[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80551.1

[Show Plain Result]


## Summary of Sequence Search
    1::203
 3414::3531    2e-04  23% 4367 aa  DYHC_NEUCR RecName: Full=Dynein heavy chain, cytoplasmic;AltName:
  319::443     4e-04  26%  507 aa  PUR9_BACTN RecName: Full=Bifunctional purine biosynthesis protein
   62::171     8e-04  27%  340 aa  ILVC_CAMLR RecName: Full=Ketol-acid reductoisomerase;       
 3492::3601    0.001  32% 4730 aa  DYHC_DICDI RecName: Full=Dynein heavy chain, cytoplasmic;AltName:
    1::203

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxFFTLPIDKNVYANDLKNEGKYQDEIVLLDEEIYLDKEQLELFKQNALVEEKN
DYHC_NEUCR      ----------------------------YAEILDRVGPLREEVMLLEEQALQTKAEAKAVEQTISTLE-N
PUR9_BACTN      ------------------FFEVIIAPDYDVDALEILGQKKNRIILVRKEAKLPKKQFRALLNGVLVQDKD
ILVC_CAMLR      --------------------------NFIVKSVKEATKEADLIMILAP----DEIQSEIFNEEIKPELKA
DYHC_DICDI      ----------------------------------------DRIKPLREEV----EQLEKLKQDEIVATIT


                         .         .         *         .         .         .         .:140
query           SLGRSFSSDYNTYVQKSVSKSEAIQIISAYDKVTGMIDNLGFTIGGSTLVASISKSSRYRNAKNFITKYG
DYHC_NEUCR      SIAR-YKTEYAALISETQAKAEMSRVQFKVDRSVKLLDSL-----------SSERTRWEEGSRSFETQIS
PUR9_BACTN      -MNIETVADLRTVTDKAPTPEEVEDLLFANKIVKNSKSNAIVLAKGKQLLASVGQTSRVDALKQAIEKAK
ILVC_CAMLR      GKTLAFAHGFNIHYGQIVAP-KGIDVIMIAPKAPGHTVRHEFSIGGGTPCLIAIHQDESKNAKNLALSYA
DYHC_DICDI      ALEKSYKEEYATLIRETEQKTESSKVKNKVDRSIALLDNLN------------SERGRWQQSENFNTQMS


                         +         .         .         .         .         *         .:210
query           SWGGNIILVTSFVAYKSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DYHC_NEUCR      TLVGDVLVAAAFLAYSGL---------------------------------------------
PUR9_BACTN      SFG------------------------------------------------------------
ILVC_CAMLR      S--------------------------------------------------------------
DYHC_DICDI      TVVGDVVLASAFLAY------------------------------------------------