[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81009.1

[Show Plain Result]


## Summary of Sequence Search
    1::397
    1::397       0.0 100%  397 aa  PGK_CLOPE RecName: Full=Phosphoglycerate kinase;       
    1::397       0.0 100%  397 aa  PGK_CLOP1 RecName: Full=Phosphoglycerate kinase;       
    1::397       0.0 100%  397 aa  PGK_CLOPS RecName: Full=Phosphoglycerate kinase;       
    1::396       0.0  85%  396 aa  PGK_CLOBA RecName: Full=Phosphoglycerate kinase;       
    1::396       0.0  85%  396 aa  PGK_CLOBB RecName: Full=Phosphoglycerate kinase;       
    1::398       0.0  81%  398 aa  PGK_CLOBH RecName: Full=Phosphoglycerate kinase;       
    1::398       0.0  81%  398 aa  PGK_CLOB1 RecName: Full=Phosphoglycerate kinase;       
    1::398       0.0  81%  398 aa  PGK_CLOBL RecName: Full=Phosphoglycerate kinase;       
    1::398       0.0  81%  398 aa  PGK_CLOB6 RecName: Full=Phosphoglycerate kinase;       
    1::398       0.0  81%  398 aa  PGK_CLOBK RecName: Full=Phosphoglycerate kinase;       
    1::398       0.0  81%  398 aa  PGK_CLOBJ RecName: Full=Phosphoglycerate kinase;       
    1::398       0.0  80%  398 aa  PGK_CLOBM RecName: Full=Phosphoglycerate kinase;       
    6::401       0.0  78%  401 aa  PGK_CLOTE RecName: Full=Phosphoglycerate kinase;       
    1::397     e-179  79%  397 aa  PGK_CLOAB RecName: Full=Phosphoglycerate kinase;       
    1::398     e-178  79%  398 aa  PGK_CLONN RecName: Full=Phosphoglycerate kinase;       
    1::391     e-176  80%  391 aa  PGK_CLOB8 RecName: Full=Phosphoglycerate kinase;       
    1::398     e-175  75%  398 aa  PGK_CLOK5 RecName: Full=Phosphoglycerate kinase;       
    1::398     e-175  75%  398 aa  PGK_CLOK1 RecName: Full=Phosphoglycerate kinase;       
    5::400     e-171  76%  400 aa  PGK_CLOD6 RecName: Full=Phosphoglycerate kinase;       
    3::394     e-134  61%  394 aa  PGK_THETN RecName: Full=Phosphoglycerate kinase;       
    2::394     e-131  59%  394 aa  PGK_EXIS2 RecName: Full=Phosphoglycerate kinase;       
    5::388     e-126  59%  392 aa  PGK_SYMTH RecName: Full=Phosphoglycerate kinase;       
    2::394     e-126  58%  394 aa  PGK_BACSU RecName: Full=Phosphoglycerate kinase;       
    2::395     e-125  54%  395 aa  PGK_FINM2 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-125  57%  394 aa  PGK_BACCN RecName: Full=Phosphoglycerate kinase;       
    2::394     e-125  57%  394 aa  PGK_BACP2 RecName: Full=Phosphoglycerate kinase;       
    3::404     e-124  59%  404 aa  PGK_LACSS RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_BACHK RecName: Full=Phosphoglycerate kinase;       
    2::393     e-124  57%  393 aa  PGK_OCEIH RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_BACLD RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_ANOFW RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_BACC3 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_BACC0 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_BACAH RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_BACAN RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_BACAC RecName: Full=Phosphoglycerate kinase;       
    2::394     e-124  57%  394 aa  PGK_BACAA RecName: Full=Phosphoglycerate kinase;       
    2::394     e-123  57%  394 aa  PGK_BACC7 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-123  57%  394 aa  PGK_BACC2 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-123  57%  394 aa  PGK_BACCQ RecName: Full=Phosphoglycerate kinase;       
    2::394     e-123  57%  394 aa  PGK_BACME RecName: Full=Phosphoglycerate kinase;       
    2::394     e-123  57%  394 aa  PGK_BACCZ RecName: Full=Phosphoglycerate kinase;       
    3::396     e-123  57%  397 aa  PGK_CHLT3 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-123  57%  394 aa  PGK_BACC4 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-123  57%  394 aa  PGK_BACWK RecName: Full=Phosphoglycerate kinase;       
    2::394     e-123  57%  394 aa  PGK_BACC1 RecName: Full=Phosphoglycerate kinase;       
    3::397     e-123  57%  402 aa  PGK_THEM4 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-122  57%  394 aa  PGK_GEOKA RecName: Full=Phosphoglycerate kinase;       
    3::393     e-122  57%  393 aa  PGK_MOOTA RecName: Full=Phosphoglycerate kinase;       
    2::394     e-122  56%  394 aa  PGK_GEOSW RecName: Full=Phosphoglycerate kinase;       
    2::394     e-122  57%  394 aa  PGK_BACST RecName: Full=Phosphoglycerate kinase;       
    3::403     e-121  59%  403 aa  PGK_LACAC RecName: Full=Phosphoglycerate kinase;       
    3::403     e-121  58%  403 aa  PGK_LACH4 RecName: Full=Phosphoglycerate kinase;       
    3::396     e-121  57%  396 aa  PGK_DICT6 RecName: Full=Phosphoglycerate kinase;       
    5::397     e-121  58%  399 aa  PGK_ELUMP RecName: Full=Phosphoglycerate kinase;       
    3::396     e-120  59%  396 aa  PGK_MACCJ RecName: Full=Phosphoglycerate kinase;       
    2::394     e-120  55%  394 aa  PGK_EXISA RecName: Full=Phosphoglycerate kinase;       
   63::462     e-119  57%  462 aa  PGKH_VOLCA RecName: Full=Phosphoglycerate kinase, chloroplastic;   
    3::396     e-119  57%  396 aa  PGK_DICTD RecName: Full=Phosphoglycerate kinase;       
    2::392     e-119  56%  394 aa  PGK_BREBN RecName: Full=Phosphoglycerate kinase;       
    3::401     e-119  57%  401 aa  PGK_LACRJ RecName: Full=Phosphoglycerate kinase;       
   31::427     e-119  58%  433 aa  PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic;   
    3::396     e-118  59%  396 aa  PGK_STACT RecName: Full=Phosphoglycerate kinase;       
    3::400     e-118  56%  400 aa  PGK_LACS1 RecName: Full=Phosphoglycerate kinase;       
    3::397     e-118  55%  402 aa  PGK_THEAB RecName: Full=Phosphoglycerate kinase;       
    9::400     e-118  57%  401 aa  PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic;       
    3::400     e-118  58%  400 aa  PGK_PEDPA RecName: Full=Phosphoglycerate kinase;       
    2::403     e-118  55%  403 aa  PGK_ACIBL RecName: Full=Phosphoglycerate kinase;       
   22::403     e-117  59%  403 aa  PGK_LACDL RecName: Full=Phosphoglycerate kinase;       
    3::406     e-117  57%  407 aa  PGK_GLOVI RecName: Full=Phosphoglycerate kinase;       
    2::398     e-117  55%  400 aa  PGK_CHLAD RecName: Full=Phosphoglycerate kinase;       
    2::394     e-117  55%  394 aa  PGK_BACHD RecName: Full=Phosphoglycerate kinase;       
    3::396     e-117  55%  396 aa  PGK_LACCB RecName: Full=Phosphoglycerate kinase;       
    3::396     e-117  55%  396 aa  PGK_LACC3 RecName: Full=Phosphoglycerate kinase;       
   78::474     e-117  57%  481 aa  PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic;   
    4::394     e-117  55%  396 aa  PGK_ANADF RecName: Full=Phosphoglycerate kinase;       
    3::403     e-117  57%  403 aa  PGK_LACJO RecName: Full=Phosphoglycerate kinase;       
    3::403     e-116  56%  403 aa  PGK_LACGA RecName: Full=Phosphoglycerate kinase;       
    3::395     e-116  55%  397 aa  PGK_THELT RecName: Full=Phosphoglycerate kinase;       
    3::400     e-116  54%  400 aa  PGK_LACBA RecName: Full=Phosphoglycerate kinase;       
    4::396     e-116  54%  396 aa  PGK_ANADE RecName: Full=Phosphoglycerate kinase;       
    4::390     e-115  54%  392 aa  PGK_BORT9 RecName: Full=Phosphoglycerate kinase;       
    4::396     e-115  54%  396 aa  PGK_ANAD2 RecName: Full=Phosphoglycerate kinase;       
    3::398     e-115  54%  403 aa  PGK_AKKM8 RecName: Full=Phosphoglycerate kinase;       
    2::394     e-115  56%  394 aa  PGK_BACSK RecName: Full=Phosphoglycerate kinase;       
    3::396     e-115  57%  396 aa  PGK_LISIN RecName: Full=Phosphoglycerate kinase;       
    4::396     e-115  53%  396 aa  PGK_ANASK RecName: Full=Phosphoglycerate kinase;       
    2::400     e-115  55%  402 aa  PGK_SYNE7 RecName: Full=Phosphoglycerate kinase;       
    2::399     e-114  57%  400 aa  PGK_THEEB RecName: Full=Phosphoglycerate kinase;       
    3::401     e-114  55%  401 aa  PGK_LACF3 RecName: Full=Phosphoglycerate kinase;       
    2::399     e-114  56%  400 aa  PGK_ANAVT RecName: Full=Phosphoglycerate kinase;       
    3::412     e-114  56%  412 aa  PGK_SPICI RecName: Full=Phosphoglycerate kinase;       
    3::405     e-114  54%  405 aa  PGK_LEUMM RecName: Full=Phosphoglycerate kinase;       
    1::404     e-114  55%  404 aa  PGK_MYCMS RecName: Full=Phosphoglycerate kinase;       
    2::405     e-114  56%  406 aa  PGK_CYAP4 RecName: Full=Phosphoglycerate kinase;       
    2::399     e-113  55%  400 aa  PGK_ANASP RecName: Full=Phosphoglycerate kinase;       
   16::400     e-113  55%  401 aa  PGK_PROMT RecName: Full=Phosphoglycerate kinase;       
    3::400     e-113  55%  400 aa  PGK_LACPL RecName: Full=Phosphoglycerate kinase;       
   22::403     e-113  58%  403 aa  PGK_LACDE RecName: Full=Phosphoglycerate kinase;       
   22::403     e-113  58%  403 aa  PGK_LACDB RecName: Full=Phosphoglycerate kinase;       
   22::403     e-113  58%  403 aa  PGK_LACDA RecName: Full=Phosphoglycerate kinase;       
    2::400     e-113  55%  402 aa  PGK_SYNP6 RecName: Full=Phosphoglycerate kinase;       
   19::401     e-113  54%  402 aa  PGK_PROM5 RecName: Full=Phosphoglycerate kinase;       
   14::399     e-113  56%  400 aa  PGK_NOSP7 RecName: Full=Phosphoglycerate kinase;       
    3::397     e-113  54%  654 aa  PGKT_THEMA RecName: Full=Bifunctional PGK/TIM;Includes:  RecName:
    3::397     e-113  54%  399 aa  PGK_THEP1 RecName: Full=Phosphoglycerate kinase;       
    3::405     e-113  55%  405 aa  PGK_LEUCK RecName: Full=Phosphoglycerate kinase;       
    3::397     e-113  54%  399 aa  PGK_THESQ RecName: Full=Phosphoglycerate kinase;       
   75::471     e-113  56%  480 aa  PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic;   
    2::398     e-112  54%  400 aa  PGK_CHLSY RecName: Full=Phosphoglycerate kinase;       
    2::398     e-112  54%  400 aa  PGK_CHLAA RecName: Full=Phosphoglycerate kinase;       
    3::400     e-112  55%  401 aa  PGK_CYAP7 RecName: Full=Phosphoglycerate kinase;       
    9::400     e-111  55%  401 aa  PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic;       
    3::397     e-111  53%  397 aa  PGK_CHLPB RecName: Full=Phosphoglycerate kinase;       
    3::393     e-111  53%  393 aa  PGK_PELTS RecName: Full=Phosphoglycerate kinase;       
    3::397     e-110  53%  397 aa  PGK_CHLPD RecName: Full=Phosphoglycerate kinase;       
   62::461     e-110  53%  461 aa  PGKH_CHLRE RecName: Full=Phosphoglycerate kinase, chloroplastic;   
   10::401     e-109  54%  401 aa  PGK_SYNY3 RecName: Full=Phosphoglycerate kinase;       
    4::390     e-109  51%  392 aa  PGK_BORHD RecName: Full=Phosphoglycerate kinase;       
    3::397     e-109  52%  397 aa  PGK_CHLTE RecName: Full=Phosphoglycerate kinase;       
    3::401     e-108  52%  402 aa  PGK_PROMA RecName: Full=Phosphoglycerate kinase;       
    2::400     e-108  54%  401 aa  PGK_ACAM1 RecName: Full=Phosphoglycerate kinase;       
    9::399     e-108  53%  400 aa  PGK_CYAP8 RecName: Full=Phosphoglycerate kinase;       
    8::401     e-108  52%  402 aa  PGK_PROM0 RecName: Full=Phosphoglycerate kinase;       
   22::396     e-108  57%  396 aa  PGK_LISMH RecName: Full=Phosphoglycerate kinase;       
   22::396     e-108  57%  396 aa  PGK_LISMF RecName: Full=Phosphoglycerate kinase;       
   22::396     e-108  57%  396 aa  PGK_LISMC RecName: Full=Phosphoglycerate kinase;       
    2::394     e-108  54%  394 aa  PGK_CARHZ RecName: Full=Phosphoglycerate kinase;       
   19::401     e-108  53%  402 aa  PGK_PROMP RecName: Full=Phosphoglycerate kinase;       
   22::396     e-108  57%  396 aa  PGK_LISMO RecName: Full=Phosphoglycerate kinase;       
    8::401     e-108  51%  402 aa  PGK_PROM9 RecName: Full=Phosphoglycerate kinase;       
    8::401     e-108  51%  402 aa  PGK_PROM2 RecName: Full=Phosphoglycerate kinase;       
   22::396     e-108  57%  396 aa  PGK_LISW6 RecName: Full=Phosphoglycerate kinase;       
    8::401     e-108  51%  402 aa  PGK_PROMS RecName: Full=Phosphoglycerate kinase;       
    4::393     e-108  49%  393 aa  PGK_BORBU RecName: Full=Phosphoglycerate kinase;       
   76::472     e-107  54%  478 aa  PGKH_ARATH RecName: Full=Phosphoglycerate kinase, chloroplastic;   
    3::398     e-107  52%  398 aa  PGK_TRIEI RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAW RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAU RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAT RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAS RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAR RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAN RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAM RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAE RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAAC RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAA9 RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAA8 RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAA3 RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAA2 RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAA1 RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  53%  396 aa  PGK_STAHJ RecName: Full=Phosphoglycerate kinase;       
    3::397     e-107  54%  397 aa  PGK_ENTFA RecName: Full=Phosphoglycerate kinase;       
    4::390     e-107  50%  392 aa  PGK_BORRA RecName: Full=Phosphoglycerate kinase;       
   14::400     e-107  54%  402 aa  PGK_SYNR3 RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  52%  396 aa  PGK_STAAB RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  52%  396 aa  PGK_STAES RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  52%  396 aa  PGK_STAEQ RecName: Full=Phosphoglycerate kinase;       
    4::390     e-107  50%  392 aa  PGK_BORDL RecName: Full=Phosphoglycerate kinase;       
    3::396     e-107  52%  396 aa  PGK_STAS1 RecName: Full=Phosphoglycerate kinase;       
    4::391     e-107  50%  393 aa  PGK_BORGA RecName: Full=Phosphoglycerate kinase;       
    3::397     e-107  51%  397 aa  PGK_CHLP8 RecName: Full=Phosphoglycerate kinase;       
   16::411     e-107  54%  412 aa  PGK_SYNJA RecName: Full=Phosphoglycerate kinase;       
    3::399     e-107  54%  399 aa  PGK_STRSY RecName: Full=Phosphoglycerate kinase;       
    3::399     e-107  54%  399 aa  PGK_STRS2 RecName: Full=Phosphoglycerate kinase;       
   16::400     e-107  51%  402 aa  PGK_PROM4 RecName: Full=Phosphoglycerate kinase;       
    4::395     e-107  51%  397 aa  PGK_AQUAE RecName: Full=Phosphoglycerate kinase;       
   18::411     e-107  54%  412 aa  PGK_SYNJB RecName: Full=Phosphoglycerate kinase;       
    4::393     e-107  49%  393 aa  PGK_BORBZ RecName: Full=Phosphoglycerate kinase;       
