[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80292.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
    1::249     1e-54  46%  251 aa  FRUR_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    1::251     3e-31  34%  251 aa  LACR_STAAW RecName: Full=Lactose phosphotransferase system
    1::251     3e-31  34%  251 aa  LACR_STAAS RecName: Full=Lactose phosphotransferase system
    1::251     3e-31  34%  251 aa  LACR_STAAC RecName: Full=Lactose phosphotransferase system
    1::251     3e-31  34%  251 aa  LACR_STAA8 RecName: Full=Lactose phosphotransferase system
    1::251     7e-31  33%  251 aa  LACR_STAAR RecName: Full=Lactose phosphotransferase system
    1::251     7e-31  33%  251 aa  LACR_STAAN RecName: Full=Lactose phosphotransferase system
    1::251     7e-31  33%  251 aa  LACR_STAAM RecName: Full=Lactose phosphotransferase system
    6::244     2e-30  34%  251 aa  LACR_STAES RecName: Full=Lactose phosphotransferase system
    6::244     2e-30  34%  251 aa  LACR_STAEQ RecName: Full=Lactose phosphotransferase system
    1::242     1e-27  32%  251 aa  LACR_STRMU RecName: Full=Lactose phosphotransferase system
    1::236     1e-26  35%  255 aa  LACR_LACLA RecName: Full=Lactose phosphotransferase system
    1::233     3e-25  31%  258 aa  GLCR_BACSU RecName: Full=HTH-type transcriptional repressor glcR;
   35::237     9e-25  30%  251 aa  IOLR_BACSU RecName: Full=HTH-type transcriptional regulator iolR;
   11::226     8e-24  31%  265 aa  YGBI_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    5::220     5e-23  31%  256 aa  Y1009_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional
    6::232     1e-21  27%  251 aa  GLPR_PSEAE RecName: Full=Glycerol-3-phosphate regulon repressor;
   48::265     2e-21  28%  269 aa  AGAR_ECOLI RecName: Full=Putative aga operon transcriptional
   48::265     2e-21  28%  269 aa  AGAR_ECOL6 RecName: Full=Putative aga operon transcriptional
   48::265     2e-21  28%  269 aa  AGAR_ECO57 RecName: Full=Putative aga operon transcriptional
   37::216     2e-19  37%  255 aa  Y1102_STAES RecName: Full=Uncharacterized HTH-type transcriptional
    1::233     2e-19  27%  252 aa  GLPR_SHIFL RecName: Full=Glycerol-3-phosphate regulon repressor;
    1::233     2e-19  27%  252 aa  GLPR_ECOLI RecName: Full=Glycerol-3-phosphate regulon repressor;
    1::222     3e-19  28%  255 aa  GLPR_HAEIN RecName: Full=Glycerol-3-phosphate regulon repressor;
    3::259     1e-18  28%  259 aa  GATR_ECOLI RecName: Full=Galactitol utilization operon repressor;
    4::249     3e-18  30%  249 aa  YCIT_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    1::249     5e-18  26%  257 aa  SRLR_ECOLI RecName: Full=Glucitol operon repressor;
    4::248     5e-18  30%  249 aa  FUCR_HAEIN RecName: Full=L-fucose operon activator;
    1::254     1e-17  25%  258 aa  YULB_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    6::236     2e-16  28%  258 aa  ACCR_AGRT5 RecName: Full=Transcriptional repressor accR;
   36::235     2e-16  26%  252 aa  YDJF_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   69::241     3e-16  29%  252 aa  DEOR_ECOLI RecName: Full=Deoxyribose operon repressor;
   69::241     3e-16  29%  252 aa  DEOR_ECOL6 RecName: Full=Deoxyribose operon repressor;
   69::241     3e-16  29%  252 aa  DEOR_ECO57 RecName: Full=Deoxyribose operon repressor;
   11::239     3e-15  24%  261 aa  YIHW_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   38::218     4e-15  30%  260 aa  SGCR_ECOLI RecName: Full=Putative sgc region transcriptional
