[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80503.1

[Show Plain Result]


## Summary of Sequence Search
    1::193
    1::186     1e-23  32%  193 aa  YWOA_BACSU RecName: Full=Uncharacterized protein ywoA;
    9::148     1e-13  29%  203 aa  BCRC_BACLI RecName: Full=Bacitracin transport permease protein
  152::318     4e-11  29%  330 aa  Y374_METJA RecName: Full=Uncharacterized protein MJ0374;
   47::180     2e-10  33%  206 aa  UDDP_SULAC RecName: Full=Undecaprenyl-diphosphatase;       
   54::159     7e-10  29%  198 aa  YBJG_ECOLI RecName: Full=Putative undecaprenyl-diphosphatase ybjG; 
  148::234     6e-06  38%  241 aa  PGPB_HAEIN RecName: Full=Phosphatidylglycerophosphatase B;       
  184::278     5e-04  30%  441 aa  SGPP1_HUMAN RecName: Full=Sphingosine-1-phosphate phosphatase 1;   
    1::193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNFWNDIFNSINGLAGKNHLLDSIMLFSSKRLPYILFATVIVVYLIGIISKNKKARGIAVDTIVFTGINL
YWOA_BACSU      MNY--EIFKAIHGLSHHNSVLDSIMVFITEYXXXXXXXXXXXXXXFGNTQSRKHVLYAGITGIAGLVINY
BCRC_BACLI      -----DAFRFINDLGKEYSMLNPVVYFLAEYMMYFLALGLVVYWL----TRTTKNRLMVIYAVIAFVVAE
Y374_METJA      --YFGDVLGNINRLSDYNYIFDAIMPIISKTAYPLIAITSLIIFI-----KNRK---FGMKXXXXXXXXX
UDDP_SULAC      --------------------LNGLMVFLSKYGREYVWIPVTALLLIF-----KRTRKIGITLVISFVIAI
YBJG_ECOLI      -------------------------------------------------------RQLVIKIAIALAVSL
PGPB_HAEIN      ----------------------------------------------------------------------
SGPP1_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ILAVIVGHFFYAPRPFVNDPNAKLLYPHKPDSSFPSGHSVGSMSIALGLNRYNKALGTICVILSILMGIS
YWOA_BACSU      LITLV----YFEPRPFVAH-TVHTLIPHAADASFPSDHTTGALAISIAMLFRNRKIGWPLVIFGLLTGFS
BCRC_BACLI      ILGKIMGSLHSNYQPFATLPNVNKLIEHEIDNSFPSDHTXXXXXXXXXXXXXHKKTGWLWLVLAFAVGIS
Y374_METJA      XXXXXXKYLVNEPRPYLVLDNVHLLCNEGNEPSFPSGHXXXXXXXXXXXXXYSKKLGILFLSWAIIVAYS
UDDP_SULAC      VLGEVSKYVMAQLRPFNFVNPTYLLEPKPTDYSYPSGHSTGAVTLLLTSPKWMWILG---IIEAVLVSYS
YBJG_ECOLI      FVSWTMGHLFPHDRPFVENIGYNFLH-HAADDSFPSDHGTVIFTFALAFLCWHRLWGSLLMVLAVVIAWS
PGPB_HAEIN      -------------------------YENETGYSFPSGHTIFALMLAVGFNRSFKALVVGIAVWGLLMLIS
SGPP1_HUMAN     ------------PRP-ASPPVVKLEVFYNSEYSMPSTHAMSGTAIPIGRWQYPLIYGLILICWCSLVCLS


                         +         .         .         .         .         *         .:210
query           RVYVGHHYPQHVVASFLIVIILNVLYMKFLSKSVQKLYFSIEKHIPILNKLVK
YWOA_BACSU      RIWVGHHYPVDVLGSLVVAIIIGFLFFRFSDLLRPFVDLVVRIYEAIINKLTK
BCRC_BACLI      RIWSGVHYP--------------------------------------------
Y374_METJA      RVYVGVHYPLDVLAGMIIGIFCGCL----------------------------
UDDP_SULAC      RVYVGVHWPLDVIAGWLL-----------------------------------
YBJG_ECOLI      RVYLGVHWPLDMLGGLLAGMI--------------------------------
PGPB_HAEIN      RVRLGMHYPIDLLVATLLAWLINSIIFAFLKK---------------------
SGPP1_HUMAN     RIYMGMHSILDIIAGFLYTILILAVFYPFV-----------------------