   18::404     e-106  53%  404 aa  PGK_OENOB RecName: Full=Phosphoglycerate kinase;       
    6::420     e-106  51%  421 aa  PGKB_TRYBB RecName: Full=Phosphoglycerate kinase, cytosolic;       
    6::395     e-106  51%  398 aa  PGK_GEOMG RecName: Full=Phosphoglycerate kinase;       
    4::391     e-106  49%  393 aa  PGK_BORAP RecName: Full=Phosphoglycerate kinase;       
    6::419     e-106  51%  440 aa  PGKC_TRYBB RecName: Full=Phosphoglycerate kinase, glycosomal;      
    3::399     e-106  53%  399 aa  PGK_STRTD RecName: Full=Phosphoglycerate kinase;       
    3::399     e-106  53%  399 aa  PGK_STRT2 RecName: Full=Phosphoglycerate kinase;       
    3::399     e-105  53%  399 aa  PGK_STRT1 RecName: Full=Phosphoglycerate kinase;       
    9::397     e-105  53%  398 aa  PGK_SYNP2 RecName: Full=Phosphoglycerate kinase;       
    3::394     e-105  50%  395 aa  PGK_ROSCS RecName: Full=Phosphoglycerate kinase;       
    3::394     e-105  51%  395 aa  PGK_ROSS1 RecName: Full=Phosphoglycerate kinase;       
   16::400     e-105  53%  401 aa  PGK_PROM1 RecName: Full=Phosphoglycerate kinase;       
   14::399     e-105  52%  401 aa  PGK_SYNSC RecName: Full=Phosphoglycerate kinase;       
    3::398     e-105  53%  398 aa  PGK_LACLA RecName: Full=Phosphoglycerate kinase;       
    3::397     e-105  51%  397 aa  PGK_PELPB RecName: Full=Phosphoglycerate kinase;       
    3::398     e-105  52%  398 aa  PGK_LACLS RecName: Full=Phosphoglycerate kinase;       
   14::400     e-104  53%  402 aa  PGK_SYNPW RecName: Full=Phosphoglycerate kinase;       
    6::394     e-104  49%  399 aa  PGK_SULDN RecName: Full=Phosphoglycerate kinase;       
    3::397     e-104  50%  397 aa  PGK_PROVI RecName: Full=Phosphoglycerate kinase;       
   14::400     e-104  52%  402 aa  PGK_SYNPX RecName: Full=Phosphoglycerate kinase;       
    3::398     e-104  52%  398 aa  PGK_LACLM RecName: Full=Phosphoglycerate kinase;       
    2::394     e-104  52%  394 aa  PGK_HERA2 RecName: Full=Phosphoglycerate kinase;       
    6::396     e-104  49%  399 aa  PGK_GEOSM RecName: Full=Phosphoglycerate kinase;       
    3::393     e-104  55%  399 aa  PGK_ACHLI RecName: Full=Phosphoglycerate kinase;       
    6::396     e-104  49%  399 aa  PGK_GEOBB RecName: Full=Phosphoglycerate kinase;       
    3::395     e-103  51%  398 aa  PGK_ONYPE RecName: Full=Phosphoglycerate kinase;       
    3::397     e-103  49%  397 aa  PGK_CHLL2 RecName: Full=Phosphoglycerate kinase;       
   12::395     e-103  50%  399 aa  PGK_GEOUR RecName: Full=Phosphoglycerate kinase;       
    3::417     e-103  51%  419 aa  PGK_TREDE RecName: Full=Phosphoglycerate kinase;       
   14::400     e-103  51%  401 aa  PGK_PROMM RecName: Full=Phosphoglycerate kinase;       
   19::400     e-103  52%  401 aa  PGK_PROM3 RecName: Full=Phosphoglycerate kinase;       
    3::396     e-103  53%  397 aa  PGK_RHOBA RecName: Full=Phosphoglycerate kinase;       
    3::401     e-102  51%  402 aa  PGK_MICAN RecName: Full=Phosphoglycerate kinase;       
    3::397     e-102  49%  397 aa  PGK_CHLCH RecName: Full=Phosphoglycerate kinase;       
   12::396     e-102  50%  397 aa  PGK_GEOLS RecName: Full=Phosphoglycerate kinase;       
    2::403     e-102  51%  403 aa  PGK_STRGG RecName: Full=Phosphoglycerate kinase;       
    6::419     e-102  51%  420 aa  PGK1_TRYCO RecName: Full=Phosphoglycerate kinase, cytosolic;       
   14::400     e-102  54%  401 aa  PGK_BIFLO RecName: Full=Phosphoglycerate kinase;       
   14::400     e-102  54%  401 aa  PGK_BIFLI RecName: Full=Phosphoglycerate kinase;       
   14::400     e-102  54%  401 aa  PGK_BIFLD RecName: Full=Phosphoglycerate kinase;       
    2::398     e-102  52%  398 aa  PGK_FUSNN RecName: Full=Phosphoglycerate kinase;       
   22::398     e-102  54%  398 aa  PGK_STRU0 RecName: Full=Phosphoglycerate kinase;       
    6::393     e-101  47%  396 aa  PGK_LEPBL RecName: Full=Phosphoglycerate kinase;       
   14::400     e-101  51%  402 aa  PGK_SYNS3 RecName: Full=Phosphoglycerate kinase;       
    3::397     e-101  48%  400 aa  PGK_FERNB RecName: Full=Phosphoglycerate kinase;       
    6::393     e-101  47%  396 aa  PGK_LEPBJ RecName: Full=Phosphoglycerate kinase;       
    2::403     e-101  51%  403 aa  PGK_STRAW RecName: Full=Phosphoglycerate kinase;       
    4::389     e-101  48%  393 aa  PGK_COPPD RecName: Full=Phosphoglycerate kinase;       
    5::416     e-100  51%  417 aa  PGK_YARLI RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRPN RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRZT RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRZP RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRZJ RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRPS RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRPM RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRPJ RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRPI RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRPF RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRP7 RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRP3 RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRA5 RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRA1 RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRR6 RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRPC RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRPB RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRP6 RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  54%  398 aa  PGK_STRP2 RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRP1 RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRA3 RecName: Full=Phosphoglycerate kinase;       
    2::389     e-100  48%  392 aa  PGK_RUBXD RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRPZ RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRP4 RecName: Full=Phosphoglycerate kinase;       
    2::403     e-100  51%  403 aa  PGK_STRCO RecName: Full=Phosphoglycerate kinase;       
    5::417     e-100  50%  418 aa  PGK_NEUCR RecName: Full=Phosphoglycerate kinase;       
    5::416     e-100  51%  416 aa  PGK_AGABI RecName: Full=Phosphoglycerate kinase;       
   22::398     e-100  53%  398 aa  PGK_STRPG RecName: Full=Phosphoglycerate kinase;       
   12::396     e-100  48%  399 aa  PGK_PELPD RecName: Full=Phosphoglycerate kinase;       
   22::398     1e-99  54%  398 aa  PGK_STRSV RecName: Full=Phosphoglycerate kinase;       
   22::398     1e-99  53%  398 aa  PGK_STRP8 RecName: Full=Phosphoglycerate kinase;       
   14::401     1e-99  53%  401 aa  PGK_BIFAA RecName: Full=Phosphoglycerate kinase;       
    3::396     3e-99  48%  397 aa  PGK_PELLD RecName: Full=Phosphoglycerate kinase;       
    6::419     3e-99  48%  420 aa  PGKE_TRYBB RecName: Full=Phosphoglycerate kinase, cytosolic;       
    6::416     3e-99  51%  417 aa  PGKB_CRIFA RecName: Full=Phosphoglycerate kinase, cytosolic;       
    6::393     4e-99  46%  396 aa  PGK_LEPIN RecName: Full=Phosphoglycerate kinase;       
    6::416     4e-99  50%  479 aa  PGKC_LEIME RecName: Full=Phosphoglycerate kinase, glycosomal;      
   14::398     5e-99  47%  398 aa  PGK_NAUPA RecName: Full=Phosphoglycerate kinase;       
    2::399     5e-99  55%  399 aa  PGK_BEUC1 RecName: Full=Phosphoglycerate kinase;       
   22::398     2e-98  53%  398 aa  PGK_STRE4 RecName: Full=Phosphoglycerate kinase;       
    6::394     2e-98  45%  400 aa  PGK_ARCB4 RecName: Full=Phosphoglycerate kinase;       
    5::416     2e-98  50%  417 aa  PGK1_PANTR RecName: Full=Phosphoglycerate kinase 1;       
    5::416     2e-98  50%  417 aa  PGK1_HUMAN RecName: Full=Phosphoglycerate kinase 1;       
    9::399     2e-98  45%  401 aa  PGK_BDEBA RecName: Full=Phosphoglycerate kinase;       
    5::416     2e-98  50%  417 aa  PGK1_PONAB RecName: Full=Phosphoglycerate kinase 1;       
    5::416     2e-98  50%  417 aa  PGK1_MACFA RecName: Full=Phosphoglycerate kinase 1;       
    1::416     3e-98  49%  417 aa  PGK1_MACEU RecName: Full=Phosphoglycerate kinase 1;       
    6::393     4e-98  45%  396 aa  PGK_LEPIC RecName: Full=Phosphoglycerate kinase;       
    6::415     4e-98  50%  455 aa  PGKC_CRIFA RecName: Full=Phosphoglycerate kinase, glycosomal;      
   22::398     5e-98  53%  398 aa  PGK_STRS7 RecName: Full=Phosphoglycerate kinase;       
    2::394     5e-98  50%  399 aa  PGK_NITSB RecName: Full=Phosphoglycerate kinase;       
    4::401     5e-98  51%  404 aa  PGK_CLAMS RecName: Full=Phosphoglycerate kinase;       
    6::414     6e-98  55%  414 aa  PGK_SCHPO RecName: Full=Phosphoglycerate kinase;       
    5::415     6e-98  50%  416 aa  PGK_PICPA RecName: Full=Phosphoglycerate kinase;       
    5::416     6e-98  50%  416 aa  PGK_GLOMO RecName: Full=Phosphoglycerate kinase;       
   22::399     1e-97  53%  399 aa  PGK_STRGC RecName: Full=Phosphoglycerate kinase;       
   22::398     1e-97  52%  398 aa  PGK_STREM RecName: Full=Phosphoglycerate kinase;       
    5::390     2e-97  51%  391 aa  PGK_SOLUE RecName: Full=Phosphoglycerate kinase;       
    2::404     2e-97  48%  404 aa  PGK_ACIC5 RecName: Full=Phosphoglycerate kinase;       
    5::416     2e-97  50%  417 aa  PGK1_PIG RecName: Full=Phosphoglycerate kinase 1;       
   22::398     2e-97  52%  398 aa  PGK_STRMU RecName: Full=Phosphoglycerate kinase;       
    5::415     2e-97  50%  417 aa  PGK1_BOVIN RecName: Full=Phosphoglycerate kinase 1;       
    6::416     3e-97  50%  417 aa  PGKB_LEIME RecName: Full=Phosphoglycerate kinase, cytosolic;       
   14::400     4e-97  49%  401 aa  PGK_SYNS9 RecName: Full=Phosphoglycerate kinase;       
    2::392     4e-97  45%  397 aa  PGK_SYNFM RecName: Full=Phosphoglycerate kinase;       
    5::415     4e-97  50%  416 aa  PGK_DEBHA RecName: Full=Phosphoglycerate kinase;       
    4::403     4e-97  52%  405 aa  PGK_CORA7 RecName: Full=Phosphoglycerate kinase;       
    5::416     4e-97  50%  417 aa  PGK1_RAT RecName: Full=Phosphoglycerate kinase 1;       
    5::417     5e-97  52%  417 aa  PGK_TRIVI RecName: Full=Phosphoglycerate kinase;       
    5::416     5e-97  51%  416 aa  PGK_TRIRE RecName: Full=Phosphoglycerate kinase;       
    5::416     5e-97  50%  417 aa  PGK1_CRIGR RecName: Full=Phosphoglycerate kinase 1;       
   11::402     7e-97  45%  402 aa  PGK_HELHP RecName: Full=Phosphoglycerate kinase;       
    2::404     9e-97  48%  771 aa  PGK_MYCPU RecName: Full=Phosphoglycerate kinase;       
    5::416     1e-96  50%  417 aa  PGK1_HORSE RecName: Full=Phosphoglycerate kinase 1;       
    5::416     1e-96  49%  417 aa  PGK1_MOUSE RecName: Full=Phosphoglycerate kinase 1;       
    2::391     2e-96  45%  391 aa  PGK_DESAH RecName: Full=Phosphoglycerate kinase;       
    3::397     3e-96  47%  397 aa  PGK_PROA2 RecName: Full=Phosphoglycerate kinase;       
    4::403     3e-96  53%  405 aa  PGK_CORDI RecName: Full=Phosphoglycerate kinase;       
    2::388     4e-96  48%  389 aa  PGK_DEIGD RecName: Full=Phosphoglycerate kinase;       
   22::389     6e-96  49%  392 aa  PGK_FRATW RecName: Full=Phosphoglycerate kinase;       
   22::389     6e-96  49%  392 aa  PGK_FRATT RecName: Full=Phosphoglycerate kinase;       
   22::389     6e-96  49%  392 aa  PGK_FRAT1 RecName: Full=Phosphoglycerate kinase;       
    5::417     6e-96  52%  417 aa  PGK_ASPOR RecName: Full=Phosphoglycerate kinase;       
    5::416     7e-96  51%  417 aa  PGK_CANMA RecName: Full=Phosphoglycerate kinase;       
   22::389     1e-95  49%  392 aa  PGK_FRATN RecName: Full=Phosphoglycerate kinase;       
    6::399     2e-95  46%  405 aa  PGK_CAMHC RecName: Full=Phosphoglycerate kinase;       
    4::389     2e-95  50%  391 aa  PGK_METCA RecName: Full=Phosphoglycerate kinase;       
   22::389     3e-95  49%  392 aa  PGK_FRATO RecName: Full=Phosphoglycerate kinase;       
   22::389     3e-95  49%  392 aa  PGK_FRATH RecName: Full=Phosphoglycerate kinase;       
   22::389     3e-95  49%  392 aa  PGK_FRATF RecName: Full=Phosphoglycerate kinase;       
   22::389     4e-95  49%  392 aa  PGK_FRATM RecName: Full=Phosphoglycerate kinase;       
    6::397     4e-95  46%  400 aa  PGK_CAMJR RecName: Full=Phosphoglycerate kinase;       
    5::396     5e-95  48%  400 aa  PGK_METEP RecName: Full=Phosphoglycerate kinase;       
    5::415     5e-95  47%  416 aa  PGK_CANGA RecName: Full=Phosphoglycerate kinase;       
    5::416     5e-95  48%  417 aa  PGK_CANAL RecName: Full=Phosphoglycerate kinase;       
    6::416     5e-95  49%  479 aa  PGKC_LEIMA RecName: Full=Phosphoglycerate kinase, glycosomal;      
    4::394     6e-95  47%  396 aa  PGK_DESAD RecName: Full=Phosphoglycerate kinase;       
    6::397     8e-95  47%  400 aa  PGK_CAMLR RecName: Full=Phosphoglycerate kinase;       
    4::390     1e-94  44%  397 aa  PGK_DESAA RecName: Full=Phosphoglycerate kinase;       
    6::416     1e-94  48%  417 aa  PGKB_LEIMA RecName: Full=Phosphoglycerate kinase, cytosolic;       
    3::395     1e-94  48%  395 aa  PGK_HYDS0 RecName: Full=Phosphoglycerate kinase;       
    2::388     1e-94  48%  389 aa  PGK_DEIDV RecName: Full=Phosphoglycerate kinase;       
   14::402     1e-94  54%  403 aa  PGK_CORK4 RecName: Full=Phosphoglycerate kinase;       
    7::405     2e-94  51%  405 aa  PGK_COREF RecName: Full=Phosphoglycerate kinase;       
    6::416     3e-94  48%  417 aa  PGK2_MOUSE RecName: Full=Phosphoglycerate kinase 2;       
   16::416     3e-94  49%  417 aa  PGK2_HORSE RecName: Full=Phosphoglycerate kinase 2;       
    7::403     5e-94  51%  405 aa  PGK_CORGB RecName: Full=Phosphoglycerate kinase;       
    4::416     7e-94  48%  416 aa  PGK_PLAF7 RecName: Full=Phosphoglycerate kinase;       
   24::410     7e-94  49%  411 aa  PGK_DEIRA RecName: Full=Phosphoglycerate kinase;       
    5::415     2e-93  47%  416 aa  PGK_YEAST RecName: Full=Phosphoglycerate kinase;       
    6::393     2e-93  46%  396 aa  PGK_LEPBP RecName: Full=Phosphoglycerate kinase;       
    6::393     2e-93  46%  396 aa  PGK_LEPBA RecName: Full=Phosphoglycerate kinase;       
    5::415     2e-93  48%  416 aa  PGK_KLULA RecName: Full=Phosphoglycerate kinase;       
    4::401     2e-93  51%  403 aa  PGK_RHOSR RecName: Full=Phosphoglycerate kinase;       
    4::401     2e-93  52%  402 aa  PGK_CORU7 RecName: Full=Phosphoglycerate kinase;       
   14::416     2e-93  48%  417 aa  PGK2_HUMAN RecName: Full=Phosphoglycerate kinase 2;       
    1::386     3e-93  48%  390 aa  PGK_LARHH RecName: Full=Phosphoglycerate kinase;       
    7::403     3e-93  51%  405 aa  PGK_CORGL RecName: Full=Phosphoglycerate kinase;       
    4::417     3e-93  49%  419 aa  PGK_TREPS RecName: Full=Phosphoglycerate kinase;       
    4::417     3e-93  49%  419 aa  PGK_TREPA RecName: Full=Phosphoglycerate kinase;       