    1::237     2e-14  26%  251 aa  ULAR_SHIDS RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_SHIBS RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_SHIB3 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOUT RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOSM RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOSE RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOLU RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOLI RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOLC RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOL6 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOL5 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOK1 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOHS RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECODH RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECOBW RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO8A RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO81 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO7I RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO5E RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO57 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO55 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO45 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO27 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     7e-14  26%  251 aa  ULAR_ECO24 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     1e-13  26%  251 aa  ULAR_SHISS RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALTY RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALTI RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALSV RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALPK RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALPC RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALPB RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALPA RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALNS RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALHS RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALEP RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALDC RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALCH RecName: Full=HTH-type transcriptional regulator ulaR;
    1::231     1e-13  25%  251 aa  ULAR_SALA4 RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     1e-13  26%  251 aa  ULAR_SALAR RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     2e-13  26%  251 aa  ULAR_SHIFL RecName: Full=HTH-type transcriptional regulator ulaR;
    1::219     2e-13  26%  251 aa  ULAR_SHIF8 RecName: Full=HTH-type transcriptional regulator ulaR;
   35::234     2e-07  23%  243 aa  FUCR_SHIFL RecName: Full=L-fucose operon activator;
   35::234     2e-07  23%  243 aa  FUCR_ECOLI RecName: Full=L-fucose operon activator;
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLANVSKELSYNE
FRUR_BACSU      MLTPERHQLIIDQIEKHDVVKIQELINLTNASESTIRRDLSTLEERGFLKRVHGGAAKLSDIRLEPDMLE
LACR_STAAW      MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGILTKIHGGARSNSTFQKEISHKE
LACR_STAAS      MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGILTKIHGGARSNSTFQKEISHKE
LACR_STAAC      MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGILTKIHGGARSNSTFQKEISHKE
LACR_STAA8      MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGILTKIHGGARSNSTFQKEISHKE
LACR_STAAR      MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGILTKIHGGARSNSTFQKEISHKE
LACR_STAAN      MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGILTKIHGGARSNSTFQKEISHKE
LACR_STAAM      MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGILTKIHGGARSNSTFQKEISHKE
LACR_STAES      -----RLDEITKLVNKRGSVRTNEIVEDLNVSDMTVRRDLAELEEKGVLTKIHGGARSNSAFQKEMSHQE
LACR_STAEQ      -----RLDEITKLVNKRGSVRTNEIVEDLNVSDMTVRRDLAELEEKGVLTKIHGGARSNSAFQKEMSHQE
