[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80612.1

[Show Plain Result]


## Summary of Sequence Search
    1::252
   79::182     2e-05  33%  208 aa  Y935_METJA RecName: Full=Uncharacterized protein MJ0935;
  377::483     4e-04  36%  703 aa  WIT1_ARATH RecName: Full=WPP domain-interacting tail-anchored
  164::260     0.001  35%  284 aa  Y066_SULSO RecName: Full=UPF0103 protein SSO0066;
    1::252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxMDYEKLVEFLVDEIYKRIQEENNKSNSLEKRKSIVVIGESNVSFYREALKGFDINPLTSECKD
Y935_METJA      ----------------------------------------------------------------------
WIT1_ARATH      ----------------------------------------------------------------------
Y066_SULSO      -------MQTPEIAEFLADAIYKVIQKYSD--------KDIVVLASSDMNHY-------DPHEITMKKDE


                         .         .         *         .         .         .         .:140
query           CDILLISKLCIKGLSNIAQGTCTTKAENFALEMLLKGKKVYILEDGIEYRKYKNTAPKVLYNKYIKFEEE
Y935_METJA      -----------------------------SLEALIKGNKIVLCDDNI-YRDFENVYGKYKINEY---SDK
WIT1_ARATH      -----------------------------------------------------NTENSTLSEKVSSLEEQ
Y066_SULSO      EAIEKIQQLDYRGLYEVVEGKDVTLCGYGPIMVSLLGKKAYILK--------------------------


                         +         .         .         .         .         *         .:210
query           LLAYGIEVIDDLNRISIESKDEKVSLSGIKEEISKNLCLCSENKVEGKKDLDTTAIADEFTINLSNKKLV
Y935_METJA      AISLLLEILKHYNIKAVIYLDAQVSKSGIKKIREKMKAFSIEGEVFCVKNCD---------YELKNKEVV
WIT1_ARATH      LNEYGIQLITDLERINEELKDKLAKTEARAEETESKCKILEESKKELQDELGN--FRDKFTIHASLEKHL
Y066_SULSO      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SESDLRKPHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y935_METJA      ATSD--------------------------------------
WIT1_ARATH      RDSDLQLEH---------------------------------
Y066_SULSO      ------------------------------------------