    2::397     4e-93  48%  398 aa  PGK_SALRD RecName: Full=Phosphoglycerate kinase;       
    3::414     4e-93  50%  417 aa  PGK_CAEEL RecName: Full=Probable phosphoglycerate kinase;       
    5::394     8e-93  47%  396 aa  PGK_XANP2 RecName: Full=Phosphoglycerate kinase;       
    5::396     8e-93  48%  398 aa  PGK_MESSB RecName: Full=Phosphoglycerate kinase;       
    1::414     1e-92  49%  416 aa  PGK_SCHMA RecName: Full=Phosphoglycerate kinase;       
    3::393     1e-92  45%  393 aa  PGK_DESAP RecName: Full=Phosphoglycerate kinase;       
    2::399     2e-92  53%  399 aa  PGK_SALAI RecName: Full=Phosphoglycerate kinase;       
    5::396     2e-92  47%  400 aa  PGK_METC4 RecName: Full=Phosphoglycerate kinase;       
    2::410     2e-92  50%  412 aa  PGK_APLCA RecName: Full=Phosphoglycerate kinase;       
    5::397     2e-92  47%  400 aa  PGK_RHILW RecName: Full=Phosphoglycerate kinase;       
    5::399     2e-92  47%  400 aa  PGK_METPB RecName: Full=Phosphoglycerate kinase;       
    6::396     3e-92  46%  401 aa  PGK_CAMFF RecName: Full=Phosphoglycerate kinase;       
    6::395     3e-92  45%  399 aa  PGK_CAMC1 RecName: Full=Phosphoglycerate kinase;       
   14::416     3e-92  48%  417 aa  PGK2_MACFA RecName: Full=Phosphoglycerate kinase 2;       
    4::401     4e-92  50%  403 aa  PGK_RHOOB RecName: Full=Phosphoglycerate kinase;       
    5::395     4e-92  46%  403 aa  PGK_MARMM RecName: Full=Phosphoglycerate kinase;       
    4::397     6e-92  52%  399 aa  PGK_SALTO RecName: Full=Phosphoglycerate kinase;       
    4::394     6e-92  47%  396 aa  PGK_RHOCS RecName: Full=Phosphoglycerate kinase;       
   12::394     6e-92  47%  399 aa  PGK_GEOSF RecName: Full=Phosphoglycerate kinase;       
   16::416     8e-92  48%  417 aa  PGK2_PIG RecName: Full=Phosphoglycerate kinase 2;       
    5::416     8e-92  48%  417 aa  PGK1_RHINI RecName: Full=Phosphoglycerate kinase 1;       
   12::401     1e-91  43%  401 aa  PGK_WOLSU RecName: Full=Phosphoglycerate kinase;       
    5::415     1e-91  48%  417 aa  PGK_CHICK RecName: Full=Phosphoglycerate kinase;       
   14::407     1e-91  46%  408 aa  PGK_ARTAT RecName: Full=Phosphoglycerate kinase;       
    1::381     1e-91  48%  387 aa  PGK_ALCBS RecName: Full=Phosphoglycerate kinase;       
    5::395     1e-91  46%  397 aa  PGK_XANFL RecName: Full=Phosphoglycerate kinase;       
    2::416     1e-91  49%  418 aa  PGK_PORGI RecName: Full=Phosphoglycerate kinase;       
    4::401     1e-91  49%  403 aa  PGK_CORJK RecName: Full=Phosphoglycerate kinase;       
    4::401     1e-91  49%  404 aa  PGK_CLAM3 RecName: Full=Phosphoglycerate kinase;       
    6::395     2e-91  44%  400 aa  PGK_CAMC5 RecName: Full=Phosphoglycerate kinase;       
    2::400     3e-91  47%  402 aa  PGK_PROAC RecName: Full=Phosphoglycerate kinase;       
    5::417     5e-91  50%  417 aa  PGK_PENCI RecName: Full=Phosphoglycerate kinase;       
    8::384     7e-91  48%  387 aa  PGK_PROMH RecName: Full=Phosphoglycerate kinase;       
    4::404     7e-91  50%  410 aa  PGK_NOCFA RecName: Full=Phosphoglycerate kinase;       
    6::397     7e-91  45%  400 aa  PGK_CAMJE RecName: Full=Phosphoglycerate kinase;       
    6::397     9e-91  45%  400 aa  PGK_CAMJJ RecName: Full=Phosphoglycerate kinase;       
    7::401     1e-90  49%  403 aa  PGK_RHOE4 RecName: Full=Phosphoglycerate kinase;       
    5::414     1e-90  46%  415 aa  PGK_ASHGO RecName: Full=Phosphoglycerate kinase;       
    2::419     2e-90  49%  419 aa  PGK_BACTN RecName: Full=Phosphoglycerate kinase;       
   14::407     2e-90  44%  408 aa  PGK_ARTCA RecName: Full=Phosphoglycerate kinase;       
    4::394     3e-90  45%  404 aa  PGK_GLUOX RecName: Full=Phosphoglycerate kinase;       
    8::419     3e-90  48%  420 aa  PGK_DICDI RecName: Full=Phosphoglycerate kinase;       
    2::390     3e-90  48%  396 aa  PGK_DESOH RecName: Full=Phosphoglycerate kinase;       
    6::397     4e-90  45%  400 aa  PGK_CAMJ8 RecName: Full=Phosphoglycerate kinase;       
   14::401     5e-90  52%  403 aa  PGK_LEIXX RecName: Full=Phosphoglycerate kinase;       
    1::384     6e-90  45%  391 aa  PGK_COXBU RecName: Full=Phosphoglycerate kinase;       
    5::396     8e-90  46%  400 aa  PGK_AGRVS RecName: Full=Phosphoglycerate kinase;       
    2::388     1e-89  47%  390 aa  PGK_THET2 RecName: Full=Phosphoglycerate kinase;       
    6::397     1e-89  44%  400 aa  PGK_CAMJD RecName: Full=Phosphoglycerate kinase;       
    8::383     3e-89  47%  386 aa  PGK_HAEIE RecName: Full=Phosphoglycerate kinase;       
    2::388     4e-89  47%  390 aa  PGK_THET8 RecName: Full=Phosphoglycerate kinase;       
    8::395     4e-89  46%  401 aa  PGK_ACIF5 RecName: Full=Phosphoglycerate kinase;       
    8::395     4e-89  46%  401 aa  PGK_ACIF2 RecName: Full=Phosphoglycerate kinase;       
    5::415     5e-89  50%  415 aa  PGK_PENCH RecName: Full=Phosphoglycerate kinase;       
    5::419     7e-89  47%  421 aa  PGK_EMENI RecName: Full=Phosphoglycerate kinase;       
    4::394     9e-89  46%  397 aa  PGK_BARHE RecName: Full=Phosphoglycerate kinase;       
   14::407     9e-89  45%  408 aa  PGK_ARTS2 RecName: Full=Phosphoglycerate kinase;       
    4::394     1e-88  46%  396 aa  PGK_SILST RecName: Full=Phosphoglycerate kinase;       
    5::416     1e-88  47%  417 aa  PGK2_RHINI RecName: Full=Phosphoglycerate kinase 2;       
    8::383     1e-88  47%  386 aa  PGK_HAEIN RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-88  46%  387 aa  PGK_ERWT9 RecName: Full=Phosphoglycerate kinase;       
    4::394     1e-88  46%  397 aa  PGK_BARQU RecName: Full=Phosphoglycerate kinase;       
    8::383     3e-88  47%  386 aa  PGK_HAEIG RecName: Full=Phosphoglycerate kinase;       
    5::396     4e-88  47%  398 aa  PGK_RHILO RecName: Full=Phosphoglycerate kinase;       
    5::409     4e-88  46%  409 aa  PGK_MYCPN RecName: Full=Phosphoglycerate kinase;       
    4::396     6e-88  47%  397 aa  PGK_RHOS5 RecName: Full=Phosphoglycerate kinase;       
    6::398     6e-88  47%  398 aa  PGK_BRAJA RecName: Full=Phosphoglycerate kinase;       
    4::394     6e-88  47%  397 aa  PGK_BART1 RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALTY RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALTI RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALSV RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALPK RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALPB RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALPA RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALNS RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALHS RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALG2 RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALEP RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALDC RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALCH RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALAR RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  46%  387 aa  PGK_SALA4 RecName: Full=Phosphoglycerate kinase;       
   15::418     1e-87  46%  419 aa  PGK_OXYNO RecName: Full=Phosphoglycerate kinase;       
    8::383     1e-87  47%  386 aa  PGK_HAEI8 RecName: Full=Phosphoglycerate kinase;       
    2::399     1e-87  47%  400 aa  PGK_FRASC RecName: Full=Phosphoglycerate kinase;       
    2::399     1e-87  46%  403 aa  PGK_CHLMU RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-87  44%  387 aa  PGK_PHOLL RecName: Full=Phosphoglycerate kinase;       
    6::389     1e-87  46%  396 aa  PGK_LEGPA RecName: Full=Phosphoglycerate kinase;       
    6::384     2e-87  47%  392 aa  PGK_VESOH RecName: Full=Phosphoglycerate kinase;       
   13::389     2e-87  46%  392 aa  PGK_PHOPR RecName: Full=Phosphoglycerate kinase;       
   14::416     3e-87  50%  417 aa  PGK_RENSM RecName: Full=Phosphoglycerate kinase;       
    8::384     4e-87  46%  387 aa  PGK_SHISS RecName: Full=Phosphoglycerate kinase;       
    8::384     5e-87  46%  387 aa  PGK_ECOHS RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_SHIFL RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_SHIF8 RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_SHIBS RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_ECOLI RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_ECOLC RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_ECOL6 RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_ECOL5 RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_ECOK1 RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_ECO57 RecName: Full=Phosphoglycerate kinase;       
    8::384     6e-87  46%  387 aa  PGK_ECO24 RecName: Full=Phosphoglycerate kinase;       
    8::386     8e-87  47%  391 aa  PGK_XANCP RecName: Full=Phosphoglycerate kinase;       
    8::386     8e-87  47%  391 aa  PGK_XANCB RecName: Full=Phosphoglycerate kinase;       
    8::386     8e-87  47%  391 aa  PGK_XANC8 RecName: Full=Phosphoglycerate kinase;       
   15::416     8e-87  46%  420 aa  PGK_TETTH RecName: Full=Phosphoglycerate kinase;       
    1::412     8e-87  46%  471 aa  PGK_MYCPE RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERPY RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERPS RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERPP RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERPN RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERPG RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERPE RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERPB RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERPA RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  46%  387 aa  PGK_YERP3 RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-86  48%  387 aa  PGK_PECCP RecName: Full=Phosphoglycerate kinase;       
    8::389     1e-86  45%  392 aa  PGK_THISH RecName: Full=Phosphoglycerate kinase;       
    6::389     1e-86  46%  396 aa  PGK_LEGPH RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-86  46%  387 aa  PGK_SHIDS RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-86  45%  387 aa  PGK_ERWCT RecName: Full=Phosphoglycerate kinase;       
    5::397     2e-86  45%  401 aa  PGK_RHIL3 RecName: Full=Phosphoglycerate kinase;       
    8::384     3e-86  45%  387 aa  PGK_SODGM RecName: Full=Phosphoglycerate kinase;       
    8::386     3e-86  48%  389 aa  PGK_MANSM RecName: Full=Phosphoglycerate kinase;       
    5::416     3e-86  45%  418 aa  PGK_EUPCR RecName: Full=Phosphoglycerate kinase;       
    6::398     4e-86  47%  398 aa  PGK_RHOPA RecName: Full=Phosphoglycerate kinase;       
    6::389     4e-86  46%  396 aa  PGK_LEGPC RecName: Full=Phosphoglycerate kinase;       
    4::398     5e-86  44%  399 aa  PGK_RHIME RecName: Full=Phosphoglycerate kinase;       
    6::390     5e-86  45%  395 aa  PGK_NITMU RecName: Full=Phosphoglycerate kinase;       
    5::396     7e-86  46%  400 aa  PGK_AGRT5 RecName: Full=Phosphoglycerate kinase;       
    1::394     7e-86  47%  395 aa  PGK_ACIAD RecName: Full=Phosphoglycerate kinase;       
    8::384     9e-86  46%  387 aa  PGK_YERE8 RecName: Full=Phosphoglycerate kinase;       
    8::384     9e-86  48%  387 aa  PGK_PSEE4 RecName: Full=Phosphoglycerate kinase;       
    2::390     9e-86  42%  392 aa  PGK_DESPS RecName: Full=Phosphoglycerate kinase;       
    1::394     9e-86  47%  395 aa  PGK_ACIBY RecName: Full=Phosphoglycerate kinase;       
    1::394     9e-86  47%  395 aa  PGK_ACIBS RecName: Full=Phosphoglycerate kinase;       
    1::394     9e-86  47%  395 aa  PGK_ACIB5 RecName: Full=Phosphoglycerate kinase;       
    1::394     9e-86  47%  395 aa  PGK_ACIB3 RecName: Full=Phosphoglycerate kinase;       
    4::395     2e-85  46%  397 aa  PGK_ZYMMO RecName: Full=Phosphoglycerate kinase;       
    4::396     2e-85  44%  399 aa  PGK_RHISN RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-85  46%  387 aa  PGK_PASMU RecName: Full=Phosphoglycerate kinase;       
    4::405     2e-85  48%  407 aa  PGK_MYCSS RecName: Full=Phosphoglycerate kinase;       
    4::405     2e-85  48%  407 aa  PGK_MYCSK RecName: Full=Phosphoglycerate kinase;       
    4::405     2e-85  48%  407 aa  PGK_MYCSJ RecName: Full=Phosphoglycerate kinase;       
    2::413     2e-85  45%  413 aa  PGK_MYCGA RecName: Full=Phosphoglycerate kinase;       
    4::388     3e-85  44%  391 aa  PGK_TERTT RecName: Full=Phosphoglycerate kinase;       
    1::394     3e-85  47%  395 aa  PGK_ACIBC RecName: Full=Phosphoglycerate kinase;       
    4::398     3e-85  44%  399 aa  PGK_SINMW RecName: Full=Phosphoglycerate kinase;       
    8::389     3e-85  45%  391 aa  PGK_SHEDO RecName: Full=Phosphoglycerate kinase;       
    4::386     4e-85  45%  394 aa  PGK_HALHL RecName: Full=Phosphoglycerate kinase;       
   23::394     8e-85  44%  396 aa  PGK_GRABC RecName: Full=Phosphoglycerate kinase;       
    8::388     8e-85  48%  391 aa  PGK_ACTSZ RecName: Full=Phosphoglycerate kinase;       
    8::387     1e-84  45%  392 aa  PGK_NITEU RecName: Full=Phosphoglycerate kinase;       
    4::406     1e-84  49%  408 aa  PGK_MYCS2 RecName: Full=Phosphoglycerate kinase;       
    6::389     1e-84  45%  396 aa  PGK_LEGPL RecName: Full=Phosphoglycerate kinase;       
    1::389     1e-84  45%  391 aa  PGK_CHRVO RecName: Full=Phosphoglycerate kinase;       
  145::508     1e-84  49%  509 aa  PGKG_TRYCO RecName: Full=Phosphoglycerate kinase, glycosomal;      
    8::384     1e-84  45%  391 aa  PGK_RUTMC RecName: Full=Phosphoglycerate kinase;       
   22::389     1e-84  46%  392 aa  PGK_FRAP2 RecName: Full=Phosphoglycerate kinase;       
    1::394     1e-84  47%  395 aa  PGK_ACIBT RecName: Full=Phosphoglycerate kinase;       
    8::386     2e-84  46%  391 aa  PGK_XANOR RecName: Full=Phosphoglycerate kinase;       
    8::386     2e-84  46%  391 aa  PGK_XANOM RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-84  45%  387 aa  PGK_ENTS8 RecName: Full=Phosphoglycerate kinase;       
    8::386     2e-84  45%  392 aa  PGK_ALHEH RecName: Full=Phosphoglycerate kinase;       
    8::386     2e-84  46%  391 aa  PGK_XANAC RecName: Full=Phosphoglycerate kinase;       
    6::389     2e-84  45%  392 aa  PGK_NITOC RecName: Full=Phosphoglycerate kinase;       
    1::390     2e-84  47%  392 aa  PGK_NEIMF RecName: Full=Phosphoglycerate kinase;       
    8::410     2e-84  44%  416 aa  PGK_MYCGE RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-84  46%  386 aa  PGK_AZOVD RecName: Full=Phosphoglycerate kinase;       
    8::386     3e-84  46%  391 aa  PGK_XANOP RecName: Full=Phosphoglycerate kinase;       
    8::386     3e-84  46%  391 aa  PGK_XANC5 RecName: Full=Phosphoglycerate kinase;       
    4::393     3e-84  45%  395 aa  PGK_ROSDO RecName: Full=Phosphoglycerate kinase;       