LACR_STRMU      MRKEERLEEITKLINKRGTIRVTEVVERLKVSDMTVRRDLTELEGLGVLTRIHGGARS-NNIFKEMSHEE
LACR_LACLA      MNKKRRLEKILDMLKIDGTITIKEIIDELDISDMTARRDLDALEADGLLTRTHGGAQLLSSKKPEKTHIE
GLCR_BACSU      MYQEERLVAILDFLKQHNRITTEQICTLLQVSRDTARRDLVKLEEQNAIIRTRGGAILPTVHQKIQSYSG
IOLR_BACSU      -----------------------------------VRRDINKLTEKGAIEKVYGGVTSIEKTAL-VPFEN
YGBI_ECOLI      LIPVERRQIILEMVAEKGIVSIAELTDRMNVSHMTIRRDLQKLEQQGAVVLVSGGVQSPGRVAHEPSHQV
Y1009_HAEIN     MIPAERQKTLLNLISKQSVISINNLVNILGVSHMTVRRDIQKLEEDGKVISVSGGVQLLERLSSEPTHDD
GLPR_PSEAE      -----RQQSIIEEVRERGYLSIEEMAQMFAVTPQTIRRDINQLAEQGLLRRYHGGAAYDSSI-ENTAYTM
AGAR_ECOLI      -----------------------------------IRNDLAFLEKQGIAVRAYGGALICDSTSVEPSVED
AGAR_ECOL6      -----------------------------------IRNDLAFLEKQGIAVRAYGGALICDSTSVEPSVED
AGAR_ECO57      -----------------------------------IRNDLAFLEKQGIAVRAYGGALICDSTSVEPSVED
Y1102_STAES     -----------------------------------VRKDLETLENDKLITRTHGGAIQYNHINKEKSYAN
GLPR_SHIFL      MKQTQRHNGIIELVKQQGYVSTEELVEHFSVSPQTIRRDLNELAEQNLILRHHGGA-ALPSSSVNTPWHD
GLPR_ECOLI      MKQTQRHNGIIELVKQQGYVSTEELVEHFSVSPQTIRRDLNELAEQNLILRHHGGA-ALPSSSVNTPWHD
GLPR_HAEIN      MKQSLRHQKIIKLVEQSGYLSTEELVAALDVSPQTIRRDLNILAELDLIRRHHGGAASPSSAENSDYVDR
GATR_ECOLI      MNSFERRNKIIQLVNEQGTVLVQDLAGVFAASEATIRADLRFLEQKGVVTRFHGGAAKIMSETQEVGFKE
YCIT_ECOLI      -----RQQTILQMVIDQGQVSVTDLAKATGVSEVTIRQDLNTLEKLSYLRRAHGFAVSLD--SDDVETRM
SRLR_ECOLI      MKPRQRQAAILEYLQKQGKCSVEELAQYFDTTGTTIRKDLVILEHAGTVIRTYGGVV-LNKEESDPPIDH
FUCR_HAEIN      -----RDELILQWVNQQGKASVIELAQHCDISVETIRRDLNKLANKGLLHRTHGGAVS--NKTKDLGSFF
YULB_BACSU      MLVAERQQKIVEIVNMRSSIRVSELSDIFSVTEETIRRDLEKLEKEHKLSRSHGGAVSIQQKESEIHFSE
ACCR_AGRT5      --TQDRQAKIVELLRDEQFLAIGRLTEHFQISVATARRDLSELHEAGLLRRTHGGAVSVTQVTQDKPNAA
YDJF_ECOLI      -----------------------------------IRRDLEKLEDEGFLTRTYGGAVNTAMLTENIHFYK
DEOR_ECOLI      --------------------------------------------------------------------SD
DEOR_ECOL6      --------------------------------------------------------------------SD
DEOR_ECO57      --------------------------------------------------------------------SD
YIHW_ECOLI      -----RHDQLLMLIAERGYMNIDELANLLDVSTQTVRRDIRKLSEQGLITRHHGGAGRASSVVNT-AFEQ
SGCR_ECOLI      -----------------------------------VRRDFQYI--VNQYPGMIRGHGCLSTDDKEYVFDV
ULAR_SHIDS      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SHIBS      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SHIB3      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOUT      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOSM      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOSE      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOLU      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOLI      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOLC      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOL6      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOL5      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOK1      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOHS      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECODH      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECOBW      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO8A      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO81      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO7I      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO5E      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO57      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO55      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO45      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO27      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_ECO24      