[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80734.1

[Show Plain Result]


## Summary of Sequence Search
    1::113
   12::101     2e-11  37%  127 aa  Y666_PYRAB RecName: Full=UPF0166 protein PYRAB06660;
   12::101     2e-11  37%  127 aa  Y1503_PYRHO RecName: Full=UPF0166 protein PH1503;
    3::65      4e-09  44%  108 aa  Y1524_METJA RecName: Full=UPF0166 protein MJ1524;
   11::70      2e-06  32%  114 aa  Y7045_STRCO RecName: Full=UPF0166 protein SCO7045;
    4::63      3e-06  41%  102 aa  Y021_THEMA RecName: Full=UPF0166 protein TM_0021;
    5::68      1e-05  33%  105 aa  Y450_AQUAE RecName: Full=UPF0166 protein aq_450;
    1::113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLPX
Y666_PYRAB      ---------LRIYIGENDRWEGKPLYKAIVEKLREMGIAGATVYRGIYGFGKKSRIHSSDVLRLSTDLPI
Y1503_PYRHO     ---------LRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGKKSRVHSSDVIRLSTDLPI
Y1524_METJA     -----KAKILKIYLREGDKFEGELMYKHIMKILKREGISGATVYKGICGYGVRGVAEFDIFR-LSVNLP-
Y7045_STRCO     ---------LTVYVGENDTWHHRPLYSEIVHRAHAAGLAGASVFRGVEGFGASSIVHTTRLLSLSEDLP-
Y021_THEMA      ---------LKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHKRHMHSDFFS-LSPDLP-
Y450_AQUAE      -----KKKLLRIFTSEDESFEGKPFYKYLLERAKERGLEGATVFRAIAGYGKTKEIRKHKLFQLRSSLP-


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXPMIETGTITVxxxxxxxxxxxxxx
Y666_PYRAB      VIEVVDRGHNIEKAVNVIKPMIKDGMITV--------------
Y1503_PYRHO     IVEVVDRGHNIEKVVNVIKPMIKDGMITV--------------
Y1524_METJA     -------------------------------------------
Y7045_STRCO     -------------------------------------------
Y021_THEMA      -------------------------------------------
Y450_AQUAE      -------------------------------------------