    8::387     4e-84  45%  392 aa  PGK_NITEC RecName: Full=Phosphoglycerate kinase;       
   14::402     6e-84  46%  416 aa  PGK_MYCUA RecName: Full=Phosphoglycerate kinase;       
   14::402     6e-84  46%  416 aa  PGK_MYCMM RecName: Full=Phosphoglycerate kinase;       
    2::399     6e-84  45%  403 aa  PGK_CHLTR RecName: Full=Phosphoglycerate kinase;       
    8::384     8e-84  45%  387 aa  PGK_ENT38 RecName: Full=Phosphoglycerate kinase;       
    6::390     1e-83  43%  393 aa  PGK_THIDA RecName: Full=Phosphoglycerate kinase;       
   12::398     1e-83  46%  400 aa  PGK_SACEN RecName: Full=Phosphoglycerate kinase;       
    7::403     1e-83  41%  404 aa  PGK_MYCH2 RecName: Full=Phosphoglycerate kinase;       
    1::412     1e-83  44%  415 aa  PGK_DROME RecName: Full=Phosphoglycerate kinase;       
    2::399     1e-83  45%  403 aa  PGK_CHLTA RecName: Full=Phosphoglycerate kinase;       
    2::399     2e-83  45%  403 aa  PGK_CHLTB RecName: Full=Phosphoglycerate kinase;       
    2::399     2e-83  45%  403 aa  PGK_CHLT2 RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-83  45%  386 aa  PGK_PSEMY RecName: Full=Phosphoglycerate kinase;       
    4::402     2e-83  47%  402 aa  PGK_MYCGI RecName: Full=Phosphoglycerate kinase;       
    8::381     3e-83  44%  386 aa  PGK_VIBPA RecName: Full=Phosphoglycerate kinase;       
    5::399     4e-83  46%  400 aa  PGK_METRJ RecName: Full=Phosphoglycerate kinase;       
    8::381     5e-83  45%  387 aa  PGK_VIBCH RecName: Full=Phosphoglycerate kinase;       
    8::381     5e-83  45%  387 aa  PGK_VIBC3 RecName: Full=Phosphoglycerate kinase;       
    1::391     5e-83  45%  393 aa  PGK_DECAR RecName: Full=Phosphoglycerate kinase;       
    8::381     7e-83  44%  386 aa  PGK_VIBHB RecName: Full=Phosphoglycerate kinase;       
    4::388     7e-83  45%  394 aa  PGK_AZOSB RecName: Full=Phosphoglycerate kinase;       
    4::387     9e-83  47%  390 aa  PGK_CELJU RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-82  45%  387 aa  PGK_PSEA8 RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-82  43%  387 aa  PGK_PHOLU RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-82  44%  387 aa  PGK_KLEP3 RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-82  45%  387 aa  PGK_TOLAT RecName: Full=Phosphoglycerate kinase;       
    5::394     3e-82  44%  396 aa  PGK_AZOC5 RecName: Full=Phosphoglycerate kinase;       
    6::389     4e-82  44%  391 aa  PGK_SHESH RecName: Full=Phosphoglycerate kinase;       
    8::384     4e-82  45%  387 aa  PGK_PSEAE RecName: Full=Phosphoglycerate kinase;       
    8::384     4e-82  45%  387 aa  PGK_PSEAB RecName: Full=Phosphoglycerate kinase;       
    4::395     5e-82  45%  397 aa  PGK_RHOSK RecName: Full=Phosphoglycerate kinase;       
    4::395     5e-82  45%  397 aa  PGK_RHOS1 RecName: Full=Phosphoglycerate kinase;       
   20::391     6e-82  45%  392 aa  PGK_THERP RecName: Full=Phosphoglycerate kinase;       
    6::389     6e-82  43%  391 aa  PGK_SHEB5 RecName: Full=Phosphoglycerate kinase;       
    4::384     6e-82  44%  386 aa  PGK_MARAV RecName: Full=Phosphoglycerate kinase;       
    4::395     8e-82  45%  397 aa  PGK_RHOS4 RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-81  44%  387 aa  PGK_PSEA7 RecName: Full=Phosphoglycerate kinase;       
    4::393     1e-81  44%  395 aa  PGK_NOVAD RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-81  44%  387 aa  PGK_PSEFS RecName: Full=Phosphoglycerate kinase;       
    5::406     2e-81  44%  416 aa  PGK_MYCLE RecName: Full=Phosphoglycerate kinase;       
    5::406     2e-81  44%  416 aa  PGK_MYCLB RecName: Full=Phosphoglycerate kinase;       
    2::398     2e-81  44%  402 aa  PGK_CHLPN RecName: Full=Phosphoglycerate kinase;       
    8::388     2e-81  46%  391 aa  PGK_ACTPJ RecName: Full=Phosphoglycerate kinase;       
    8::388     2e-81  46%  391 aa  PGK_ACTP7 RecName: Full=Phosphoglycerate kinase;       
    8::388     2e-81  46%  391 aa  PGK_ACTP2 RecName: Full=Phosphoglycerate kinase;       
    8::384     3e-81  45%  387 aa  PGK_PSESM RecName: Full=Phosphoglycerate kinase;       
   14::394     3e-81  44%  397 aa  PGK_JANMA RecName: Full=Phosphoglycerate kinase;       
    6::389     4e-81  43%  391 aa  PGK_SHEB9 RecName: Full=Phosphoglycerate kinase;       
    6::389     4e-81  43%  391 aa  PGK_SHEB2 RecName: Full=Phosphoglycerate kinase;       
    6::389     5e-81  44%  391 aa  PGK_SHEPC RecName: Full=Phosphoglycerate kinase;       
    8::389     5e-81  44%  391 aa  PGK_COLP3 RecName: Full=Phosphoglycerate kinase;       
    8::384     5e-81  44%  387 aa  PGK_ALISL RecName: Full=Phosphoglycerate kinase;       
    8::389     1e-80  44%  391 aa  PGK_PSEHT RecName: Full=Phosphoglycerate kinase;       
    2::388     1e-80  44%  394 aa  PGK_AZOSE RecName: Full=Phosphoglycerate kinase;       
    6::389     1e-80  44%  391 aa  PGK_SHESW RecName: Full=Phosphoglycerate kinase;       
    6::389     1e-80  42%  391 aa  PGK_SHEB8 RecName: Full=Phosphoglycerate kinase;       
    4::406     1e-80  47%  407 aa  PGK_MYCVP RecName: Full=Phosphoglycerate kinase;       
    8::381     2e-80  44%  387 aa  PGK_PSEF5 RecName: Full=Phosphoglycerate kinase;       
    4::394     2e-80  45%  400 aa  PGK_BARBK RecName: Full=Phosphoglycerate kinase;       
    6::389     3e-80  44%  391 aa  PGK_SHESM RecName: Full=Phosphoglycerate kinase;       
    6::389     3e-80  44%  391 aa  PGK_SHEON RecName: Full=Phosphoglycerate kinase;       
    6::383     3e-80  43%  386 aa  PGK_SERP5 RecName: Full=Phosphoglycerate kinase;       
    2::399     3e-80  44%  403 aa  PGK_CHLCV RecName: Full=Phosphoglycerate kinase;       
   16::392     3e-80  44%  397 aa  PGK_BORPE RecName: Full=Phosphoglycerate kinase;       
    8::386     6e-80  43%  391 aa  PGK_PSEA6 RecName: Full=Phosphoglycerate kinase;       
    2::399     6e-80  44%  403 aa  PGK_CHLFF RecName: Full=Phosphoglycerate kinase;       
    8::384     7e-80  43%  387 aa  PGK_VIBFM RecName: Full=Phosphoglycerate kinase;       
    6::389     7e-80  44%  391 aa  PGK_SHESR RecName: Full=Phosphoglycerate kinase;       
    6::389     7e-80  44%  391 aa  PGK_SHESA RecName: Full=Phosphoglycerate kinase;       
    8::384     7e-80  43%  387 aa  PGK_AERS4 RecName: Full=Phosphoglycerate kinase;       
    8::387     1e-79  45%  391 aa  PGK_STRM5 RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-79  43%  387 aa  PGK_VIBF1 RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-79  45%  387 aa  PGK_PSE14 RecName: Full=Phosphoglycerate kinase;       
   14::394     1e-79  43%  397 aa  PGK_DIAST RecName: Full=Phosphoglycerate kinase;       
    4::394     2e-79  44%  396 aa  PGK_BRUME RecName: Full=Phosphoglycerate kinase;       
    4::394     2e-79  44%  396 aa  PGK_BRUAB RecName: Full=Phosphoglycerate kinase;       
    4::395     2e-79  43%  397 aa  PGK_SPHWW RecName: Full=Phosphoglycerate kinase;       
    8::384     2e-79  45%  387 aa  PGK_PSEU2 RecName: Full=Phosphoglycerate kinase;       
    1::390     2e-79  45%  392 aa  PGK_NEIMB RecName: Full=Phosphoglycerate kinase;       
    2::399     2e-79  46%  403 aa  PGK_CHLAB RecName: Full=Phosphoglycerate kinase;       
    1::390     3e-79  44%  392 aa  PGK_NEIMA RecName: Full=Phosphoglycerate kinase;       
    4::390     4e-79  43%  393 aa  PGK_DINSH RecName: Full=Phosphoglycerate kinase;       
    8::384     5e-79  45%  387 aa  PGK_PSEPW RecName: Full=Phosphoglycerate kinase;       
    8::381     1e-78  43%  386 aa  PGK_VIBVY RecName: Full=Phosphoglycerate kinase;       
    8::381     1e-78  43%  386 aa  PGK_VIBVU RecName: Full=Phosphoglycerate kinase;       
    6::389     1e-78  43%  391 aa  PGK_SHEPA RecName: Full=Phosphoglycerate kinase;       
    8::389     1e-78  42%  391 aa  PGK_SHEFN RecName: Full=Phosphoglycerate kinase;       
    1::414     2e-78  44%  415 aa  PGK_OPISI RecName: Full=Phosphoglycerate kinase;       
    3::393     2e-78  43%  395 aa  PGK_BRUSU RecName: Full=Phosphoglycerate kinase;       
   27::411     5e-78  43%  419 aa  PGK_RALSO RecName: Full=Phosphoglycerate kinase;       
   15::395     9e-78  44%  395 aa  PGK_TROW8 RecName: Full=Phosphoglycerate kinase;       
   15::395     1e-77  44%  395 aa  PGK_TROWT RecName: Full=Phosphoglycerate kinase;       
    6::388     1e-77  43%  389 aa  PGK_DESDA RecName: Full=Phosphoglycerate kinase;       
    6::389     2e-77  43%  391 aa  PGK_SHEHH RecName: Full=Phosphoglycerate kinase;       
    8::385     2e-77  43%  388 aa  PGK_HAHCH RecName: Full=Phosphoglycerate kinase;       
    2::399     2e-77  46%  400 aa  PGK_FRAAA RecName: Full=Phosphoglycerate kinase;       
  145::504     3e-77  46%  505 aa  PGKA_TRYBB RecName: Full=Phosphoglycerate kinase A;       
    6::384     3e-77  43%  387 aa  PGK_MARMS RecName: Full=Phosphoglycerate kinase;       
    3::394     4e-77  39%  399 aa  PGK_WOLTR RecName: Full=Phosphoglycerate kinase;       
  145::507     4e-77  47%  508 aa  PGKD_TRYBB RecName: Full=Phosphoglycerate kinase A;       
   14::412     6e-77  49%  412 aa  PGK_MYCA9 RecName: Full=Phosphoglycerate kinase;       
   10::401     6e-77  42%  402 aa  PGK_HELPY RecName: Full=Phosphoglycerate kinase;       
    1::396     8e-77  45%  400 aa  PGK_PSYCK RecName: Full=Phosphoglycerate kinase;       
    8::389     8e-77  42%  393 aa  PGK_DESVV RecName: Full=Phosphoglycerate kinase;       
    2::376     8e-77  45%  378 aa  PGK_CONMG RecName: Full=Phosphoglycerate kinase;       
   14::394     8e-77  42%  397 aa  PGK_ACISJ RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-76  44%  387 aa  PGK_PSEPK RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-76  44%  387 aa  PGK_PSEPG RecName: Full=Phosphoglycerate kinase;       
    8::384     1e-76  44%  387 aa  PGK_PSEP1 RecName: Full=Phosphoglycerate kinase;       
   14::409     1e-76  47%  415 aa  PGK_MICLC RecName: Full=Phosphoglycerate kinase;       
    6::385     1e-76  41%  394 aa  PGK_BLOPB RecName: Full=Phosphoglycerate kinase;       
    1::390     2e-76  43%  392 aa  PGK_NEIM0 RecName: Full=Phosphoglycerate kinase;       
    6::383     2e-76  42%  387 aa  PGK_BAUCH RecName: Full=Phosphoglycerate kinase;       
    6::384     2e-76  42%  387 aa  PGK_PSEPF RecName: Full=Phosphoglycerate kinase;       
    8::389     3e-76  42%  393 aa  PGK_DESVH RecName: Full=Phosphoglycerate kinase;       
   32::409     4e-76  42%  412 aa  PGKP_RALEH RecName: Full=Phosphoglycerate kinase, plasmid;       
   14::394     5e-76  42%  397 aa  PGK_HERAR RecName: Full=Phosphoglycerate kinase;       
    8::384     5e-76  42%  387 aa  PGK_AERHH RecName: Full=Phosphoglycerate kinase;       
   10::401     6e-76  41%  402 aa  PGK_HELPJ RecName: Full=Phosphoglycerate kinase;       
   33::399     8e-76  43%  413 aa  PGKC_RALEH RecName: Full=Phosphoglycerate kinase, chromosomal;     
   14::394     1e-75  42%  397 aa  PGK_LEPCP RecName: Full=Phosphoglycerate kinase;       
    4::394     1e-75  42%  396 aa  PGK_CAUSK RecName: Full=Phosphoglycerate kinase;       
    8::390     1e-75  41%  393 aa  PGK_METFK RecName: Full=Phosphoglycerate kinase;       
    4::394     3e-75  41%  398 aa  PGK_SILPO RecName: Full=Phosphoglycerate kinase;       
    6::389     3e-75  41%  391 aa  PGK_SHEPW RecName: Full=Phosphoglycerate kinase;       
    6::387     4e-75  43%  397 aa  PGK_NEIG2 RecName: Full=Phosphoglycerate kinase;       
    6::387     4e-75  43%  397 aa  PGK_NEIG1 RecName: Full=Phosphoglycerate kinase;       
    3::396     9e-75  39%  396 aa  PGK_WOLPP RecName: Full=Phosphoglycerate kinase;       
    9::389     9e-75  41%  391 aa  PGK_SHELP RecName: Full=Phosphoglycerate kinase;       
    4::394     9e-75  41%  396 aa  PGK_CAUCR RecName: Full=Phosphoglycerate kinase;       
    4::394     9e-75  41%  396 aa  PGK_CAUCN RecName: Full=Phosphoglycerate kinase;       
   14::394     9e-75  42%  397 aa  PGK_ACIAC RecName: Full=Phosphoglycerate kinase;       
    1::390     1e-74  41%  396 aa  PGK_JANSC RecName: Full=Phosphoglycerate kinase;       
    4::388     2e-74  43%  391 aa  PGK_HAEDU RecName: Full=Phosphoglycerate kinase;       
    2::399     4e-74  42%  400 aa  PGK_FRASN RecName: Full=Phosphoglycerate kinase;       
    2::412     8e-74  47%  412 aa  PGK_KINRD RecName: Full=Phosphoglycerate kinase;       
   16::392     8e-74  41%  397 aa  PGK_BORPA RecName: Full=Phosphoglycerate kinase;       
   16::392     2e-73  41%  397 aa  PGK_BORBR RecName: Full=Phosphoglycerate kinase;       
    8::386     3e-73  43%  391 aa  PGK_XYLFA RecName: Full=Phosphoglycerate kinase;       
   14::391     3e-73  41%  397 aa  PGK_RHOFD RecName: Full=Phosphoglycerate kinase;       
    8::387     5e-73  43%  391 aa  PGK_STRMK RecName: Full=Phosphoglycerate kinase;       
    8::386     1e-72  43%  391 aa  PGK_XYLFT RecName: Full=Phosphoglycerate kinase;       
    2::374     2e-72  42%  375 aa  PGK_TETPY RecName: Full=Phosphoglycerate kinase;       
    2::376     2e-72  43%  376 aa  PGK_GLACH RecName: Full=Phosphoglycerate kinase;       
    8::386     7e-72  42%  389 aa  PGK_HAES2 RecName: Full=Phosphoglycerate kinase;       
    8::389     7e-72  40%  393 aa  PGK_DESVM RecName: Full=Phosphoglycerate kinase;       
    2::367     1e-71  44%  367 aa  PGK_PARPR RecName: Full=Phosphoglycerate kinase;       
    5::403     2e-71  42%  412 aa  PGK_MYCTU RecName: Full=Phosphoglycerate kinase;       
    5::403     2e-71  42%  412 aa  PGK_MYCTA RecName: Full=Phosphoglycerate kinase;       
    5::403     2e-71  42%  412 aa  PGK_MYCBT RecName: Full=Phosphoglycerate kinase;       
    5::403     2e-71  42%  412 aa  PGK_MYCBP RecName: Full=Phosphoglycerate kinase;       
    5::403     2e-71  42%  412 aa  PGK_MYCBO RecName: Full=Phosphoglycerate kinase;       
    2::396     4e-71  38%  398 aa  PGK_WOLPM RecName: Full=Phosphoglycerate kinase;       
    2::396     2e-70  38%  398 aa  PGK_WOLWR RecName: Full=Phosphoglycerate kinase;       
    6::409     9e-70  42%  417 aa  PGK_METJA RecName: Full=Phosphoglycerate kinase;       
    4::383     9e-70  38%  390 aa  PGK_BUCAT RecName: Full=Phosphoglycerate kinase;       
    4::383     9e-70  38%  390 aa  PGK_BUCAI RecName: Full=Phosphoglycerate kinase;       
    4::383     2e-69  37%  390 aa  PGK_BUCA5 RecName: Full=Phosphoglycerate kinase;       
  174::504     2e-69  43%  505 aa  PGKA_CRIFA RecName: Full=Phosphoglycerate kinase, glycosomal;      
    1::396     3e-69  40%  402 aa  PGK_PSYWF RecName: Full=Phosphoglycerate kinase;       
    6::386     1e-68  38%  400 aa  PGK_BLOFL RecName: Full=Phosphoglycerate kinase;       
    1::384     2e-68  39%  388 aa  PGK_BUCAP RecName: Full=Phosphoglycerate kinase;       
    5::396     6e-68  40%  398 aa  PGK_SPHAL RecName: Full=Phosphoglycerate kinase;       