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SHISS      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDERGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALTY      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALTI      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALSV      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALPK      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALPC      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALPB      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALPA      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALNS      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALHS      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALEP      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALDC      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALCH      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALA4      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SALAR      MTEAQRHQILLDMLAQLGFVTVENVIERLGISPATARRDINKLDESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SHIFL      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLGESGKLKKVRNGAEAITQQRPRWTMNL
ULAR_SHIF8      MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLGESGKLKKVRNGAEAITQQRPRWTMNL
FUCR_SHIFL      -----------------------------------IRRDLNELQTQGKILRNHGRAKYIHRQNQDSGFHI
FUCR_ECOLI      -----------------------------------IRRDLNELQTQGKILRNHGRAKYIHRQNQDSGFHI


                         .         .         *         .         .         .         .:140
query           KSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQKNIKCYVIG
FRUR_BACSU      KSSKNLHDKLKIAEKAASLLEEGDCIYLDAGTTTLHMIDFMDKKDIVVVTNGVMHIDALIRKEISFYLLG
LACR_STAAW      KHTRQIAEKRFIAKKAASLIEDGDTLFFGPGTTVELLAEEVNHHTLTIITNCLPVYKILLEKHFRVYLIG
LACR_STAAS      KHTRQIAEKRFIAKKAASLIEDGDTLFFGPGTTVELLAEEVNHHTLTIITNCLPVYKILLEKHFRVYLIG
LACR_STAAC      KHTRQIAEKRFIAKKAASLIEDGDTLFFGPGTTVELLAEEVNHHTLTIITNCLPVYKILLEKHFRVYLIG
LACR_STAA8      KHTRQIAEKRFIAKKAASLIEDGDTLFFGPGTTVELLAEEVNHHTLTIITNCLPVYKILLEKHFRVYLIG
LACR_STAAR      KHTRQIAEKRFIARKAASLIEDGDTLFFGPGTTVELLAEEVNHHTLTIITNCLPVYKILLEKHFRVYLIG
LACR_STAAN      KHTRQIAEKRYIARKAASLIEDGDTLFFGPGTTVELLAEEVNHHTLTIITNCLPVYKILLEKHFRVYLIG
LACR_STAAM      KHTRQIAEKRYIARKAASLIEDGDTLFFGPGTTVELLAEEVNHHTLTIITNCLPVYKILLEKHFRVYLIG
LACR_STAES      KHTRFIEEKRFIAKNAVDLIEDGDTIFLGPGTTVQKLAEEINHYSLTIITNCLPVFNILIKKHFRVYLLG
LACR_STAEQ      KHTRFIEEKRFIAKNAVDLIEDGDTIFLGPGTTVQKLAEEINHYSLTIITNCLPVFNILIKKHFRVYLLG
LACR_STRMU      KHSRQIEEKHYIAQKAAELVEEGDTIFLGPGTTVELLAEEINKTTLQVITNCLPVFQILSQKTFRVHLLG
LACR_LACLA      KKSLNTKEKIDIAKKACSLIKDGDTIFIGPGTTLVQLALELKGRKIRVITNSLPVFLILDSETIDLLLLG
GLCR_BACSU      RLKTVSEEKNKIGRLAASLIHDGDRVILDASTTVQACAKHLNAVDCTVITNSINLADVLSDKGIEIYLLG
IOLR_BACSU      RTIQHQDEKTKIAHYASRFIEDHDLVFIDSGTTTKSILDTLDAKNVTILTNSLDIINAASAKXXXXXXXX
YGBI_ECOLI      KTALAMTQKAAIGKLAASLVQPGSCIYLDAGTTTLAIAQHLHMESLTVVTNDFVIADYLLD-NSNCTIIG
Y1009_HAEIN     KSLLATTEKTAISKKAVELIQEHSTIYLDAGTTTLEIAKQIANRDLLVITNDFV-IAHYLMVNSQCNIMG
GLPR_PSEAE      RADQMRDEKQRIAEAVASLVPDNASLFINIGTTTEAIARLLNHRNLKIITNNLHVAATLSAKDFEVLVAG
AGAR_ECOLI      KSALNTAMKRSVAKAAVELIQPGHRVILDSGTTTFEIARLMKHTDVIAMTNGMNVANALLEEGVELLMTG
AGAR_ECOL6      KSALNTAMKRSVAKAAVELIQPGHRVILDSGTTTFEIARLMKHTDVIAMTNGMNVANALLEEGVELLMTG
AGAR_ECO57      KSALNTAMKRSVAKAAVELIQPGHRVILDSGTTTFEIARLMKHTDVIAMTNGMNVANALLEEGVELLMTG
Y1102_STAES     KWQKQSQVKERIAKKAALQIKSGEIIVIDGGTTTGRIPQYLNDTQTTIVTNSLKIADELEEQRIQAEVIA
GLPR_SHIFL      RKATQTEEKERIARKVAEQIPNGSTLFIDIGTTPEAVAHLLNHSNLRIVTNNLNVANTLVKEDFRIILAG
GLPR_ECOLI      RKATQTEEKERIARKVAEQIPNGSTLFIDIGTTPEAVAHLLNHSNLRIVTNNLNVANTLVKEDFRIILAG
GLPR_HAEIN      KQFFSL-QKNNIAQEVAKLIPNGASLFIDIGTTPEAVANALLGHEKLIVTNNLNAAHLLRQNESFDIVMA
