[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80582.1

[Show Plain Result]


## Summary of Sequence Search
    1::147
   93::152     7e-07  35%  177 aa  TTR_PSESZ RecName: Full=Acetyltransferase;       
    6::136     6e-06  25%  142 aa  Y1711_SODGM RecName: Full=Acetyltransferase SG1711;       
    6::135     2e-05  28%  141 aa  YPEA_SHIBS RecName: Full=Acetyltransferase ypeA;       
    6::124     2e-05  29%  141 aa  YPEA_SALTY RecName: Full=Acetyltransferase ypeA;       
    6::124     2e-05  29%  141 aa  YPEA_SALTI RecName: Full=Acetyltransferase ypeA;       
    6::124     2e-05  29%  141 aa  YPEA_SALPA RecName: Full=Acetyltransferase ypeA;       
    6::124     2e-05  29%  141 aa  YPEA_SALCH RecName: Full=Acetyltransferase ypeA;       
    6::124     3e-05  29%  141 aa  YPEA_SHISS RecName: Full=Acetyltransferase ypeA;       
    6::124     3e-05  29%  141 aa  YPEA_SHIFL RecName: Full=Acetyltransferase ypeA;       
    6::124     3e-05  29%  141 aa  YPEA_SHIF8 RecName: Full=Acetyltransferase ypeA;       
    6::124     3e-05  29%  141 aa  YPEA_SHIDS RecName: Full=Acetyltransferase ypeA;       
    6::124     3e-05  29%  141 aa  YPEA_ECOUT RecName: Full=Acetyltransferase ypeA;       
    6::124     3e-05  29%  141 aa  YPEA_ECOL6 RecName: Full=Acetyltransferase ypeA;       
    6::124     3e-05  29%  141 aa  YPEA_ECOK1 RecName: Full=Acetyltransferase ypeA;       
    6::124     3e-05  29%  141 aa  YPEA_ECO57 RecName: Full=Acetyltransferase ypeA;       
    6::124     4e-05  30%  141 aa  YPEA_ECOLI RecName: Full=Acetyltransferase ypeA;       
    6::124     6e-05  29%  141 aa  YPEA_ECOL5 RecName: Full=Acetyltransferase ypeA;       
    6::124     8e-05  26%  141 aa  Y875_ERWCT RecName: Full=Acetyltransferase ECA0875;       
   61::150     8e-05  30%  156 aa  HPA2_YEAST RecName: Full=Histone acetyltransferase HPA2;       
    6::135     1e-04  26%  141 aa  Y3031_YERPE RecName: Full=Uncharacterized N-acetyltransferase
    6::135     1e-04  26%  141 aa  Y2753_YERPS RecName: Full=Acetyltransferase YPTB2753;       
    6::135     1e-04  26%  141 aa  Y2219_YERPA RecName: Full=Acetyltransferase YPA_2219;       
    6::135     1e-04  26%  141 aa  Y2136_YERPP RecName: Full=Acetyltransferase YPDSF_2136;       
    6::135     1e-04  26%  141 aa  Y1354_YERPN RecName: Full=Acetyltransferase YPN_1354;       
   10::147     2e-04  29%  172 aa  PAIA_BACSU RecName: Full=Protease synthase and sporulation negative
    6::135     2e-04  26%  141 aa  Y1169_YERE8 RecName: Full=Acetyltransferase YE1169;       
   44::122     3e-04  33%  159 aa  YXBD_BACSU RecName: Full=Uncharacterized protein yxbD;
  374::428     5e-04  42%  521 aa  SYM_UREPA RecName: Full=Methionyl-tRNA synthetase;       
    1::147