    5::405     8e-68  44%  415 aa  PGK_MYCPA RecName: Full=Phosphoglycerate kinase;       
    5::405     8e-68  44%  415 aa  PGK_MYCA1 RecName: Full=Phosphoglycerate kinase;       
    4::406     1e-67  42%  414 aa  PGK_METMP RecName: Full=Phosphoglycerate kinase;       
    6::389     2e-67  38%  391 aa  PGK_SHEWM RecName: Full=Phosphoglycerate kinase;       
    6::372     7e-67  39%  393 aa  PGK_BUCBP RecName: Full=Phosphoglycerate kinase;       
   24::399     3e-66  38%  406 aa  PGK_ORITI RecName: Full=Phosphoglycerate kinase;       
   24::399     5e-66  38%  403 aa  PGK_ORITB RecName: Full=Phosphoglycerate kinase;       
    9::403     3e-62  41%  416 aa  PGK_METMA RecName: Full=Phosphoglycerate kinase;       
    6::398     7e-62  38%  410 aa  PGK_PYRAB RecName: Full=Phosphoglycerate kinase;       
    4::398     8e-61  39%  413 aa  PGK_THESM RecName: Full=Phosphoglycerate kinase;       
    4::397     3e-60  38%  414 aa  PGK_THEON RecName: Full=Phosphoglycerate kinase;       
    3::413     1e-59  34%  422 aa  PGK_UREPA RecName: Full=Phosphoglycerate kinase;       
    9::403     5e-59  39%  416 aa  PGK2_METAC RecName: Full=Phosphoglycerate kinase 2;       
   12::404     8e-58  37%  412 aa  PGK1_METAC RecName: Full=Phosphoglycerate kinase 1;       
    4::398     1e-57  37%  410 aa  PGK_PYRHO RecName: Full=Phosphoglycerate kinase;       
    2::401     1e-57  38%  410 aa  PGK_METFE RecName: Full=Phosphoglycerate kinase;       
    4::398     1e-55  37%  410 aa  PGK_PYRWO RecName: Full=Phosphoglycerate kinase;       
    4::398     1e-55  37%  410 aa  PGK_PYRFU RecName: Full=Phosphoglycerate kinase;       
    8::398     5e-55  35%  407 aa  PGK_ARCFU RecName: Full=Phosphoglycerate kinase;       
   12::407     4e-54  37%  415 aa  PGK_AERPE RecName: Full=Phosphoglycerate kinase;       
    6::382     9e-54  32%  394 aa  PGK_WIGBR RecName: Full=Phosphoglycerate kinase;       
    8::400     2e-53  36%  408 aa  PGK_SULSO RecName: Full=Phosphoglycerate kinase;       
    4::398     2e-53  36%  411 aa  PGK_PYRKO RecName: Full=Phosphoglycerate kinase;       
    1::398     3e-53  37%  405 aa  PGK_METLZ RecName: Full=Phosphoglycerate kinase;       
    3::396     7e-52  36%  396 aa  PGK_NATPD RecName: Full=Phosphoglycerate kinase;       
   14::401     9e-51  36%  408 aa  PGK_THEAC RecName: Full=Phosphoglycerate kinase;       
    7::401     1e-50  35%  408 aa  PGK_THEVO RecName: Full=Phosphoglycerate kinase;       
    6::400     8e-50  36%  407 aa  PGK_HALLT RecName: Full=Phosphoglycerate kinase;       
    4::398     9e-49  33%  400 aa  PGK_HALMA RecName: Full=Phosphoglycerate kinase;       
    6::407     5e-46  33%  411 aa  PGK_METTH RecName: Full=Phosphoglycerate kinase;       
    6::363     3e-45  33%  415 aa  PGK_SULTO RecName: Full=Phosphoglycerate kinase;       
    4::398     1e-43  34%  406 aa  PGK_METKA RecName: Full=Phosphoglycerate kinase;       
    1::400     3e-43  33%  414 aa  PGK_PICTO RecName: Full=Phosphoglycerate kinase;       
    5::399     6e-43  32%  401 aa  PGK_HALVA RecName: Full=Phosphoglycerate kinase;       
    2::377     2e-42  33%  407 aa  PGK_METS5 RecName: Full=Phosphoglycerate kinase;       
   19::399     3e-40  32%  408 aa  PGK_PYRAE RecName: Full=Phosphoglycerate kinase;       
    7::402     3e-40  33%  409 aa  PGK_METBR RecName: Full=Phosphoglycerate kinase;       
   11::405     7e-40  32%  415 aa  PGK_SULAC RecName: Full=Phosphoglycerate kinase;       
    4::397     7e-40  35%  398 aa  PGK_HALSA RecName: Full=Phosphoglycerate kinase;       
    4::397     7e-40  35%  398 aa  PGK_HALS3 RecName: Full=Phosphoglycerate kinase;       
  155::372     4e-35  39%  388 aa  PGK_MYCAV RecName: Full=Phosphoglycerate kinase;       
  199::291     9e-06  38%  349 aa  NAGZ_METFK RecName: Full=Beta-hexosaminidase;       
    1::397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNFNKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAK
PGK_CLOPE       MNFNKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAK
PGK_CLOP1       MNFNKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAK
PGK_CLOPS       MNFNKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAQVILCSHMGKPKGEAK
PGK_CLOBA       MNFNKKTIEDIQVKGKKVLVRCDFNVPLKDGVITDENRLNGALPTIKYLVENGAKVILCSHMGKPKGEPK
PGK_CLOBB       MNFNKKTIEDIQVKGKKVLVRCDFNVPLKDGVITDENRLNGALPTIKYLVENGAKVILCSHMGKPKGEPK
PGK_CLOBH       MNYNKKSIEDIDVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMEKGAKIILCSHMGKPKGEPK
PGK_CLOB1       MNYNKKSIEDIDVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMEKGAKIILCSHMGKPKGEPK
PGK_CLOBL       MNYNKKSIEDIDVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMGKGAKIILCSHMGKPKGEPK
PGK_CLOB6       MNYNKKSIEDIDVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMEKGAKIILCSHMGKPKGEPK
PGK_CLOBK       MNYNKKSIEDIDVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMGKGAKIILCSHMGKPKGEPK
PGK_CLOBJ       MNYNKKSIEYIDVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMEKGAKIILCSHMGKPKGEPK
PGK_CLOBM       MNYNKKSIEDIDVKSKKVLVRCDFNVPLNEGKITDENRLVGALPTVKYLMEKGAKIILCSHMGKPKGEPK
PGK_CLOTE       --FNKKTIEDIDVKGRKVLVRCDFNVPLKDGKITDENRLMGALPTIKYIMEKGGKVILCSHLGKPKGEPK
PGK_CLOAB       MKFNKKTIEDVDVKGKRVLVRCDFNVPLKDGVITDENRLNGALPTIKYLSEHGGKVILCSHLGKAKGP-D
PGK_CLONN       MKLNKKTVEDIQVKGKKVLVRCDFNVPLKDGVITDENRLVGAMPTIKYLVNEGAKVILCSHLGKPKGEAK
PGK_CLOB8       MNFNKKTIEDIEVSGKKVLVRCDFNVPLKDGVITDENRLVGALPTIKYLVEKGAKVILCSHLGKDASK--
PGK_CLOK5       MVFNKKTIEDVDVKGKRVLVRCDFNVPLQEGKITDENRLIGSLPTIKYLMENNAKVILCSHLGKPKGEVK
PGK_CLOK1       MVFNKKTIEDVDVKGKRVLVRCDFNVPLQEGKITDENRLIGSLPTIKYLMENNAKVILCSHLGKPKGEVK
PGK_CLOD6       ---NKKTIEDIDVCGKKVLVRCDFNVPLQDGVITDENRLNGALPTIQYLISKGAKVILCSHLGKPKGEAK
PGK_THETN       ----KKTVRDIDVSGKRVLVRVDFNVPMDENKITDDRRIREALPTIEYLINHNAKVILVSHLGRPKGKFN
PGK_EXIS2       ---NKKSIRDIDVKGKRVFTRVDFNVPLEDGKITDDTRIRAALPTIKHLVDGGAKVILASHMGRPKGEKN
PGK_SYMTH       ------TVRDIDVKGKRVFVRVDFNVPLEDGRITDDTRIRAAVPTIRYLVEEGAVAVLASHLGRPKGQRN
PGK_BACSU       ---NKKTLKDIDVKGKVVFCRVDFNVPMKDGEVTDDTRIRAALPTIKHLADQGAKVLLASHLGRPKGEVV
PGK_FINM2       ---NKKTLKDLNVENKRVLVRVDFNVPIKEGIITDTNRIEASLTTIKYLIDNNAKVILMSHLGRPKGEPK
PGK_BACCN       ---NKKSIRDVDLKGKRVFCRVDFNVPMKDGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVV
PGK_BACP2       ---NKKSVKDIDVKGKVVFCRVDFNVPMKDGKVTDDTRIRAALPTIEYLTGQGAKVLLASHLGRPKGQVT
PGK_LACSS       ----KQTVADLKIKGKKVLVRVDFNVPIKGGVIGDDNRIVAALPTIQYIIDNGGKAILLSHLGRIKSEDK
PGK_BACHK       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAV
PGK_OCEIH       ---NKKTINDLQVEGKRVFTRVDFNVPLKDGEITDDTRIRAALPTIEQLTAQGAKVILASHLGRPKGTVV
PGK_BACLD       ---NKKSVKDIDVKGRVVFCRVDFNVPMKDGKVTDDTRIRAALPTIQYLTEQGAKVLLASHLGRPKGQVS
PGK_ANOFW       ---NKKTVRDIDVKGKRVFCRVDFNVPMQNGVVTDDTRIRAALPTIQYLMEQGAKVILASHLGRPKGKVV
PGK_BACC3       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAV
PGK_BACC0       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAV
PGK_BACAH       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAV
PGK_BACAN       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAV
PGK_BACAC       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAV
PGK_BACAA       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAV
PGK_BACC7       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVV
PGK_BACC2       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAV
PGK_BACCQ       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVV
PGK_BACME       ---NKKTLKDIDVKGKRVFCRVDFNVPMKDGKVTDETRIRAAIPTIQYLVEQGAKVILASHLGRPKGEVV
PGK_BACCZ       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVV
PGK_CHLT3       ----KKTVDDVSFAGKRVLMRVDFNVPLKDGAVTDDIRIRGALPSIQKVLSDGGCVILMSHLGRPKGKPV
PGK_BACC4       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVV
PGK_BACWK       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLIEQGAKVILASHLGRPKGQAV
PGK_BACC1       ---NKKSIRDVDLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVV
PGK_THEM4       ----KLTIRDIDIKNKKVIMRVDFNVPLKDGKITDDTRIVEALPTIKYAIENNAVVILLSHLGRPKGERK
PGK_GEOKA       ---NKKTIRDVEVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGRPKGKVV
PGK_MOOTA       ----KLTLKDLELNNKRVLVRVDFNVPLEAGRVTDNTRIRAALPTIEYLLDHGARVILMSHLGRPKGKVK
PGK_GEOSW       ---NKKTVRDVDVKGKRVFCRVDFNVPMENGAITDDTRIRAALPTIRYLMEQGAKVILASHLGRPKGKVV
PGK_BACST       ---NKKTIRDVDVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGRPKGKVV
PGK_LACAC       ----KLIISDLDVKGKKVLVRVDFNVPIKDGVIGDDNRIVAALPTIKYIIEHGGKAILLSHLGRVKSDAK
PGK_LACH4       ----KLIVDDLDVKGKKVLVRVDFNVPIKDGVIGDDNRIVAALPTIKYIIEHGGKAILLSHLGRVKSDAK
PGK_DICT6       ----KKTILDLQLKGKRVLVRVDFNVPIKNGVITDDRRIREALPTIKYLIDRGAKVILVSHLGRPKG-FQ
PGK_ELUMP       ---NIKKLQDLDVKGKTVLVRVDYNVPLKDGKVDNNKRIVASEKTVKYLLDNNCKVVLMSHLGRPKGKVA
PGK_MACCJ       ----KKVVSDLELKDKKVLVRADFNVPMKDGNITNDNRIVEALPTIKYIIEQGGKVILFSHLGKVKTEEK
PGK_EXISA       ---NKQSIRDIDVKGKRVFCRVDFNVPLKDGVIQDETRIQAALPTIKHLLDGGAKLVLASHLGRPKGEKK
PGKH_VOLCA      ----KKSVGDLDLEGKRVFVRADLNVPLKTLAITDDTRIRAAVPTLKYLLDNGAKVLLTSHLGRPKGGPE
PGK_DICTD       ----KKTILDLRLKGKRVLVRVDFNVPLKNGVITDDRRIREALPTIKYLMDKGAKVILVSHLGRPKG-FQ
PGK_BREBN       ---NKKSIRDVELAGKRVFCRVDFNVPMQDGVITDDTRIRAAVPTIRFMMEAGAKVILASHFGRPKGQVV
PGK_LACRJ       ----KLTVEDLPLEGKKVLMRVDFNVPIKDGVVGDDNRIVAALPTIKYVIDHGGRAILFSHLGRKKEEDK
PGKH_SPIOL      ----KKSVGDLDLKGKKVFVRADLNVPLDDSQITDDTRIRAAIPTIKHLINNGAKVILSSHLGRPKG-VT
PGK_STACT       ----KKHVSDLDLKGKVVLERADFNVPLKDGKITNDNRIVQALPTIEYILDQGGRLVLFSHLGKVKEESK
PGK_LACS1       ----KLIVSDLDVKGKKVLMRVDFNVPIKNGVIGNDNRIVAALPTINYIIEHDGKAILFSHLGRKKEEDK
PGK_THEAB       ----KLTIRDIDLKGKRVIMRVDFNVPMKDGEITDDTRIVEALPTIKYAIENGAIVILLSHLGRPKGERK
PGKY_TOBAC      ------SLKEADLKGKRVFVRVDLNVPLDENFITDDTRIRAAVPTIKYLMQHGSHVILASHLGRPKG-VT
PGK_PEDPA       ----KLTVSDLDVKNKKVLMRVDFNVPVKNGVIGDDNRVVAALPTIKYIIENGGKAILFSHLGRIKTEEK
PGK_ACIBL       ---SKLSIKDLQLSNKRVFMRVDFNVPLENGRVTDDTRIRETLPTIEYALRHGAKLILCSHLGRPKGKPN
PGK_LACDL       -----------------------FNVPIKDGVIGDDNRIVAALPTIKYIIENGGKAILLSHLGRIKSEDK
PGK_GLOVI       ----KKTVEALDLKGKRALVRVDFNVPLDEGQITDDTRIRAALPTIGMLTGGGARVILVSHLGRPKG-FD
PGK_CHLAD       ---NKKTIRDVDWAGKRALVRVDFNVPLDEGQITDDTRIRAALPTIRYLLEHGAKVILMSHLGRPKGKPN
PGK_BACHD       ---NKQSVRDVELQGKKVFCRVDFNVPMKDGVVTDDTRIRAALPTIQLLAEKGARIILASHLGRPKGEVV
PGK_LACCB       ----KLIVSDLDVKDKKVLIRVDFNVPIKDGVIGDDNRIVAALPTIQYVIDHGGKAILLSHLGRVKTEEK
PGK_LACC3       ----KLIVSDLDVKDKKVLIRVDFNVPIKDGVIGDDNRIVAALPTIQYVIDHGGKAILLSHLGRVKTEEK
PGKH_TOBAC      ----KKSVGDLELKGKKVFVRADLNVPLDDNQITDDTRIRAAVPTIKHLMANGAKVILSSHLGRPKG-VT
PGK_ANADF       -----KTIDALDLAGKRVFIRVDFNVPLDEQRVTDDARIRAALPTIKHAIQARAKVILGSHLGRPKGKPR
PGK_LACJO       ----KLIVSDLDLKGKKVLVRVDFNVPIKNGVIGDDNRIVAALPTIKYIIDHGGKAILLSHLGRVKSDAK
PGK_LACGA       ----KLIVSDLDLKGKKVLVRVDFNVPIKNGVIGDDNRIVAALPTIKYIIEHGGKAILLSHLGRVKSDAK
PGK_THELT       ----KLTIKDIDLSNKAVIMRVDFNVPIKDGKVSDDTRITAALPTIKYAVEKKAKVILLSHLGRPKGSFD
PGK_LACBA       ----KLTVSDLDLKGKKVLMRVDFNVPIKDGVIGNDNRIVAALPTIKYVIEHGGKAILLSHLGRKKEEDK
PGK_ANADE       -----RTIDALDLAGKRVFIRVDFNVPLDQGKVTDDARIRAALPTIRHAIQAKAKVILASHLGRPKGKPR
PGK_BORT9       -----KTIKDCDFAGKRALVRCDFNVPLKEGNITDDTRIRAALPTIEYLKSQGARVILMSHLGRPKGEKN
PGK_ANAD2       -----RTIDALELAGKRVFIRVDFNVPLDQGRVTDDARIRAALPTIRHAIQAKAKVILASHLGRPKGEDR
PGK_AKKM8       ----KLTVRDLDAKGKEVLMRVDFNVPLKDGEITNDARIVAALPTIKFLLDQGARLVLTSHLGRPKNEPD
PGK_BACSK       ---NKKTLYDYDFAGKTVFCRVDFNVPMKDGKITDETRIQAALPTIKYLSEQGARVLLASHLGRPKGEVV
PGK_LISIN       ----KKVVTDLDLKNKKVLVRVDFNVPMKDGKITNDNRIVAALPTIEYILEQNGKAILFSHLGKVKTEED
PGK_ANASK       -----RTIDALDLAGKRVFIRVDFNVPLDQGRVTDDARIRAALPTIRHAIQAKAKVILASHLGRPKGKPR
PGK_SYNE7       ---SKRTLASLDLEGKRVLVRVDFNVPLDNGKITDDTRIRAALPTIRYLSESGAKVILVSHFGRPKGKPV
PGK_THEEB       ---SKKSVAQLSLEGKRVLVRVDFNVPVDEGVITDETRIRAALPTIQDLISKGAKVILVSHFGRPKG-VD
PGK_LACF3       ----KLTVEDLDLAGKKVLMRVDFNVPIKDGVVGDDNRIVAALPTIKYVLDHQGKAILFSHLGRIKKEDK
PGK_ANAVT       ---SKKTVASLSISGKRALVRVDFNVPLDDGNITDDTRIRAALPTIQDLTQKGAKVILASHFGRPKG-VD
PGK_SPICI       ---NKKELKDVQVKGKKVLVRVDFNVPMKDGQVTDDNRIIAALPTIKYLIAQEAKVILFSHLGKVKADDL
PGK_LEUMM       ----KLTVSDLELSGKKVLMRVDFNVPIKAGVIGNDNRIVAALPTIKYVLENNGRAILFSHLGRIKSEDK
PGK_MYCMS       MNYNKKTLKDIDVKNKTVLVRVDFNVPIQNGVITDDNRIIAAFPTINYLLENDAKIVLFSHLSRIKSEDK
PGK_CYAP4       ---SKKTVANLSLAGKRVLVRVDFNVPLDDGKITDDTRIRAALPTIQDLTSKGAKVILSSHFGRPKGETK
PGK_ANASP       ---SKKTVASLSISGKRALVRVDFNVPLDDGNITDDTRIRAALPTIQDLTQKGAKVILASHFGRPKG-VD
PGK_PROMT       --------------GKRVLVRVDFNVPLGDGLITDDTRIRAALPTINDLLDKSARVILSAHFGRPKGQVN
PGK_LACPL       ----KLIVSDLDVKDKKVLIRVDFNVPIKDGKIGDDNRIVAALPTIKYVIEHDGKAILFSHLGRIKSEDK
PGK_LACDE       -----------------------FNVPIKDGVIGDDNRIVAALPTIKYIIENGGKAILLSHLGRIKSEDK
PGK_LACDB       -----------------------FNVPIKDGVIGDDNRIVAALPTIKYIIENGGKAILLSHLGRIKSEDK
PGK_LACDA       -----------------------FNVPIKDGVIGDDNRIVAALPTIKYIIENGGKAILLSHLGRIKSEDK
PGK_SYNP6       ---SKRTLASLDLEGKRVLVRVDFNVPLDNGKITDDTRIRAALPTIRYLSESGAKVILVSHFGRPKGKPV
PGK_PROM5       -----------------VLVRVDFNVPLNDGQITDDTRIRAAIPTIKYLINNSAKVILAAHFGRPKGKVN
PGK_NOSP7       ------------ISGKRALVRVDFNVPVDDGKITDDTRIRAALPTIQDLTQKGAKVILASHFGRPKG-VD
PGKT_THEMA      ----KMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPS
PGK_THEP1       ----KMTIKDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPS
PGK_LEUCK       ----KLTVSDLELSGKKVLMRVDFNVPIKAGVIGNDNRIVAALPTIKYVLENNGRAILFSHLGRIKSEDK
PGK_THESQ       ----KMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVIFLSHLGRPKGEPS
PGKH_WHEAT      ----KKSVGDLDLEGKRVLVRADLNVPLDDNQITDDTRIRAAIPTIKYLLSNGAKVILTSHLGRPKG-VT
PGK_CHLSY       ---NKKTIRDVDWAGKRALVRVDFNVPLDDGQITDDTRIRAALPTIRYLLEHGASVVLMSHLGRPKGKPN
PGK_CHLAA       ---NKKTIRDVDWAGKRALVRVDFNVPLDDGQITDDTRIRAALPTIRYLLEHGASVVLMSHLGRPKGKPN
PGK_CYAP7       ----KKTIANLSVEGKRVLVRVDFNVPLDDGNITDDTRIRAALPTIQDLISKGAKVILCSHFGRPKGKVV
PGKY_WHEAT      ------TLGEADLKGKKVFVRADLNVPLDDAQITDDTRIRASIPTIKYLLEKGAKVILASHLGRPKG-VT
PGK_CHLPB       ----KKSLYDISCKGSRVLMRVDFNVPLDEHAITNDKRIIEALPSIHKIIEDGGRLILMSHLGRPKGKVV
PGK_PELTS       ----KKTVRDIDVKGKRVLLRVDFNVPMENGRVADDVKIKEAVPTINYLIGQKARVILVSHLGRPKGRVD
PGK_CHLPD       ----KKTLSDVAIQGKRVLMRVDFNVPIEEKNITDDKRIVEALPSIKKIIDGGGRLILMSHLGRPKGKVN
PGKH_CHLRE      ----KKSVGDLHLEGKRVFVRADLNVPLDKATITDDTRIRAAVPTLKYLLDNGAKVLLTSHLGRPKGGPE
PGK_SYNY3       -------LTEADLAGKRVFVRVDFNVPLDNGSITDDTRIRAALPTIKDLLSKGAKVILGSHFGRPKGKVV
PGK_BORHD       -----KTIKDFDFSGKRALVRCDFNVPLREGNITDDTRIRAALPTIEYLKSQGARVVLMSHLGRPKGERN
PGK_CHLTE       ----KKTLSDISLQGKRVLMRVDFNVPLQDRNITDEKRIVEALPSIRKVIDNGGRLILMSHLGRPKGKVN
PGK_PROMA       ----KRSLSNLSVEGKRVLVRVDFNVPLEEGSITDDTRIRAALPTIQHLIEKEARVILSAHFGRPKGKVN
PGK_ACAM1       ---SKKTIANLDLSGKRVLVRADFNVPLDDGKITDDTRIRAALPTIQDLTSKGAKVILASHFGRPKGQVN
PGK_CYAP8       -------LSPADVAGKRVLVRVDFNVPLDGATITDDTRIRAALPTIKDLIEKGAKVILCSHFGRPKGQVV
PGK_PROM0       ------SLDKTHLEGKKVLVRVDFNVPLEDGQITDDTRIRAAIPTIEYLVNHSAKVILAAHFGRPKGQVN
PGK_LISMH       -----------------------FNVPMKDGKITNDNRIVAALPTIEYILEQNGKAILFSHLGKVKTEED