GATR_ECOLI      RFQLASAPKNRIAQAAVKMIHEGMTVILDSGSTTMLIAEGLTAKNITVITNSLPAAFALSEKDITLVVCG
YCIT_ECOLI      MSNYTL--KRELAEFAASLVQPGETIFIENGSSNALLARTLKNVTIITVSSYIAHL----LKDAPCEVIG
SRLR_ECOLI      KTLINTHKKELIAEAAVSFIHDGDSIILDAGSTVLQMVPLLSRNNITVMTNSLHIVNALSELDNEQTILG
FUCR_HAEIN      QTRKHINAKRHIAQKALDLLYENAVIGLDASSTSWYFAYLMPDIPCTVVTNSMFNINALVNKNVKTIVTG
YULB_BACSU      REITNVXXXXXXXXXXXXYVKSGDRIILDASTTAWYMAKILPDIELTVITNSMAAIELSNKENISVISTG
ACCR_AGRT5      RAVWNRAEKXXXXXXXXXXXXEGDTVLLDAGTTALEVAKKLDRRNLTFISNGLDIVEELTRGEGKIYSVG
YDJF_ECOLI      RASSFYEEKQLIARKALPFIDNKTTMAADSSSTVMELLKLLQDRSLTLLTNSAEAIHVLAQSEIKVVSTG
DEOR_ECOLI      QKSRLVEEKRRAAKLAATLVEPDQTLFFDCGTTTPWIIEAIDNEPFTAVCYSLNTFLALKEKHCRAFLCG
DEOR_ECOL6      QKSRLVEEKRRAAKLAATLVEPDQTLFFDCGTTTPWIIEAIDNEPFTAVCYSLNTFLALKEKHCRAFLCG
DEOR_ECO57      QKSRLVEEKRRAAKLAATLVEPDQTLFFDCGTTTPWIIEAIDNEPFTAVCYSLNTFLALKEKHCRAFLCG
YIHW_ECOLI      REVSQTEEKKAIAEAVADYIPDGSTIFITIGTTVEHVAALLNHNHLRIITNSLRVAHILYHNRFEVMVPG
SGCR_ECOLI      KRTLQSVAKREIAALARTMIKDGDCFFLDSGSTCLELAKCLADARVKVICNDIKIANELCFPHVESYIIG
ULAR_SHIDS      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGQEMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SHIBS      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SHIB3      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOUT      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOSM      HQAQNHDEKVRIAKAASQLVNTGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOSE      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOLU      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOLI      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOLC      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOL6      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOL5      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOK1      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOHS      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECODH      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECOBW      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO8A      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO81      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO7I      HQAQNHDEKVRIAKAASQLVNTGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO5E      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO57      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO55      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO45      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO27      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_ECO24      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SHISS      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALTY      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALTI      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALSV      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALPK      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALPC      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALPB      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALPA      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALNS      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALHS      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALEP      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALDC      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALCH      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALA4      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SALAR      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHESVIIM
ULAR_SHIFL      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