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxFKKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEKIEGVILGNLE
TTR_PSESZ       ----------------------------------------------------------------------
Y1711_SODGM     ------FRHDDFEEVITLWERCDLLRPWNDPMDIERKLNHDPDLFLVA-----------EVAGEVVGSIM
YPEA_SHIBS      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_SALTY      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKVNHDVSL---FLVA------EVSGEVVGTVM
YPEA_SALTI      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKVNHDVSL---FLVA------EVSGEVVGTVM
YPEA_SALPA      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKVNHDVSL---FLVA------EVSGEVVGTVM
YPEA_SALCH      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKVNHDVSL---FLVA------EVSGEVVGTVM
YPEA_SHISS      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_SHIFL      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_SHIF8      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_SHIDS      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_ECOUT      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_ECOL6      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_ECOK1      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_ECO57      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
YPEA_ECOLI      ------FRQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVAEVNGD--VVGTVMGG--
YPEA_ECOL5      ------FHQEDFEEVITLWERCDLLRPWNDP-EMDIERKMNHDVSL---FLVA------EVNGEVVGTVM
Y875_ERWCT      ------FRQDDFEAVITLWERCDLLRPWNDPMDIERKLNHDPDLFLVA-----------EVNGEIVGSVM
HPA2_YEAST      ----------------------------------------------------AVESSSEKIIGMIFNHMT
Y3031_YERPE     ------FQQDDFEEVILLWEHCDLLRPWNDPMDIERKLNHDPELFLVA-----------EVNGTIVGSVM
Y2753_YERPS     ------FQQDDFEEVILLWEHCDLLRPWNDPMDIERKLNHDPELFLVA-----------EVNGTIVGSVM
Y2219_YERPA     ------FQQDDFEEVILLWEHCDLLRPWNDPMDIERKLNHDPELFLVA-----------EVNGTIVGSVM
Y2136_YERPP     ------FQQDDFEEVILLWEHCDLLRPWNDPMDIERKLNHDPELFLVA-----------EVNGTIVGSVM
Y1354_YERPN     ------FQQDDFEEVILLWEHCDLLRPWNDPMDIERKLNHDPELFLVA-----------EVNGTIVGSVM
PAIA_BACSU      --------REDLQTLQQLSIETFN-DTFKEQNSPENMKAYLESAFNTEQLEKELIYFDHEIAGYVKVNID
Y1169_YERE8     ------FQQSDFEEVILLWEHCDLLRPWNDPMDIERKLNHDPELFLVA-----------EVSGAIVGSVM
YXBD_BACSU      -----------------------------------------------------MLNDDNQIVGLIT----
SYM_UREPA       -------------------------------------KKYRNNIV--PKYVGCVLKNDEKLENLINKNIE


                         .         .         *         .         .         .         .:140
query           QWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMKGSTAEAFYNKRGYEIPKELI
TTR_PSESZ       ---------VQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGEL-
Y1711_SODGM     GGYDGHRGAAYYLGVHPDYRGRGIANALISRLEKKLIARGCPKINLMVRGDNDAVSMYEKLEYEMQDSVL
YPEA_SHIBS      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE-HADML
YPEA_SALTY      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDNDVVLGMYERLGYE------
YPEA_SALTI      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDNDVVLGMYERLGYE------
YPEA_SALPA      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDNDVVLGMYERLGYE------
YPEA_SALCH      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDNDVVLGMYERLGYE------
YPEA_SHISS      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_SHIFL      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_SHIF8      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_SHIDS      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_ECOUT      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_ECOL6      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_ECOK1      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_ECO57      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_ECOLI      --YDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
YPEA_ECOL5      GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPENDMVLGMYERLGYE------
Y875_ERWCT      GGYDGHRGSAYYLGVHPDFRGRGIANALISRLEKKLIARGCPKIHLMVREDNDAVGMYEKLEYE------
HPA2_YEAST      TWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNRAQLLYVKVGYKAPKIL-
Y3031_YERPE     GGYDGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVGMYEKLDYE-TQDTI
Y2753_YERPS     GGYDGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVGMYEKLDYE-TQDTI
Y2219_YERPA     GGYDGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVGMYEKLDYE-TQDTI
Y2136_YERPP     GGYDGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVGMYEKLDYE-TQDTI
Y1354_YERPN     GGYDGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVGMYEKLDYE-TQDTI
PAIA_BACSU      EEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLWE-KNENAIAFYKKMGF-------
Y1169_YERE8     GGYDGHRGSAYYLGVHPDFRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVGMYEKLDYE-TQDTI
YXBD_BACSU      --YIFEEDACEIISLDSVIENKGIGTALLEKAEEACRERNIKQIKLITTNDNIALAFYQKRGYRLDR---
SYM_UREPA       LVQEN----INKYSID----------KALNCIQEILVE--------------------------------


                         +         .         .         .         .         *         .:210
query           MMRKKLx
TTR_PSESZ       -------
Y1711_SODGM     LLGKRL-
YPEA_SHIBS      SLGKRL-
YPEA_SALTY      -------
YPEA_SALTI      -------
YPEA_SALPA      -------
YPEA_SALCH      -------
YPEA_SHISS      -------
YPEA_SHIFL      -------
YPEA_SHIF8      -------
YPEA_SHIDS      -------
YPEA_ECOUT      -------
YPEA_ECOL6      -------
YPEA_ECOK1      -------
YPEA_ECO57      -------
YPEA_ECOLI      -------
YPEA_ECOL5      -------
Y875_ERWCT      -------
HPA2_YEAST      -------
Y3031_YERPE     MLGKRL-
Y2753_YERPS     MLGKRL-
Y2219_YERPA     MLGKRL-
Y2136_YERPP     MLGKRL-
Y1354_YERPN     MLGKRL-
PAIA_BACSU      -------
Y1169_YERE8     MLGKRL-
YXBD_BACSU      -------
SYM_UREPA       -------