PGK_LISMF       -----------------------FNVPMKDGKITNDNRIVAALPTIEYILEQNGKAILFSHLGKVKTEED
PGK_LISMC       -----------------------FNVPMKDGKITNDNRIVAALPTIEYILEQNGKAILFSHLGKVKTEED
PGK_CARHZ       ---NKKSIRDVEVKGKKVFVRVDFNVPLNENEITDDTRIRAALPTLQYLREQGAKLIVASHLGRPKGQFN
PGK_PROMP       -----------------VLVRVDFNVPLNDGQITDDTRIRAAIPTIKYLINNSAKVILAAHFGRPKGKVN
PGK_LISMO       -----------------------FNVPMKDGKITNDNRIVAALPTIEYILEQNGKAILFSHLGKVKTEED
PGK_PROM9       ------SLDKTNLEGKKVLVRVDFNVPLEDGQITDDTRIRAAIPTIEYLINHSAKVILAAHFGRPKGQVN
PGK_PROM2       ------SLDKTHLEGKKVLVRVDFNVPLEDGQITDDTRIRAAIPTIEYLINHSAKVILAAHFGRPKGQVN
PGK_LISW6       -----------------------FNVPMKDGKITNDNRIVAALPTIEYILEQNGKAILFSHLGKVKTEED
PGK_PROMS       ------SLDKTHLEGKKVLVRVDFNVPLEDGQITDDTRIRAAIPTIEYLINHSAKVILAAHFGRPKGQVN
PGK_BORBU       -----KTVKDFSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLGRPDGKKN
PGKH_ARATH      ----KKSVGDVDLKGKKVFVRADLNVPLDDNQITDDTRIRAAIPTIKFLIENGAKVILSTHLGRPKG-VT
PGK_TRIEI       ----KKTVASLSLSGKKVLMRADFNVPVDNGSITDDTRIRAALPTIQDLTEKGAKVILTSHFGRPKGKVN
PGK_STAAW       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAAU       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAAT       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAAS       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAAR       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAAN       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAAM       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAAE       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAAC       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAA9       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAA8       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAA3       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAA2       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAA1       ----KKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAHJ       ----KKIVSDLDLKGKVVLERADFNVPLKDGKITNDNRIVQALPTIKYIIEQGGKLVLFSHLGKVKQESD
PGK_ENTFA       ----KKTIXXXXXXXXXXXXXXXFNVPLKDGVITNDNRIVAALPTIKYVIENGGKAILFSHLGRVKTEEK
PGK_BORRA       -----RTIKDCDFSGKRALVRCDFNVPLREGNITDDTRIKAALPTIEYLKSQGARVVLMSHLGRPKGEKN
PGK_SYNR3       ------------LRGKRVLVRVDFNVPLNDGAITDDTRIRAALPTIKDLTGKGAKVILSAHFGRPKGQVN
PGK_STAAB       ----KKIVSDLDLKGKTVIVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHLGKVKEESK
PGK_STAES       ----KKIVSDLDLKGKVVLERADFNVPIKDGEITNDNRIVQALPTIEYIIEQGGKLVLFSHLGKVKEESD
PGK_STAEQ       ----KKIVSDLDLKGKVVLERADFNVPIKDGEITNDNRIVQALPTIEYIIEQGGKLVLFSHLGKVKEESD
PGK_BORDL       -----RTIKDCDFSGKRALVRCDFNVPLREGNITDDTRIKAALPTIEYLKSQGARVVLMSHLGRPKGEKN
PGK_STAS1       ----KKIVTDLELKGKTVLVRADFNVPMKDGEITDDNRIVQALPTIKYIIEQGGKVVLFSHLGKVKEESK
PGK_BORGA       -----KTVKDFNFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLKEKGARIVLISHLGRPEGKKN
PGK_CHLP8       ----KKTLSDISLQGKRVLMRVDFNVPLQDRNITDDKRIVGALPSIRKVIEEGGRLILMSHLGRPKGKVN
PGK_SYNJA       ------------LKGKRVLVRADFNVPLDQGNITDDTRIRASLPTIQALAQAGAKVILTSHLGRPIQKAR
PGK_STRSY       ----KLTVKDVELKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIKYILEQGGRAILFSHLGRVKEEAD
PGK_STRS2       ----KLTVKDVELKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIKYILEQGGRAILFSHLGRVKEEAD
PGK_PROM4       --------------GKRVFVRVDFNVPVNEGDITDDTRIRAALPTIKDLIDKGARVILSAHFGRPKGQVN
PGK_AQUAE       ----KKTLRDVDVKGKRVLVRVDYNVPLDEGNIVDDTRIRASLPTVEYLLDANAKVILMSHLGRPKNR-D
PGK_SYNJB       --------------GKRVLVRADFNVPLDQGNITDDTRIRAALPTVQALTQAGAKVILTSHLGRPVKKAR
PGK_BORBZ       -----KTVKDFSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLGRPDGKKN
PGK_OENOB       -------------------MRVDFNVPIKDGVIGNDNRVVAALPTIKYVLEQGGKAILFSHLGRKKAEDK
PGKB_TRYBB      ----RKSINECDLKGKKVLIRVDFNVPLDDGNITNDYRIRSALPAVQKVLTEGGSCVLMSHLGRPKGVSM
PGK_GEOMG       -------IDEIELKGKKVFIRVDFNVPLDEHQITEDTRIRAVLPTINFALDAGAKVILASHLGRPKGERK
PGK_BORAP       -----KTVKDFNFAGKRVLVRCDFNVPLKEGSISDDTRIKAALPTIEYLKERGARIVLVSHLGRPEGKKN
PGKC_TRYBB      ----KKSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGRPKGGGV
PGK_STRTD       ----KLTVKDVELKGKKVLVRVDFNVPVKDGVITNDNRITAALPTIKYILEQGGRAILFSHLGRVKEEAD
PGK_STRT2       ----KLTVKDVELKGKKVLVRVDFNVPVKDGVITNDNRITAALPTIKYILEQGGRAILFSHLGRVKEEAD
PGK_STRT1       ----KLTVKDVELKGKKVLVRVDFNVPVKDGVITNDNRITAALPTIKYILEQGGRAILFSHLGRVKEEAD
PGK_SYNP2       -------LTEADLSGKRVFVRVDFNVPLNEGVITDDTRIRAALPTIKYLTEKGAKVILGSHMGRPKGQVV
PGK_ROSCS       ----KKTIRDIDWSGKRALVRVDFNVPLENGQITDDTRIRAALPTIRYLLEHGAAVILMSHLGRPKNKVV
PGK_ROSS1       ----KKTIRDIDWSGKRALVRVDFNVPLENGQITDDTRIRAALPTIRYLLEHGAAVILMSHLGRPKNKVV
PGK_PROM1       --------------GKRVLVRVDFNVPLGDGQITDDTRIRAALPTINDLLDKSARVILSAHFGRPKGEVN
PGK_SYNSC       ------------LSGKRVLVRVDFNVPLNDGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVN
PGK_LACLA       ----KLTVKDVELKGKKVLVRVDFNVPIKDGVITNDNRITAALPTIKYILEQGGRAVLFSHLGRVKEEAK
PGK_PELPB       ----KKSLSDIAIQGKRVLMRVDFNVPLDSNKITDDKRIIESLPSIKKVLENGGRLILMSHLGRPKGKVN
PGK_LACLS       ----KLTVKDVELKGKKVLVRVDFNVPIKDGVITNDNRITAALPTIKYILEQGGRAVLFSHLGRVKEEAK
PGK_SYNPW       ------------LSGKRVLVRVDFNVPLNDGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVN
PGK_SULDN       -------IKNLDLAGKKVFIRCDFNVPMDEGNISDDRRIRSAVSTINYCLDQECAVILASHLGRPEGEVV
PGK_PROVI       ----KKTLSDITIQGKRILMRVDFNVPLNDEEITDDKRIVEALPSIRKILDNGGRLILMSHLGRPKGKVN
PGK_SYNPX       ------------LSGKRVLVRVDFNVPLNEGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVN
PGK_LACLM       ----KLTVKDVELKGKKVLVRVDFNVPIKDGVITNDNRITAALPTIKYILEQGGRAVLFSHLGRVKEESK
PGK_HERA2       ---NKQTIRDVAWSGKRALVRVDFNVPLDQAKVTDDTRIRAALPTINYLLEQGASVILMSHLGRPKKKVA
PGK_GEOSM       -------IDEIELSGKKLFMRVDFNVPLDDNQITEDTRIRAVLPSINYALDQKAKIILASHLGRPKGERK
PGK_ACHLI       ----KKTIRDIELKNKSVLMRVDFNVPLKDGSISDDTRITAALPTIEYAIEKGAKLILFSHLGRIKAEDK
PGK_GEOBB       -------IDEIELSGKKLFMRVDFNVPLDDHQITEDTRIRAVLPSINYALDQKAKIILASHLGRPKGERK
PGK_ONYPE       -----KSLTNMNITNKKVLLRADLNVPLENSVITDDNRIKAILPTLKYLVQQKAKVIIFSHLGRVKTEAK
PGK_CHLL2       ----KKTLSDITIQGKRVLMRVDFNVPLEEKNITDDKRIVEALPSIKKIIENGGRLILMSHLGRPKGKPN
PGK_GEOUR       ------------LREKKIFMRVDFNVPLDEHQITEDTRIRAVLPTINYALDYNAKVVLASHLGRPKGERN
PGK_TREDE       -----KTVKDVNLKDKRIIMRVDFNVPMKDGVVQDDTRIRAALPTIKYILEQGARLVLMSHLGDPSXXGK
PGK_PROMM       ------------LRSKRVLVRVDFNVPLNEGAITDDTRIRAALPTINDLIDKGARVILSAHFGRPKGQIN
PGK_PROM3       -----------------VLVRVDFNVPLNEGAITDDTRIRAALPTINDLIDKGARVILSAHFGRPKGQIN
PGK_RHOBA       ----KKTIDQIDVQDKTVLMRVDFNVPLDESLITDDRRIRMALPSIKSVIDRGGKVILMSHLGRPTGEGD
PGK_MICAN       ----KKTVANLDLAGKRVLVRVDFNVPMDKGAISDDTRIRAALPTIEDLIKKGAKVILCSHMGRPDGQVK
PGK_CHLCH       ----KKTLSDIATQGKRVLMRVDFNVPLDENKITDDKRIVESLPSIRKVIEEGGRLILMSHLGRPKGKVN
PGK_GEOLS       ------------LKGKKVFIRVDFNVPQDEGNITEDTRIAGAVPTIKYAVEQGAKVVLASHLGRPKGEKK
PGK_STRGG       -----KTIDELLVAGKRVFVRADLNVPLDGTTITDDGRIRAVVPTIAKLAEAGARVVVASHLGRPKGAPD
PGK1_TRYCO      ----KKSINECDLKGKKTLVRVDFNVPVKGGVITNDYRIRSALPTIQKVLNEGGSCILMSHLGRPKGISI
PGK_BIFLO       ----------------RVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLGRPKGKVV
PGK_BIFLI       ----------------RVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLGRPKGKVV
PGK_BIFLD       ----------------RVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLGRPKGKVV
PGK_FUSNN       ----KKIITDLDLNNKKVLMRVDFNVPMKDGKITDENRIVQALPTIKYVLEHNAKLILFSHLGKVKEEDK
PGK_STRU0       -----------------------FNVPLKDGVITNDNRISAALPTIKYIIENGGRAILFSHLGRVKEEAD
PGK_LEPBL       -------LENVDLSGKRVFLRVDFNVPIENGKVTDKTRIEKTLPTIELLIKKGARIIIASHLGRPKGQTN
PGK_SYNS3       ------------LSGKRVLVRVDFNVPLNDGAITDDTRIRAALPTINDLIGKGAKVILAAHFGRPKGQVN
PGK_FERNB       ----KLTIRDVDLKGKRVIMRVDFNVPIKDGVVTDDTRIVEALPTIKYVLEQGAKVILLTHLGRPKGGPD
PGK_LEPBJ       -------LENVDLSGKRVFLRVDFNVPIENGKVTDKTRIEKTLPTIELLIKKGARIIIASHLGRPKGQTN
PGK_STRAW       -----KTIDELLVDGKRVFVRADLNVPLADGLITDDGRIRAVLPTVKALAEAGAKVVVASHLGRPKGAPD
PGK_COPPD       -----RSIRDAEVRNKRVIVRVDFNVPLDEGNVVDDFRIRAALPTIEYLVENGAKVILISHLGRPKGKRD
PGK_YARLI       ---NKLSIKDLDLKNKRVFIRVDFNVPLDGTTITNNQRIVAALPSIKYAIDQGAKVILASHLGRPNGQRV
PGK_STRPN       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRZT       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRZP       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRZJ       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRPS       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRPM       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRPJ       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRPI       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRPF       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRP7       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRP3       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRA5       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRA1       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRR6       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEESK
PGK_STRPC       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRPB       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRP6       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRP2       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEESK
PGK_STRP1       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRA3       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_RUBXD       ---DKRSVRDLELRGKKVLVRVDFNVPVKGGEVTDDTRIRRALPTIRYLLQRGARVALISHLGRPKGEPD
PGK_STRPZ       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRP4       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAK
PGK_STRCO       -----KTIDELLVAGKRVFVRADLNVPLDGTTITDDGRIRAVVPTVKALADAGARVIVASHLGRPKGAPD
PGK_NEUCR       ---NKLSIEDVDLKGKRVLIRVDFNVPLDEKKVTNPQRIAGAIPTIKYALDHGAKVVLMSHLGRPDGKPN
PGK_AGABI       ---NKLSITDLALTGKRVLIRVDFNSPIQDGKITNPARINAALPTIKYALDNGAKVILMSHLGRPDGKAI
PGK_STRPG       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_PELPD       ------------LKDKKVFIRVDFNVPQDSGNITEDTRITGALPTIRYAIEQGARVILASHLGRPKGEKN
PGK_STRSV       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_STRP8       -----------------------FNVPLKDGVITNDNRITAALPTIKYIIEQGGRAILFSHLGRVKEEAD
PGK_BIFAA       ----------------RVLVRADFNVPLDGTTITDDGRIKAALPTIKALREQGAKVILMAHLGRPKGKVV
PGK_PELLD       ----KKTLSDITIQGKRVLMRVDFNVPLDNGEITDDKRIVEALPSIRKVLDNGGRLILMSHLGRPKGKVN
PGKE_TRYBB      ----RKSINECDLKGKKVLIRVDFNVPLDDGNITNDYRIRSALPAVQKVLTEGGSCVLMSHLGRPKGVSM
PGKB_CRIFA      ----KKTIDDAVVKGKKVLIRVDFNVPVKNGEITNDFRIRSALPTIQKVLKEGGSCILMSHLGRPKGDPK
PGK_LEPIN       -------LENVDLSGKRVFLRVDFNVPVENGKVTDKTRIEKTLPTIELLIKKGARIIIASHLGRPKGQVN
PGKC_LEIME      ----KKSIDDVALKDKKVLIRVDFNVPVKNGEITNDFRIRSALPTIQKVLKEGGSCILMSHLGRPKGDPK
PGK_NAUPA       --------------GSSVFLRCDFNVPLDEGNITDDRRIRMALPTIKYLLDNECKIVIASHLGRPKGEFD
PGK_BEUC1       -----RTIDDLELRGKTVLVRSDFNVPLDGTTITDDGRIRAALPTLKRLVDAGAKVVVTAHLGRPKGAPD
PGK_STRE4       -----------------------FNVPLKNGVITNDNRISAALPTIKYIIEHGGRAILFSHLGRVKEEAD
PGK_ARCB4       -------IKNIDITGKKVFIRCDFNVPMDENNITDDRRIRSALNTIRYCIDHDCSVILSSHFGRPKGGFE
PGK1_PANTR      ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
PGK1_HUMAN      ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
PGK_BDEBA       -----KTVRDFELAGKVVFLRLDLNVPMENGKITDENRITASLPTIKYCMEQGAKLVMASHLGRPKTKDD
PGK1_PONAB      ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
PGK1_MACFA      ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
PGK1_MACEU      MSLSKKTLDKVDLKGKRVIMRVDFNVPMKNKEITNNQRIKAALPSINYCLDNGAKVVLMSHLGRPDGVPM
PGK_LEPIC       -------LENVDLSGKRVFLRVDFNVPVENGKVTDKTRIEKTLPTIELLIKKGARIIIASHLGRPKGQVN
PGKC_CRIFA      ----KKSIDDAVVKGKKVLIRVDFNVPVKNGEITNDFRIRSALPTIQKVLKEGGSCILMSHLGRPKGDPK
PGK_STRS7       -----------------------FNVPLKNGVITNDNRISAALPTIKYIIEHGGRAILFSHLGRVKEEAD
PGK_NITSB       ---NIKSIKDLDLKGNSVFIRCDFNVPLDEGNITDDRRIREALPTIRYCLDNDCKIVLGSHLGRPKGFDE
PGK_CLAMS       -----RTIDSLDLRGRRVIVRCDLNVPLKGGVIGDDGRIRASLGTLTGLREAGARVIVISHLGRPDGTPD
PGK_SCHPO       ----KLAITDVDLKGKNVLIRVDFNVPLDGDRITNNARIVGALPTIKYALEQQPKVILMSHLGRPNGARV
PGK_PICPA       ---NKLSVKDLDVAGKRVFIRVDFNVPLDGDKITNNQRIVAALPTIQYVLDHKPKVVLASHLGRPNGEVN
PGK_GLOMO       ---NKLSIRDLNVKDKRVLIRVDFNVPLDGTTITNNQRIVAALPTIKYALEQKAKVVLMSHLGRPDGKKV
PGK_STRGC       -----------------------FNVPVKDGVITNDNRITAALPTIKYILEQGGRAILFSHLGRVKEEAD
PGK_STREM       -----------------------FNVPLKNGVITNDNRISAALPTIKYIIEHGGRAILFSHLGRVKEEAD
PGK_SOLUE       ------SIRDLDLKGKRVFIRVDFNVPLQKNEITSDKRIKASLPTIQYALEHGAAVILASHLGRPKGKPN
PGK_ACIC5       ---SKLSIRDLDLAHKHVFMRVDFNVPLSESEITDDTRIRETLPTIEYALRHKAKLILASHLGRPKGKVN
PGK1_PIG        ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAIPSIKFCLDNGAKVVLMSHLGRPDGIPM
PGK_STRMU       -----------------------FNVPVKDGVITNDNRITAALPTIKYIIEHGGRAVLFSHLGRVKEEAK
PGK1_BOVIN      ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKYCLDSGAKVVLMSHLGRPDGVPM
PGKB_LEIME      ----KKSIDDVALKDKKVLIRVDFNVPVKNGEITNDFRIRSALPTIQKVLKEGGSCILMSHLGRPKGDPK
PGK_SYNS9       ------------LSGKRVLVRVDFNVPLNDGAITDDTRIRAALPTINDLVGKGAKVVLAAHFGRPKGQVN
PGK_SYNFM       -----KTVGELELSGKRVFIRVDFNVPLKEFRVKDDLRIRAVLPTLNKVIEKGGKAILASHLGRPKGKPS
PGK_DEBHA       ---NKLSVKDLDVSGKRVFIRVDFNVPLDGKTITNNQRIVAALPTIKYVLENKPKVILASHLGRPNGEKV
PGK_CORA7       -----KTLDDLLVSGRHVLVRSDFNVPLDDGNITDSGRITASLPTIKALIEGGAKVILSAHLGRPKGEVN
PGK1_RAT        ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
PGK_TRIVI       ---NKLSITDVDVKGKRVLIRVDFNVPLDENKITNPQRIAGAIPTIKHALDNGAKVILMSHLGRPNGAVN
PGK_TRIRE       ---NKLSITDVDLKGKRVLIRVDFNVPLDENKITNNQRIVGAIPTIKHALDNGAKVVLMSHLGRPNGAVN
PGK1_CRIGR      ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
PGK_HELHP       ---NTKSVRDIDVKDKRVLIRVDFNVPMEDFDISDDTRIREALPTINYCIDNHAQIVLVSHLGRPKGR-N
PGK_MYCPU       ----KKLITDLNLNDKKVLIRLDLNVPLKGKKITSLKRIEESIPTIKYVQERGGKIILLSHLGRVKTEDK
PGK1_HORSE      ---NKLTLDKLNVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGPMP
PGK1_MOUSE      ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
PGK_DESAH       -----KTVREIEFNSKTVLVRVDYNLPMENGNIADDNRIRATLPLVNYLVDKGAKIVLASHMGRPKGXXX
PGK_PROA2       ----KKTLSDISCKGKRILMRVDFNVPLDNGTITNDKRIIEALPSIRQVLETGGRLILMSHLGRPKGKVT
PGK_CORDI       -----KTLKDLLVEGRHVLVRSDFNVPLNDDEITDAGRITASLPTIKALVDNGARVILMAHLGRPKGEVN
PGK_DEIGD       -----QTLDQLDVNGKRVLVRVDYNVPIKDGVVQDETRVTASLPTLQHLLARGAALVLLSHLGRPKNGPE
PGK_FRATW       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPEGEYD
PGK_FRATT       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPEGEYD
PGK_FRAT1       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPEGEYD
PGK_ASPOR       ---NKLAITDVDLKDKRVLIRVDFNVPLDDKKITNNQRIVGALPTIKYAIENGAKVVLMSHLGRPDGKAN
PGK_CANMA       ---NKLSVKDLNVTGKRVFIRVDFNVPLDGKTITNNQRIVAALPTIKYVEEQKPKIILASHLGRPNGERN
PGK_FRATN       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPEGEYD
PGK_CAMHC       ------SVKDIKFKGEKVFIRCDFNVPMDEFLITDDRRIRAAIPTIRYCLDEGCSVILASHLGRPKNGYE
PGK_METCA       -----KRMTDIDLAGKRVLIREDFNVPVKDGRVTSDARIRAALPTIRHALDAGAAVMLMSHLGRPEGEYA