ULAR_SHIF8      HQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIM
FUCR_SHIFL      RLKSHYAHKADIAREALAWIEEGMVIALDASSTCWYLARQLPDINIQVFTNSHPICHELKRERIQLISSG
FUCR_ECOLI      RLKSHYAHKADIAREALAWIEEGMVIALDASSTCWYLARQLPDINIQVFTNSHPICHELKRERIQLISSG


                         +         .         .         .         .         *         .:210
query           GNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKF
FRUR_BACSU      GYVKHRTGAIIGGASLVAMDQYRFDKSFLGTNGVHTEAGFTTPDPDEXXXXXXXXXXXXXXYVLADPSKF
LACR_STAAW      GEMRHITEAFVGEMANAMLEKLRFSKMFFSSNAVNKG-AVMTSTLDEAYTQQLALSNSIEKYLLIDHTKV
LACR_STAAS      GEMRHITEAFVGEMANAMLEKLRFSKMFFSSNAVNKG-AVMTSTLDEAYTQQLALSNSIEKYLLIDHTKV
LACR_STAAC      GEMRHITEAFVGEMANAMLEKLRFSKMFFSSNAVNKG-AVMTSTLDEAYTQQLALSNSIEKYLLIDHTKV
LACR_STAA8      GEMRHITEAFVGEMANAMLEKLRFSKMFFSSNAVNKG-AVMTSTLDEAYTQQLALSNSIEKYLLIDHTKV
LACR_STAAR      GEMRHITEAFVGEMANAMLEKLRFSKMFFSSNAVNKG-AVMTSTLDEAYTQQLALSNSIEKYLLIDHTKV
LACR_STAAN      GEMRHITEAFVGEMANAMLEKLRFSKMFFSSNAVNKG-AVMTSTLDEAYTQQLALSNSIEKYLLIDHTKV
LACR_STAAM      GEMRHITEAFVGEMANAMLEKLRFSKMFFSSNAVNKG-AVMTSTLDEAYTQQLALSNSIEKYLLIDHTKV
LACR_STAES      GEMRDLTEAFVGEMTNQLLSQLRFSKMFFSSNGVKDGLAMTS-SIEEAYTQQIALSHSLEKYLLIDSSKI
LACR_STAEQ      GEMRDLTEAFVGEMTNQLLSQLRFSKMFFSSNGVKDGLAMTS-SIEEAYTQQIALSHSLEKYLLIDSSKI
LACR_STRMU      GEMRSITQSFIGEITNIVLEKMHFSKMFFSGNGVKGNEVMTS-SFQEAYTQKMALGRAIEKYLLIDSSKI
LACR_LACLA      GEYREITGAFVGSMASTNLKAMRFAKAFVRANAVTHN-SIATYSDKEGVIQQLALNNAVEKFLLVDSTKF
GLCR_BACSU      GKLEKEHRFLYGSSVIEKLSSYHVDKALIGVVGISE-HGITIAHEEDGMVKRKMIQQAKQVIALADHSKL
IOLR_BACSU      XXYKRKTRSFVGMDDPAMLDKYNINKAFMSATGTTLTHGLTNSDLLEYEIKKRISEKAKEVYLLADHSKF
YGBI_ECOLI      GAVCRENRSCVGEAAATMLRSLMIDQAFISASS-WSVRGISTPAEDKVTVKRAIASASRQRVLVCDATKY
Y1009_HAEIN     GLINKSNRSSVGEFAAQFLHQISVDIAFISTSS-WNLKGLTTPDEQKIPVKKAIIQFSQKNILVTDSSKY
GLPR_PSEAE      GTVR-SDGGIVGQAAVDFIQQFRVDFALVGISGIDEDGSLLDFDYQEVRVSQAIIDNARQVFLAADSSKF
AGAR_ECOLI      GHLRRQSQSFYGDQAEQSLQNYHFDMLFLGVDAIDLERGVSTHNEDEARLNRRMCEVAERIIVVTDSSKF
AGAR_ECOL6      GHLRRQSQSFYGDQAEQSLQNYHFDMLFLGVDAIDLERGVSTHNEDEARLNRRMCEVAERIIVVTDSSKF
AGAR_ECO57      GHLRRQSQSFYGDQAEQSLQNYHFDMLFLGVDAIDLERGVSTHNEDEARLNRRMCEVAERIIVVTDSSKF
Y1102_STAES     GKTNTEQDVVRGHMTNELLQRFKFDKAFISC-GSFDTSDCYEFDLEEAHASHIMIQKSQLSYLLADSSK-
GLPR_SHIFL      GELRSRDGGIIGEATLDFISQFRXXXXXXXXXXXXXXXXXXEFDYHEVRTKRAIIENSRHVMLVVDHSKF
GLPR_ECOLI      GELRSRDGGIIGEATLDFISQFRXXXXXXXXXXXXXXXXXXEFDYHEVRTKRAIIENSRHVMLVVDHSKF
GLPR_HAEIN      GGSLRMDGGIIGEATVNFISQFRLDFGILGISAIDADGSLLDYDYHEVQVKRAIIESSRQTLLVADHSKF
GATR_ECOLI      GTVRHKTRSMHGSIAERSLQDINADLMFVGADGIDAVNGITT-FNEGYSISGAMVTAANKVIAVLDSSKF
YCIT_ECOLI      GVYQKKSESMVGPLTRQCIQQVHFSKAFIGIDGWQPETGFTGRDMMRTDVVNAVLEKECEAIVLTDSSKF
SRLR_ECOLI      GTFRKKSASFHGQLAENAFEHFTFDKLFMGTDGIDLNAGVTT-FNEVYTVSKAMCNAAREVILMADSSKF
FUCR_HAEIN      GVYSAKYEAFYGPLSEYLLQRLHINFSVFSCSGIDKNGNIWESNELNASLKRKMMEASERAYLLIDSSKF
YULB_BACSU      GILLEKSLSFAGPLAERSLETYHVNKTFLSCKGFDVHNGMSDSNEWQALLKKRMIERSDQTILMADSSKW
ACCR_AGRT5      GEYTETNRSFRGPLAEQFIRQFNVDKLILNAASIDVDRGLCTSSPVNASVARAMIEVSSRVIVVADHSKF
YDJF_ECOLI      GELNKNTLSLQGRITKEIIRRYHVDIMVMSCKGLDINSGALDSNEAEAEIKKTMIRQATEVALLVDHSKF
DEOR_ECOLI      GEFHASNAIFKPIDFQQTLNNFCPDIAFYSAAGVHVSKGATCFNLEELPVKHWAMSMAQKHVLVVDHSKF
DEOR_ECOL6      GEFHASNAIFKPIDFQQTLNNFCPDIAFYSAAGVHVSKGATCFNLEELPVKHWAMSMAQKHVLVVDHSKF
DEOR_ECO57      GEFHASNAIFKPIDFQQTLNNFCPDIAFYSAAGVHVSKGATCFNLEELPVKHWAMSMAQKHVLVVDHSKF
YIHW_ECOLI      GTLRSHNSGIIGPSAASFVADFRADYLVTSVGAIESDGALMEFDVNEANVVKTMMAHARNILLVADHTKY
SGCR_ECOLI      GLIRPGYFSVGESLALEMINAFSVERAFISCDALSLETGITNATMFEVGVKTRIIQRSREVILMADHSKF