PGK_FRATO       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPEGEYD
PGK_FRATH       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPEGEYD
PGK_FRATF       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPEGEYD
PGK_FRATM       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPESEYD
PGK_CAMJR       ------SIKDIDLAKKKVFIRCDFNVPQDDFLITDDRRIRSAIPTIRYCLDNGCSVILASHLGRPK-EIS
PGK_METEP       -----RTLDDAPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLAHFGRPKGKPD
PGK_CANGA       ---SKLTVQDLELKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHNPRVVLASHLGRPNGERN
PGK_CANAL       ---NKLSVKDLDVAGKRVFIRVDFNVPLDGKTITNNQRIVAALPTIKYVEEHKPKIVLASHLGRPNGERN
PGKC_LEIMA      ----KKSIDDATVRDKKVLIRVDFNVPVKNGKITNDFRIRSALPTIQKVLKEGGSCILMSHLGRPKGDPS
PGK_DESAD       -------IDQLDIAGKKLLMRVDFNVPLDGETITDDNRIKAAVPTFKYALEKGASVIVMAHLGKPKGKRV
PGK_CAMLR       ------SIKDIDLAKKKVFIRCDFNVPQDEFLITDDRRIRSAIPTIRYCLDNGCAVILASHLGRPK-EIA
PGK_DESAA       -------MRDVDISGKRVLIRVDVNVPLDANLITDDTRIRAVLPSINYALDEGAKVIIASHMGRPKGQVV
PGKB_LEIMA      ----KKSIDDATVRDKKVLIRVDFNVPVKNGKITNDFRIRSALPTIQKVLKEGGSCILMSHLGRPKGDPS
PGK_HYDS0       ---NKKTIRDIDLKGKRVLVRVDFNVPIDNGNIEDDARIRAAIPTIEYLLDAKAIVILMSHLGRPKGFDE
PGK_DEIDV       -----QNLSSLDVKGKRVLVRVDYNVPVKDGVVQDDTRVTASLPTVNALLGAGASVVLMSHFGRPKGGPE
PGK_CORK4       ------------VEGRHVLVRADLNVPLKDKVITDPGRIDASLPTIKALTEAGARVIVAAHLGRPKSPQD
PGK_COREF       -----KDLLDEGVDGRHVIVRSDFNVPLNDDEITDKGRIIASLPTLKALTEAGAKVIVMSHLGRPKGEVN
PGK2_MOUSE      ----KLTLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPM
PGK2_HORSE      --------------GKRIIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGARVVLMSHLGRPDGVPM
PGK_CORGB       -----KDLLDEGVDGRHVIVRSDFNVPLNDDEITDKGRIIASLPTLKALSEGGAKVIVMAHLGRPKGEVN
PGK_PLAF7       ---NKLSISDLKIKNKKVLVRVDFNVPIENGIIKDTNRITATLPTINHLKKEGAKIILISHCGRPDGLRN
PGK_DEIRA       -----QNLSQLDVKGKRVLVRVDYNVPVGDGVVQDDTRITASVPTIKKLLDGGASVVLMSHFGRPKNGPE
PGK_YEAST       ---SKLSVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRVVLASHLGRPNGERN
PGK_LEPBP       -------LEEQNLKGKRVFVRVDFNVPVENGKATDRTRIEKTLPTLELLISKGAKIILGSHLGRPKGGPE
PGK_LEPBA       -------LEEQNLKGKRVFVRVDFNVPVENGKATDRTRIEKTLPTLELLISKGAKIILGSHLGRPKGGPE
PGK_KLULA       ---SKLTVKDLDVTGKRVFIRVDFNVPLDGKKITSNQRIVAALPTIQYVLEKKPKIVLASHLGRPNGEVN
PGK_RHOSR       -----QTLDDLLVEGRAVLVRSDLNVPLDGDRITDPGRIIASAPTLKALAEAGAKVIVTAHLGRPKGEPD
PGK_CORU7       -----KTLKDLLVEGRHVLVRSDLNVPLADGEITDPGRIDASIPTLRALLDEGARVIVAAHLGRPKGEVD
PGK2_HUMAN      ------------VRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKVVLMSHLGRPDGVPM
PGK_LARHH       MQFKKLT--EQSLAGKRVLIRVDMNVPVKNGVIGDDTRIRASLPSILHCLKAGASVILMTHLGRPEGEPK
PGK_CORGL       -----KDLLDEGVDGRHVIVRSDFNVPLNDDEITDKGRIIASLPTLKALSEGGAKVIVMAHLGRPKGEVN
PGK_TREPS       -----RTCKDVTMRGERVVVRVDFNVPMRDGMVQDDTRVTAAVPTLRYIIEQGPRVVLISHLGDPEGNAK
PGK_TREPA       -----RTCKDVTMRGERVVVRVDFNVPMRDGMVQDDTRVTAAVPTLRYIIEQGPRVVLISHLGDPEGNAK
PGK_SALRD       ---HKLTLDDVDVRGQRVLIRVDFNVPLEDGCVGDDTRIRAALPTIRHVLDHGGKAILVSHLGRPGGQPD
PGK_CAEEL       -SLNKLAIDQLNLAGKRVLIRVDFNVPLKDGKITNNQRIAAAVPTIQHALSNGAKVVLMSHLGRPDGRRQ
PGK_XANP2       -----RTLDDADLADKRVLVRVDLNVPMESGRVTDETRLKAILPTIRTITDKGGKAVLLAHFGRPKGRDE
PGK_MESSB       -----KTLDDLKVAGKRVLLRVDLNVPVKDGEVTDTTRIERVAPTITELSDKGAKVILLAHFGRPKGKPD
PGK_SCHMA       MGLSKLSISDVDLKGKRVLIRVDFNVPMKDGKVTNTQRIAAAIPTIKYALDKGAKVVLMSHLGRPDGHKV
PGK_DESAP       ----KKTIRDVDIAGKRVFVRVDFNVPFNEGEVADDTRIRAVLPTIEYLLTGGAAVILASHLGRPKGKRD
PGK_SALAI       ---NIRTLDDLEVTGRRVLVRADLNVPLQTGQITDDGRIRAVLPTLGALVQAGAKVVVCSHLGRPKGSPD
PGK_METC4       -----RTLDDAPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLAHFGRPKGKPD
PGK_APLCA       ---NKLSINDVDVRDKRVLIRVDFNVPLKNGQISNNQRIAAALPTIKLALEKGAKVVLMSHLGRPDGRPI
PGK_RHILW       -----KTLDDLSIRGKRVLVRVDLNVPVKDGKVTDTTRIERVAPTILELSEKGAKVILLAHFGRPKDGPS
PGK_METPB       -----RTLDDAPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIAEAGGRVILLAHFGRPKGKPE
PGK_CAMFF       ------SIKDINFKGSKVFVRCDFNTPMDEFYITDDRRIRSAIPTIRYILDQGCSVILASHLGRPKNGYE
PGK_CAMC1       ------SINDLELNGAKVFIRCDFNVPMDEFLITDDRRIRSAIPTIRYCLDNGCSVVLASHLGRPKNGYE
PGK2_MACFA      ------------VRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKVVLMSHLGRPDGVPM
PGK_RHOOB       -----QTLDDLLVEGRAVLVRSDLNVPLDGDRITDPGRIIASAPTLKALAEAGAKVIVTAHLGRPEGEPD
PGK_MARMM       -----RRIQDADVAGKRVLVRVDFNVPMKDGQVTDATRLEAALPTIEYLTEAGAKVVLLAHFGRPKGAVV
PGK_SALTO       -----RTLDDLEVTGRRVLVRADLNVPLQTGQIADDGRIRAVLPTLSALVQAGAKVVVCSHLGRPKGSPN
PGK_RHOCS       -----KTLDDLSVAGKTVLVRGDLNVPVQDGRVSDTTRLDRLAPTLKELAGKGAKVVVLSHFGRPKGGPD
PGK_GEOSF       ------------LREKLVFIRVDFNVPQDDGNITEDTRIVGAVPTIKYAIENGAKVILASHLGRPKGEKK
PGK2_PIG        --------------GKRVIMRVDFNVPMKRNQVTNNQRIKASLPSIRYCLDNGARVVLMSHLGRPDGVAM
PGK1_RHINI      ---NKLSIRDLNLKDKRVLIRVDFNVPMKDGAITNNNRIVQALPTVKYALDNGASVILMSHLGRPNGEAV
PGK_WOLSU       -----KSIRDVEIEGKRVLIRVDFNVPMSDFNISDDTRIREAIPTINHCIDNGAKIVLVSHLGRPRGKSS
PGK_CHICK       ---NKLTLDKVDVKGKRVVMRVDFNVPMKDHKITNNQRIKAAVPTIKHCLDHGAKVVLMSHLGRPDGVPM
PGK_ARTAT       ------------VRGRYILVRSDLNVPLDGSAVTDDGRIKASLPVLKKLSDAGARVLVTAHLGRPKGAPE
PGK_ALCBS       MNFKRMT--DLDLAGKRVLIREDLNVPVKDGKVTSDARIRASLPTIEHALKAGAKVMLMSHLGRPEGEYA
PGK_XANFL       -----RTLDDVDLADKRVLVRVDLNVPMESGRVTDATRLKAILPTIRDITGKGGKAVLLAHLGRPKGRDE
PGK_PORGI       ------TIEQFNFAGKKAFVRVDFNVPLDDNFITDDTRIRAALPTLRKIIADGGMTIIGSHLGRPKGVA-
PGK_CORJK       -----KTVQDLGVQGRHVLVRADLNVPLSDGNITDPGRIDASVPTLKALLEAGARVVVSAHLGRPKGEFK
PGK_CLAM3       -----RTIDSLDLRGRRVIVRCDLNVPLKDGVIGDDGRIRASLGTLTGLREAGARVVVISHLGRPDGTPD
PGK_CAMC5       ------SISELNLAKKRVFIRCDFNVPMDEFLITDDRRIRSAIPTIRYCLDNGCSVVLASHLGRPKSGFE
PGK_PROAC       -----KSVEDLDLRGKRVVIRCDFNVPLDGDKITDDGRIKAALPTLTQLHEAGARTTVLAHLGRPKGAVD
PGK_PENCI       ---NKLPVTDVDLKGKRVLIRVDFNVPLDENKVTNPQRIVGALPTIKYAIDNGAKVVLMSHLGRPDGKVN
PGK_PROMH       ---------DLDLAGKRVLIRADLNVPVKDGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_NOCFA       -----KTLQDLLVEGRGVLVRSDLNVPLDDGQITDPGRIIASIPTLKALVEAGAKVVVTAHLGRPKGEPD
PGK_CAMJE       ------SIKDIDLAKKKVFIRCDFNVPQDDFLITDDRRIRSAIPTIRYCLDNGCSVILASHLGRPK-EIS
PGK_CAMJJ       ------SIKDIDLAKKKVFIRCDFNVPQDDFLITDDRRIRSAIPTIRYCLDNGCSVILASHLGRPK-EIS
PGK_RHOE4       -----KDLLDAGVEGRTVLVRSDLNVPLDGGEITDPGRIVASAPTLRALAEGGAKVIVTAHLGRPDGQPD
PGK_ASHGO       ---SKLTVKDLSLAGKRVFIRVDFNVPLDGKTITSNQRIVAALPTIKYVLEQGPKVVLASHLGRPNGERN
PGK_BACTN       -----QTIDKFNFAGKKAFVRVDFNVPLDENFITDDTRMRAALPTLKKILADGGSIIIGSHLGRPKGVAD
PGK_ARTCA       ------------VRGRYILVRSDLNVPLDGSTVTDDGRIKASLPVLAKLTDAGARVLVTAHLGRPKGAPE
PGK_GLUOX       -----RTLDGVDARGKRVLVRADLNVPMHDGVITDDTRLQRVAPTIRELVDKGARVVVFSHFDRPKGQVV
PGK_DICDI       ---NKLSLDKVDVKGKRVLIRVDYNVPLKNNNITSTQRIDASIPTLEYCLKNGAKIVLMSHLGRPDGLVK
PGK_DESOH       -----KSLKTIDVAGKRVLVRVDFNVPLXXXXXXXXXXXXSAVPTIEYLVGAGAKVIVCSHLGRPKGKPD
PGK_CAMJ8       ------SIKDIDLAKKKVFIRCDFNVPQDDFLITDDRRIRSAIPTIRYCLDNGCSVILASHLGRPK-EIS
PGK_LEIXX       --------------GKRVVVRCDLNVPLKDGKITDDGRVRASIPTLHALIAQGAKVAIVSHLGRPEGAPD
PGK_COXBU       -------MSNLNLHNKRVMIREDLNVPMKNGKITNDERIVRALPTIQKAIEQKARVMILSHLGRPEGKFE
PGK_AGRVS       -----KTLDDLDIAGKRVLLRVDLNVPVSGGKVTDATRIERVAPTIKELSAKGAKVILLAHFGRPKGEPV
PGK_THET2       -----RTLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRXXXXXXXXXXXXXXXGRPKGP-D
PGK_CAMJD       ------SIKDIDLAKKKIFIRCDFNVPQDDFLITDDRRIRSAIPTIRYCLDNGCSVILASHLGRPK-EIS
PGK_HAEIE       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRATIPTLKLALEKGAKVMVTSHLGRPEGEFK
PGK_THET8       -----RTLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRXXXXXXXXXXXXXXXGRPKGP-D
PGK_ACIF5       ---------DVPLKGKRVLIREDLNVPMNDGAITDDTRIRASLPTIRAALASGARVMLMSHLGRPKGVFD
PGK_ACIF2       ---------DVPLKGKRVLIREDLNVPMNDGAITDDTRIRASLPTIRAALASGARVMLMSHLGRPKGVFD
PGK_PENCH       ---NKLPVTDVDLKGKRVLIRVDFNVPLDENEVTNPQRIVGALPTIKYAIDNGRKVVLMSHLGRPDGKVN
PGK_EMENI       ---SKLSITDVDLKDKRVLIRVDFNVPLDKNTITNPQRIVGALPTIKYAIDNGAKVILMSHLGRPDGKKN
PGK_BARHE       -----RTLDDVDVTGKRVLVRVDFNVPMAQGKVCDDTRLKRHKETLLELQKRGAKLILLSHCGRPKGQVE
PGK_ARTS2       ------------VRGRYILVRSDLNVPLDGSEVTDDGRIKASLPVLTKLTDAGARVLVTAHLGRPKGAPE
PGK_SILST       -----KTLDDMDLQGKSVLTRVDINVPMEDGKVTDDTRIRRLVPTISDLLSKGAKPVLLAHFGRPKGKVV
PGK2_RHINI      ---NKLSIRDLDLKNKRVLIRVDFNVPMKDGAITNNNRIVQALPTVKYALDNGASVILMSHLGRPNGEAV
PGK_HAEIN       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRATIPTLKLALEKGAKVMVTSHLGRPEGEFK
PGK_ERWT9       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_BARQU       -----RTLDDVDVTGKRVLVRVDFNVPMSQGKVCDETRLKRHKETLLELQKRGAKLILLSHCGRPKGQGE
PGK_HAEIG       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRATIPTLKLALEKGAKVMVTSHLGRPEGEFK
PGK_RHILO       -----KTLDDINISGKRVLVRVDLNVPVADGKVTDATRIERIAPTIAELSGKGAKVILLAHFGRPKDGPS
PGK_MYCPN       -----KTVQAFDFQGKTVVLRADLNVPMKDGVITDNERILASLDTIKYLLGHNCKIVLLSHLSRXXXXXX
PGK_RHOS5       -----KTLDDMDLAGKVVLVRVDVNVPMEKGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGRPKGKVV
PGK_BRAJA       -----RTLDDVDVKGKRVLLRVDLNVPMENGRVTDATRLERVAPTITELADKGGKVILLAHFGRPKGRDA
PGK_BART1       -----RTLDDVDVLGKRVLVRVDFNVPMALGKVCDETRLVRHKETLVELQKRGAKLILLSHCGRPKGKIE
PGK_SALTY       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALTI       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALSV       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALPK       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALPB       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALPA       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALNS       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALHS       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALG2       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALEP       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALDC       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALCH       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALAR       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SALA4       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_OXYNO       ------------IKGKRVLMRVDFNVPIKEGKIKDLTRIQGALPSINYCLENGAEVVLMSHLGRPDGQRV
PGK_HAEI8       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRATIPTLKLALEKGAKVMVTSHLGRPEGEFT
PGK_FRASC       -----RTIDDLQVAGHRVLVRSDLNVPLDRSGITDDGRVRASVPTISALLDRGARVVVSSHLGRPKGEPD
PGK_CHLMU       ---DKLSIKDLSPEGKKVLVRVDFNVPIKDGKILDDVRIRSAMPTINYLLKRDAAIILVSHLGRPKGDMF
PGK_PHOLL       ---------DLDLAGKRILIRADLNVPVKDGKVTSDARIRASLPTIEAALKQGAKVMITSHLGRPEGEYS
PGK_LEGPA       -------MSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIKSALDNGAAVIVLSHLGRPEGKYE
PGK_VESOH       -------LSDLDLNSKRVLIRQDLNVPISNGVVTSDKRIKASLPTIKMALNQGAKVMLMSHRGRPEGDPS
PGK_PHOPR       ---------DLELAGKRVFIRADLNVPVKDGKVTSDARILASLPTIKRCLEAGAKVMVTSHLGRPEGEYN
PGK_RENSM       ------------VQGRYVLVRSDLNVPLSGATVTDDGRIRASLPVIEKXXXXXXXXXXXXXXXRPKGAPE
PGK_SHISS       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ECOHS       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SHIFL       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SHIF8       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_SHIBS       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ECOLI       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ECOLC       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ECOL6       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ECOL5       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ECOK1       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ECO57       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ECO24       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_XANCP       ---------DLDLSGKRVLIRQDLNVPIDNGQITSEQRITASVPTIKLALEKGAAVMVTSHLGRPKGTWS
PGK_XANCB       ---------DLDLSGKRVLIRQDLNVPIDNGQITSEQRITASVPTIKLALEKGAAVMVTSHLGRPKGTWS
PGK_XANC8       ---------DLDLSGKRVLIRQDLNVPIDNGQITSEQRITASVPTIKLALEKGAAVMVTSHLGRPKGTWS
PGK_TETTH       ------------IENKRVLMRVDFNVPLKEGKVKDPTRIQGSVPSIKKILEQNPKLVLMSHLGRPDGNRV
PGK_MYCPE       MEYNKKIVTDLDLKGKKVILRCDFNVPINSGEITDYTRIDAALQTINYLLDKGVKLIVLSHLSRVKDISS
PGK_YERPY       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_YERPS       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_YERPP       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_YERPN       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_YERPG       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_YERPE       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_YERPB       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_YERPA       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_YERP3       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEAALKQGAKVMVTSHLGRPEGEYN
PGK_PECCP       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEIALKQGARVMVTSHLGRPEGEYN
PGK_THISH       ---------DLDLAGKRVLIREDLNVPVKDGKVTSDARIRASLPTIEHAMKAGAKVMLMSHLGRPEGVFS
PGK_LEGPH       -------MSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIKSALDSGAAVIVLSHLGRPEGKYE
PGK_SHIDS       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ERWCT       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIEIALKQGARVMVTSHLGRPEGEYN
PGK_RHIL3       -----KTLDDLSIRGKRVLVRVDLNVPVKDGKVTDVTRIERVAPTILELSEKGAKVILLAHFGRPKDGPS
PGK_SODGM       ---------DLDLAGKRVFIRSDLNVPVKDGKVTSDARIRASLPTIEDSLKQGARVMVTSHLGRPEGEYN
PGK_MANSM       ---------DLDLAGKRLFIRADLNVPVKDGKVTSDARIRATIPTLKLALEKGAKVMVTSHLGRPEGEFK
PGK_EUPCR       ----KLTVDKIMIKNKRVLVRVDFNVPIKDGKVADPTRIVSTLDTINFLKENGAKIVLMSHLGRPKGVRQ
PGK_RHOPA       -----RTLDDVDVKGKRVLLRVDLNVPMDAGKVTDTTRLERVMPTITELSGKGAKVILLAHFGRPKGRDD
PGK_LEGPC       -------MSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIKSALDSGAAVIVLSHLGRPEGKYE
PGK_RHIME       -----KTLDDLDIAGKRVLVRVDLNVPVKDGQVTDTTRIERVAPTIRELSEKGAKVVLLAHFGRPKGEPV
PGK_NITMU       -------VTDLDLKGKRVFIRADLNVPVKDGKVTSDARISASMGTIDYCLKQGGKVMVTSHLGRPEGVWS
PGK_AGRT5       -----KTIDDLNIAGKRVLVRVDLNVPVADGKVTDATRIERVAPTILELSSKGAKVILLAHFGRPKGEPV
PGK_ACIAD       MNFKRMT--DLDLSEKRVLIREDLNVPVKNGQITSDARLRAALPTIQAALAQGAAVMVCSHLGRPEGEPK
PGK_YERE8       ---------DLDLAGKRVLIRADLNVPVKDGKVTSDARIRASLPTIETALKQGAKVMVTSHLGRPEGEYN
PGK_PSEE4       ---------DLDLQGKRVLIREDLNVPVKDGVVTSDARILAALPTIKLALEKGAAVMVCSHLGRPEGEFS
PGK_DESPS       -----KSLRELELAGKRVLVRVDFNVPMDDKQITDDIRIRMVLPTLRYVLEQGGRLIICSHMGRPKGKRV
PGK_ACIBY       MNFQRMT--DLNLAGKRVLIREDLNVPVKNGVITSDARLRAALPTIKAALEKGAAVMVFSHLGRPEGEPK
PGK_ACIBS       MNFQRMT--DLNLAGKRVLIREDLNVPVKNGVITSDARLRAALPTIKAALEKGAAVMVFSHLGRPEGEPK
PGK_ACIB5       MNFQRMT--DLNLAGKRVLIREDLNVPVKNGVITSDARLRAALPTIKAALEKGAAVMVFSHLGRPEGEPK
PGK_ACIB3       MNFQRMT--DLNLAGKRVLIREDLNVPVKNGVITSDARLRAALPTIKAALEKGAAVMVFSHLGRPEGEPK
PGK_ZYMMO       -----RTLDDIDVKGKRVLVREDLNVPMDGDRVTDDTRLRAAIPTVNELAEKGAKVLILAHFGRPKGQPN
PGK_RHISN       -----KTLDDLDIAGKRVLVRVDLNVPVKDGQVTDTTRIERVAPTIRELSEKGAKIILLAHFGRPKGEPV
PGK_PASMU       ---------DLDLSGKRVFIRADLNVPVKDGKVTSDARIRATIPTLKLALEKGAKVMVTSHLGRPEGEFD
PGK_MYCSS       -----KTLEDLEIAGRGVLVRSDLNVPLDDGAITDPGRIIASVPTLEALAEAGAKVIVTAHLGRPKGGPD