ULAR_SHIDS      GGQYNKSQSITLSPQGSENSLYAGHWMFTSSKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_SHIBS      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_SHIB3      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOUT      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOSM      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOSE      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOLU      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOLI      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOLC      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOL6      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOL5      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOK1      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOHS      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECODH      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECOBW      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO8A      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO81      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO7I      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO5E      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO57      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO55      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO45      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO27      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_ECO24      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_SHISS      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_SALTY      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALTI      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALSV      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALPK      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALPC      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALPB      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALPA      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALNS      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALHS      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALEP      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALDC      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALCH      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALA4      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SALAR      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TADGLYKTDMLTAMAEQKMLSVVGKLVALVDSSKI
ULAR_SHIFL      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
ULAR_SHIF8      GGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGL-TAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKI
FUCR_SHIFL      GTLERKYGCYVNPSLISQLKSLEIDLFIFSCEGIDSSGALWDSNAINADYKSMLLKRAAQSLLLIDKSKF
FUCR_ECOLI      GTLERKYGCYVNPSLISQLKSLEIDLFIFSCEGIDSSGALWDSNAINADYKSMLLKRAAQSLLLIDKSKF


                         .         .         .         +         .         .         .:280
query           GEISTIKFSDINKCVIITNEKPKDNTYDKKTDIKVVDI
FRUR_BACSU      GEISFSAFAGIGDATIITTEELTFDNYQEKTVVKVV--
LACR_STAAW      GKEDFTSFCQLNETAVVMDYEDEEKVETIKTYIEVVD-
LACR_STAAS      GKEDFTSFCQLNETAVVMDYEDEEKVETIKTYIEVVD-
LACR_STAAC      GKEDFTSFCQLNETAVVMDYEDEEKVETIKTYIEVVD-
LACR_STAA8      GKEDFTSFCQLNETAVVMDYEDEEKVETIKTYIEVVD-
LACR_STAAR      GKEDFTSFCQLNETAVVMDYEDEEKVETIKTYIEVVD-
LACR_STAAN      GKEDFTSFCQLNETAVVMDYEDEEKVETIKTYIEVVD-
LACR_STAAM      GKEDFTSFCQLNETAVVMDYEDEEKVETIKTYIEVVD-
LACR_STAES      GKDDFSSFCELRELNAVLTD---NNDLEKKEKIE----
LACR_STAEQ      GKDDFSSFCELRELNAVLTD---NNDLEKKEKIE----
LACR_STRMU      GKEDFTSFYQLSQLTALITDCQDDDKLQK---------
LACR_LACLA      DRYDFFNFYNLDQLTIITDNQ-----------------
GLCR_BACSU      GSTSFYQYAELNEILLITDRLP----------------
IOLR_BACSU      GKSTLLTYAPFDRLHCIVTSQPLDDEY-----------
YGBI_ECOLI      GQVAT---------------------------------
Y1009_HAEIN     GKVAT---------------------------------
GLPR_PSEAE      GRNAVVRLGPISLVNRVISDSP----------------
AGAR_ECOLI      NRSSLHKIIDTQRMIIVDEGIPADSLEGRKAGVEVI--
AGAR_ECOL6      NRSSLHKIIDTQRMIIVDEGIPADSLEGRKAGVEVI--
AGAR_ECO57      NRSSLHKIIDTQRMIIVDEGIPADSLEGRKAGVEVI--
Y1102_STAES     --------------------------------------
GLPR_SHIFL      GRNAMVNMGSISMVDAVYTDAP----------------
GLPR_ECOLI      GRNAMVNMGSISMVDAVYTDAP----------------
GLPR_HAEIN      TRQAIVRLGELS--------------------------
GATR_ECOLI      NRRGFNQVLPIEKIIIITDDSEVDKLALQKTRVKLITV
YCIT_ECOLI      GAVHSYSIGPVERFRVITDSKIRASDLHSKLTIHVVDI
SRLR_ECOLI      GRKSPNVVCSLESVDKLITDAGIDPAFRQALEEKGIDV
FUCR_HAEIN      EKTSLIQLADLSKITIFSDRSLPDNKYCEQHDIMTV--
YULB_BACSU      GEFSHISLQDVSRLITDSGLDPASALEDKKVKVTAVPL
ACCR_AGRT5      TKSSTARIEDVG--VIVTD-------------------
YDJF_ECOLI      DRKAFVQLADFSHIYIITDKSP----------------
DEOR_ECOLI      GKVRPARMGDLKRFDIVVSDCCPEDEYVK---------
DEOR_ECOL6      GKVRPARMGDLKRFDIVVSDCCPEDEYVK---------
DEOR_ECO57      GKVRPARMGDLKRFDIVVSDCCPEDEYVK---------
YIHW_ECOLI      HASAAVEIGNVAQTALFTDELP----------------
SGCR_ECOLI      DAV-----------------------------------
ULAR_SHIDS      GERAGMLFSRADQIMLITGKNANPET------------
ULAR_SHIBS      GERAGMLFS-----------------------------
ULAR_SHIB3      GERAGMLFS-----------------------------
ULAR_ECOUT      GERAGMLFS-----------------------------
ULAR_ECOSM      GERAGMLFS-----------------------------
ULAR_ECOSE      GERAGMLFS-----------------------------
ULAR_ECOLU      GERAGMLFS-----------------------------
ULAR_ECOLI      GERAGMLFS-----------------------------
ULAR_ECOLC      GERAGMLFS-----------------------------
ULAR_ECOL6      GERAGMLFS-----------------------------
ULAR_ECOL5      GERAGMLFS-----------------------------
ULAR_ECOK1      GERAGMLFS-----------------------------
ULAR_ECOHS      GERAGMLFS-----------------------------
ULAR_ECODH      GERAGMLFS-----------------------------
ULAR_ECOBW      GERAGMLFS-----------------------------
ULAR_ECO8A      GERAGMLFS-----------------------------
ULAR_ECO81      GERAGMLFS-----------------------------
ULAR_ECO7I      GERAGMLFS-----------------------------
ULAR_ECO5E      GERAGMLFS-----------------------------
ULAR_ECO57      GERAGMLFS-----------------------------
ULAR_ECO55      GERAGMLFS-----------------------------
ULAR_ECO45      GERAGMLFS-----------------------------
ULAR_ECO27      GERAGMLFS-----------------------------
ULAR_ECO24      GERAGMLFS-----------------------------
ULAR_SHISS      GERAGMLFS-----------------------------
ULAR_SALTY      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALTI      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALSV      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALPK      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALPC      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALPB      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALPA      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALNS      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALHS      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALEP      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALDC      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALCH      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALA4      GERAGMLFSRADQIAMLITGK-----------------
ULAR_SALAR      GERAGMLFS-----------------------------
ULAR_SHIFL      GERAGMLFS-----------------------------
ULAR_SHIF8      GERAGMLFS-----------------------------
FUCR_SHIFL      NRSGEARIGHLDEVTIISDER-----------------
FUCR_ECOLI      NRSGEARIGHLDEVTIISDER-----------------