PGK_MYCSK       -----KTLEDLEIAGRGVLVRSDLNVPLDDGAITDPGRIIASVPTLEALAEAGAKVIVTAHLGRPKGGPD
PGK_MYCSJ       -----KTLEDLEIAGRGVLVRSDLNVPLDDGAITDPGRIIASVPTLEALAEAGAKVIVTAHLGRPKGGPD
PGK_MYCGA       INYNXXXXXXXXXXXXXXIVRVDFNVPIKDNKVIDDTRIVQALDTIKYLIEQNCKIVLLSHLSRIKSLSS
PGK_TERTT       -----KLMKDLDLKGKRVLIRQDLNVPIKDGNITSDVRIQASLPTIKLAVEAGAKVLLMSHLGRPEGEYE
PGK_ACIBC       MNFQRMT--DLNLAGKRVLIREDLNVPVKNGVITSDARLRAALPTIKAALEKGAAVMVFSHLGRPEGEPK
PGK_SINMW       -----KTLDDLDIAGKRVLVRVDLNVPVKDGQVTDTTRIERVAPTIRELSEKGAKVVLLAHFGRPKGEPV
PGK_SHEDO       ---------DLDLTNKRVLIRQDLNVPVSDGMVTSDARLRASLPTIQLALDKGAAVMVMSHLGRPEGEFN
PGK_HALHL       -----KRMTDLDLTGKRVLIREDLNVPIKDGQVADDTRVRAAAESIRQAMQAGGRVLVMSHLGRPKGEYD
PGK_GRABC       ------------------------NVPMRDGRVSDLTRIERQAPTVRELAEGGARVIVMSHFDRPKGKRV
PGK_ACTSZ       ---------DLDLAGKRVFIRADLNVPVKDGKVASDARIRATIPTLKLALEKGAKVMVTSHLGRPEGEFK
PGK_NITEU       ---------DLDLKNKRVFIRADLNVPVKDGKVTSDARITASMATINHCLKQGAKVMVTSHLGRPEGVWT
PGK_MYCS2       -----KTLDDLLVQGRGVLVRSDLNVPLDDGNITDPGRVIASVPTLQALAEAGAKVIVTAHLGRPKGEPD
PGK_LEGPL       -------MSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIKSALDSGAAVIVLSHLGRPEGKYE
PGK_CHRVO       MKFNK--LSEQNLSGKRALIRVDMNVPLKNGVIGDDTRIRASLPTIEHCLKAGAAVLLMTHLGRPEGEPK
PGKG_TRYCO      ------------------------------------------------LPEDEKKQLLMQYLDEKKDNGL
PGK_RUTMC       ---------DLDLSSKRVLIRQDLNVSISNWIVTSDKRIKASLPTIKIALKQGAKVMLMSHRGRPEGEPS
PGK_FRAP2       -----------------------FNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLGRPEGEYD
PGK_ACIBT       MNFQRMT--DLNLAGKRVLIREDLNVPVKNGVITSDARLRAALPTIKAALEKGAAVMVFSHLGRPEGEPK
PGK_XANOR       ---------DLDLSGKRVLIRQDLNVPIDNGQITSEQRITASVPTIKLALEKGAAVMVTSHLGRPKGSWT
PGK_XANOM       ---------DLDLSGKRVLIRQDLNVPIDNGQITSEQRITASVPTIKLALEKGAAVMVTSHLGRPKGSWT
PGK_ENTS8       ---------DLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_ALHEH       ---------DLDLKGKRVLIREDLNVPLKEGKVADDTRIRASLPTIRHALESGARVMLLSHLGRPKGEPD
PGK_XANAC       ---------DLDLSGKRVLIRQDLNVPIDNGQITSEQRITASVPTIKLALEKGAAVMVTSHLGRPKGSWT
PGK_NITOC       -------MSELDLAGKRVLIREDLNVPLKNGEITDDTRIRASLPSIQQAMQAGAKVMVMSHLGRPEGEFD
PGK_NEIMF       MAFLKLTEQNVQ--GKTVLIRADMNVPFKDGKISDDTRIRASLASIQYCMDNGASVIVMTHLGRPEGEFH
PGK_MYCGE       ---NFKTLQAIDFQNKTVVLRSDFNVPMINGVISDSERILAGLDTIKFLVKKNCKIVLLSHLSRIKSKLN
PGK_AZOVD       ---------DLDLKGKRVLIREDLNVPVKDGVVKSDARILASLPTIKLALEKGAAVMVCSHLGRPEGEYS
PGK_XANOP       ---------DLDLSGKRVLIRQDLNVPIDNGQITSEQRITASVPTIKLALEKGAAVMVTSHLGRPKGSWT
PGK_XANC5       ---------DLDLSGKRVLIRQDLNVPIDNGQITSEQRITASVPTIKLALEKGAAVMVTSHLGRPKGSWT
PGK_ROSDO       -----KTLDDMDVAGKRVLLRVDINVPVEEGQVTDRTRIDRIIPTLQDILAKGGTPIMLAHFGRPKGKVV
PGK_NITEC       ---------DLDLKNKRVFIRSDLNVPVKEGKVTSDARITASMATINHCLKQGARVMVTSHLGRPEGVWA
PGK_MYCUA       ------------VSGRGVLVRSDLNVPLENGVITDAGRITASVPTLKALLDGGAKVVVAAHLGRPKDGPD
PGK_MYCMM       ------------VSGRGVLVRSDLNVPLENGVITDAGRITASVPTLKALLDGGAKVVVAAHLGRPKDGPD
PGK_CHLTR       ---DKLSIRDLSLEGKKVLVRVDFNVPIKDGKILDDVRIHSAMPTIHYLLKQDAAVILVSHVGRPKGGVF
PGK_ENT38       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_THIDA       -------VTDLDLAGKRVFIRADMNVPVKDGKVTSDARITASMRTIEHCMRAGAKVMVTSHLGRPEGEFK
PGK_SACEN       ------------VRGRRVLVRADLNVPLDGDRITDDGRVRASLPTIEKLTGAGARVVVTAHLGRPKGEPD
PGK_MYCH2       ---NKKFIDDIDFLNKTVILRVDFNVPIKNGEISSIKRIIASLKTIKKIVNNGGKLVILSHLGRIKSEDL
PGK_DROME       MAFNKLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIXXXXXXXXXXXXXXXXXXXMSHLGRPDGNKN
PGK_CHLTA       ---DKLSIRDLSLEGKKVLVRVDFNVPIKDGKILDDVRIRSAMPTIHYLLKQDAAVILVSHLGRPKGGVF
PGK_CHLTB       ---DKLSIRDLSLEGKKVLVRVDFNVPIKDGKILDDVRIRSAMPTIHYLLKQDAAVILVSHLGRPKGGVF
PGK_CHLT2       ---DKLSIRDLSLEGKKVLVRVDFNVPIKDGKILDDVRIRSAMPTIHYLLKQDAAVILVSHLGRPKGGVF
PGK_PSEMY       ---------DLDLAGKRVLIREDLNVPVKDGVVKSDARILASLPTIKLALEKGAAVLVCSHLGRPEGVYS
PGK_MYCGI       -----KSLDDLLVSGRGVLVRSDLNVPLDGGSITDPGRIIASVPTLKALSDAGAKVVVTAHLGRPKGEPD
PGK_VIBPA       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIIASLPTIKHCLEAGAKVMVTSHLGRPEGEYA
PGK_METRJ       -----RTLDDASLKGKRVLMRVDLNVPMESGRVTDATRIERVAPTIREVAEQGAKVILLAHFGRPKGKRE
PGK_VIBCH       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARILASLPTIKHCLEAGAKVMVTSHLGRPEGEYA
PGK_VIBC3       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARILASLPTIKHCLEAGAKVMVTSHLGRPEGEYA
PGK_DECAR       MNVIKLT--DLDVSGKRVFIRADLNVPQDEGNITEDTRIRASLPSIKYCLEKGAAVMVTSHLGRPEGELN
PGK_VIBHB       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIIASLPTIKHCLEAGAKVMVTSHLGRPEGEYA
PGK_AZOSB       -----KKLTDLDVRGKKVFIRADLNVPQDEGNITEDTRIRASIPSIQYCLDNGAAVMVTSHLGRPEGEVG
PGK_CELJU       -----KLMKDQDLAGKRVLIREDLNVPLDGGRITSTVRIDAAIPTLKAALEAGAKVAVMSHLGRPEGVYD
PGK_PSEA8       ---------DLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTLKLALEKGAAVMVCSHLGRPEGEFS
PGK_PHOLU       ---------DLDLAGKRVLIRADLNVPVKDGKVTSDARIRASLPTIEAALKQGAKVMITSHLGRPEGEYN
PGK_KLEP3       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
PGK_TOLAT       ---------DLDLAGKRVLVRADLNVPVKDGKVTSDARIVATLPTIKLALEKGAKLMITSHLGRPEGEYN
PGK_AZOC5       -----RTLDEADLAGKRVLVRVDLNVPMDEGRVTDDTRIQAILPTIRAITEKGGKAILLSHFGRPKGRDA
PGK_SHESH       -------MSELDLQGKRVLIREDLNVPVSDGVVTSDARLRAALPTIKLALEKGAAVMVMSHLGRPEGEFN
PGK_PSEAE       ---------DLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTLKLALEKGAAVMVCSHLGRPEGEFS
PGK_PSEAB       ---------DLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTLKLALEKGAAVMVCSHLGRPEGEFS
PGK_RHOSK       -----KTLDDMDLAGKVVLVRVDVNVPMENGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGRPKGKVV
PGK_RHOS1       -----KTLDDMDLAGKVVLVRVDVNVPMENGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGRPKGKVV
PGK_THERP       -----------------------YNVPLEGGRVVDDTRIRATLPTLQWLLERRARIILCSHLGRPKGQVR
PGK_SHEB5       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALANGAAVMVMSHLGRPEGEYN
PGK_MARAV       -----KKMTDLNLAGKRVLIREDLNVPVKDGKVSSDARIRASLPTIKAAKDAGAKVMLMSHLGRPEGVYD
PGK_RHOS4       -----KTLDDMDLAGKVVLVRVDVNVPMENGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGRPKGKVV
PGK_PSEA7       ---------DLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTIRLALEKGAAVMVCSHLGRPEGEFS
PGK_NOVAD       -----KTLDDIDLTGKTVLVREDLNVPMQDGAVTDDTRLRATIATLNELSDKGAKVLVLAHFGRPKGQPS
PGK_PSEFS       ---------DLDLQGKRVLIREDLNVPVKDGVVTSDARILASLPTIKLALEKGAAVMVCSHLGRPEGEFS
PGK_MYCLE       ---NLKDLLEEGVSGRCVLVRCDLNVPLDDGAITDLGRVTASVPTLKALLEAGAKIVVAAHLGRPKNGPD
PGK_MYCLB       ---NLKDLLEEGVSGRCVLVRCDLNVPLDDGAITDLGRVTASVPTLKALLEAGAKIVVAAHLGRPKNGPD
PGK_CHLPN       ---DKLTVQDLSPEEKKVLVRVDFNVPMQDGKILDDIRIRSAMPTINYLLKKHAAVILMSHLGRPKGQGQ
PGK_ACTPJ       ---------DLDLAGKRLFIRADLNVPVKDGKVTSDARIRATIPTLKLALQKGAKVMVTSHLGRPEGVFE
PGK_ACTP7       ---------DLDLAGKRLFIRADLNVPVKDGKVTSDARIRATIPTLKLALQKGAKVMVTSHLGRPEGVFE
PGK_ACTP2       ---------DLDLAGKRLFIRADLNVPVKDGKVTSDARIRATIPTLKLALQKGAKVMVTSHLGRPEGVFE
PGK_PSESM       ---------DLDLQGKRVLIREDLNVPIKDGVVSSDARILASLPTIRLALEKGAAVMVCSHLGRPEGEFS
PGK_JANMA       -----------ELQGKRVFIRADLNVPQDSGNITEDTRIRASVPAIQQALQAGAAVMVTSHLGRPEGEFK
PGK_SHEB9       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_SHEB2       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_SHEPC       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_COLP3       ---------DLTLANQRVLIREDLNVPVTDGKITSDARLRAALPTLKLALEAGAKVMVMSHLGRPEGQPE
PGK_ALISL       ---------DLELAGKRVFIRADLNVPVKDGKVTSDARILASLPTIKLCLEAGAKVMVTSHLGRPEGEYN
PGK_PSEHT       ---------DLDLNGKRVLIREDLNVPVKAGKVTSDARIRAALPTIKLALEKGAKVMVMSHLGRPEGEYD
PGK_AZOSE       ---NVKKLADLDVAGKRVFIRADLNVPQDEGNIVEDTRIRASLPSIRYCLERSATVMVTSHLGRPEGECR
PGK_SHESW       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_SHEB8       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_MYCVP       -----KSLDDLLVTGRGVLVRSDLNVPVDDGNISDPGRIIASVPTLKALSDAGAKVVVTAHLGRPKGEPD
PGK_PSEF5       ---------DLDLQGKRVLIREDLNVPVKDGVVTSDARILASLPTIKLALEKGAAVMVCSHLGRPEGEFS
PGK_BARBK       -----RTINEANVSGKRVLVRVDFNVPMSQGKVCDNTRLERHKETICALQKRGAKIILLSHCSRPRGKIV
PGK_SHESM       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_SHEON       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_SERP5       -------MSDLDLAGKRVLIRSDLNVPVKDGKVTSDARIRASLPTIEAALKQGARVMVTSHLGRPEGEYN
PGK_CHLCV       ---DRLTVRELSPEENKVLVRVDFNVPIKDGKILDDIRIRSAMPTINYLLQKRAAVILMSHLGRPKGTGF
PGK_BORPE       ------------LSGKRVFIRADLNVPFDDGRISEDTRIRASVPGIRLALDAGAAVMVTSHLGRPKEGAL
PGK_PSEA6       ---------DLDLAGKRVLIRQDLNVPVKGGKVTSDARIKASLGTLKHALEAGAKVMVMSHLGRPEGEYD
PGK_CHLFF       ---DRLTVRDLSPEEKKVLVRVDFNVPIKDGKILDDIRIRSAMPTINYLLQKRAAVILMSHLGRPRGSGF
PGK_VIBFM       ---------DLELAGKRVFIRADLNVPVKDGKVTSDARILASLPTIKLCLEAGAKVMVTSHLGRPEGEYN
PGK_SHESR       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_SHESA       -------MSDLDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIELALAKGAAVMVMSHLGRPEGEYN
PGK_AERS4       ---------DLDLAGKRVLIRADLNVPVKDGKVTSDARIVATLPTIKLALEKGAKLMITSHLGRPEGEYN
PGK_STRM5       ---------DLDLSGKRVLIRQDLNVPIENGRITSEQRITASLPTLKRALEQGAAVMVTSHLGRPKGVWS
PGK_VIBF1       ---------DLELAGKRVFIRADLNVPVKDGKVTSDARILASLPTIKLCLEAGAKVMVTSHLGRPEGEYN
PGK_PSE14       ---------DLDLQGKRVLIREDLNVPVKDGVVSSDARILASLPTIRLALEKGAAVMVCSHLGRPEGEFS
PGK_DIAST       -----------QARGQRVFIRADLNVPQDDGRITEDTRIRASVPCIQMALEAGAAVMVTSHLGRPEGEFK
PGK_BRUME       -----RTLDDANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFGRPKGVAS
PGK_BRUAB       -----RTLDDANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFGRPKGVAS
PGK_SPHWW       -----RTLDDIDVRGKRVLVREDLNVPMEGAAVTDDTRLRSAAPTVAELADKGAIVLVLAHFGRPKGERN
PGK_PSEU2       ---------DLDLQGKRVLIREDLNVPVKDGVVSSDARILASLPTIRLALEKGAAVMVCSHLGRPEGEFS
PGK_NEIMB       MAFLKLTEQNVQ--GKTVLIRADMNVPFKDGKISDDTRIRASLASIKYCVDNGASVIVMTHLGRPEGEFH
PGK_CHLAB       ---DRLTVRELSPEEKKVLVRVDFNVPIKDGKILDDIRIRSAMPTIHYLLQKRAAVILMSHLGRPQGKGF
PGK_NEIMA       MAFLKLTEQNVQ--GKTVLIRADMNVPFKDGKISDDTRIRASIASVKYCVDNGASVIVMTHLGRPEGEFH
PGK_DINSH       -----KTLDDMALDGKIVLTRVDINVPVADGVVTDTTRIERIVPTVTDILAKGGLPVLLAHFGRPKGKVV
PGK_PSEPW       ---------DLDLQGKRVLIREDLNVPVKDGVVTSDARILAALPTIKLALEKGAAVMVCSHLGRPEGEFS
PGK_VIBVY       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIIASLPTIKLCLEAGAKVMVTSHLGRPEGEYA
PGK_VIBVU       ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIIASLPTIKLCLEAGAKVMVTSHLGRPEGEYA
PGK_SHEPA       -------MKDLDLQGKRVLIREDLNVPVSDGVVTSDARLRASLPTIKLALEKGAAVMVMSHLGRPEGEFN
PGK_SHEFN       ---------DLDLQNKRVLIREDLNVPVSDGVVTSDARLRASLPTIQLALKKGAAVMVMSHLGRPEGEFN
PGK_OPISI       MGLRKLSIANVDLKDKRVLMRVDFNVPMKDGKVTNTQRIVGASPTIKYALDKGAKIVLMSHLGGRVGNKV
PGK_BRUSU       -----RTLDDANVQSKRVLVRIDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFGRPKGVAS
PGK_RALSO       -------ISEGKLAGKRVFIRADLNVPQDDGNITEDTRIRASVPAIRAALDAGAAVMVTSHLGRPEGEFK
PGK_TROW8       -----------------VFVRVDFNVPMDEGTITDDLRIRASLPTIESLLGRGAPLILISHLGRPVKNEQ
PGK_TROWT       -----------------VFVRVDFNVPMDEGTITDDLRIRASLPTIESLLGRGAPLILISHLGRPVKNEQ
PGK_DESDA       -------MQDLDLGGKTVVIREDLNVPMKDGIITNDKRIRAALPTIQLALEKGAGVIVLSHLGRPEGQYD
PGK_SHEHH       -------MQDLELQGKRVLIREDLNVPVKDGVVTSDARLRASLPTIKLALEKGAAVMVMSHLGRPEGEFN
PGK_HAHCH       ---------DLDLRGKRVLIREDLNVPVKNGKVTSDARIQAALPTIKLAMEQGAKVMVMSHLGRPEGQFS
PGK_FRAAA       -----RTIDDLQVAGHRVLVRSDLNVPLDRSGITDDGRVRASVPTIAALLDRGARVIVTSHLGRPKGEPD
PGKA_TRYBB      ------------------------------------------------LPEDEKKSLLMQYLNENKDSAL
PGK_MARMS       -------MKDVDLANKRVLIREDLNVPVKDGKVTSDARIRAALPTIKMALEAGAKVMVMSHLGRPEGQYE
PGK_WOLTR       ---NIPNIENCDLHGKAVLLRVDFNIPIKNGKVHDATRVLRSLPTIRHLVNAGAKVIIISHFGRPRAKDN
PGKD_TRYBB      ------------------------------------------------LPEDEKKSLLMQYLNENKDSAL
PGK_MYCA9       ------------VSGKGVLVRSDLNVPLEDGNISDPGRIVASVPTIRALAGAGAKVIVTAHLGRPDGKPD
PGK_HELPY       ---NVKNIQEVEVSHKRVLIRVDFNVPLDENLITDDTRIRESLPTIQYCIDNKAKIILVSHLGRPKG-VE
PGK_PSYCK       MNFLR--MSELSLTDKVVLIREDLNVPIKAGKVASDARLQASLPTIKMALEKGAAVIVCSHLGRPT-EGN
PGK_DESVV       ---------DLDLKGKRVLLREDLNVPLKEGRITSDKRIRAALPSIRMAMEAGGRVLIVSHLGRPEGEFD
PGK_CONMG       ----------------------DFNVPIKDGRITDSNRIQATLPSIQAVLDNGAKLVLMSHLGRPDGRRD
PGK_ACISJ       -----------QARGQRVFIRADLNVPQDDGRITEDTRIRASVPCIQMALEAGAAVMVTSHLGRPEGEFK
PGK_PSEPK       ---------DLDLQGKRVLIREDLNVPVKDGVVASDARILAALPTIKLALEKGAAVMVCSHLGRPEGEFS
PGK_PSEPG       ---------DLDLQGKRVLIREDLNVPVKDGVVASDARILAALPTIKLALEKGAAVMVCSHLGRPEGEFS
PGK_PSEP1       ---------DLDLQGKRVLIREDLNVPVKDGVVASDARILAALPTIKLALEKGAAVMVCSHLGRPEGEFS
PGK_MICLC       ------------VTGRTVLIRSDLNVPLDGDTVTDDGRIRASLPAIRDLAEAGARVIVMAHLGRPKGEPD
PGK_BLOPB       -------ITDLDLTGKRVLIRSDLNVPVKNGVITSNRKIHASLPTIKLALKKSKHVMVTSHLGRPEGEYN
PGK_NEIM0       MAFLKLTEQNVQ--GKTVLIRADMNVPFKDGKISDDTRIRASLASVKYCLDNGASVIVMTHLGRPEGEFH
PGK_BAUCH       -------ITDLNLKNKRVLIRADLNVPIKDGQITSYARINASLPTIITVLKQGASVMVTSHLGRPEGQYD
PGK_PSEPF       -------MSDLDLQGKRVLIREDLNVPVKDGVVTSDARILASLPTIKLALEKGAAVMVCSHLGRPEGEFS
PGK_DESVH       ---------DLDLKGKRVLLREDLNVPLKEGRITSDKRIRAALPSIRMAMEAGARVLIVSHLGRPEGEFD
PGKP_RALEH      ---------------KRVFIRADLNVPQDAGDITDDTRIRASVPAIAACLQAGAAVMVTSHLGRPQGAPD
PGK_HERAR       -----------ELKGKRVFIRADLNVPQDGGNITEDTRIRASVPAIRQALQAGAAVMVTSHLGRPEGEFK
PGK_AERHH       ---------DLDLAGKRVLIRADLNVPVKDGKVTSDARIVATLPTIKLALEKGAKLMITSHLGRPEGEYN
PGK_HELPJ       ---NVKNIQEVDVNHKRVLIRVDFNVPLDENLITDDTRIRESLPTIQFCIDNKAKIILVSHLGRPKG-VE
PGKC_RALEH      ---------------KRVFIRADLNVPQDAGAITDDTRIRASVPAIAACLQAGAAVMVTSHLGRPQGAPD
PGK_LEPCP       -----------QVAGQRVFIRADLNVPQDDGHITEDTRIRASIPCIEMALKAGAAVMVTSHLGRPEGEFK
PGK_CAUSK       -----RTLDTADLAGKRALVRVDFNVPVDGGKITDDTRLRAALPTIRYLSSKGAKVVLLAHFDRPKGKVV
PGK_METFK       ---------DLDLAGKRVFIRADLNVPVSDGKVTSDARITASIPTIRHALDAKARVMVTSHLGRPEGVYS
PGK_SILPO       -----KTLDDMDLTGKRVLVRVDINVPIVDGVVTDSTRIRRLMPTIRDILAAGGRPILLAHFGRPGGERR
PGK_SHEPW       -------MQDLELQGKRVLIREDLNVPVSDGVVTSDARLRASLPTIKLALEKGAAVMVMSHLGRPEGEFN
PGK_NEIG2       -------LTEQNVRGKTVLIRADMNVPFKGGKISDDTRIRASLASVKYCLDNGASVIVMTHLGRPEGEFH
PGK_NEIG1       -------LTEQNVRGKTVLIRADMNVPFKGGKISDDTRIRASLASVKYCLDNGASVIVMTHLGRPEGEFH
PGK_WOLPP       ---NVPSIESCDFHNKNVLLRVDFNVPIKNGRICDATRILRALPTIQYLANAGAKVIVISHFGRPKAKDS
PGK_SHELP       ----------LDLQGKRVLIREDLNVPVSNGVVTSDARLRASLPTIKLALEKGAAVMVMSHLGRPEGEYN
PGK_CAUCR       -----RTLDTADLAGKRALVRVDFNVPVDGGKVADDTRLKAALPTIRFLADKGAKVVLLAHFDRPKGKVV
PGK_CAUCN       -----RTLDTADLAGKRALVRVDFNVPVDGGKVADDTRLKAALPTIRFLADKGAKVVLLAHFDRPKGKVV
PGK_ACIAC       -----------QARGQRVFIRADLNVPQDDGRITEDTRIRASVPCIRMALDAGAAVMVTSHLGRPEGTLT
PGK_JANSC       MRFN--TLDDMDLAGKLVLTRVDINVPVDGDTVTDATRITRIVPTIKDILAKGGRPVMLAHFGRPKGAYV
PGK_HAEDU       -----KKMADLDLTGKRLFIRADLNVPVKEGKITSDARIRATIPTLKLALQKGAKVMVTSHLGRPEGVFE
PGK_FRASN       -----RTIDDLQVTGHRVLVRSDLNVPLDHSKITDDGRVRASVPTIQALLDRNAKVIVCSHLGRPKGAPE
PGK_KINRD       -----KTLDDLETQGRRVLVRSDLNVPLRDGVITDDGRLRASVPTLRRLLDAGARVVVTAHLGRPKGAPE
PGK_BORPA       ------------LSGKRVFIRADLNVPFDDGRISEDTRIRASVPGIRLALDAGEAVMVTSHLGRPKEGAL
PGK_BORBR       ------------LSGKRVFIRADLNVPFDDGRISEDTRIRASVPGIRLALDAGAAVMVTSHLGRPKEGAL
PGK_XYLFA       ---------DLALSGKRVLIRQDLNVPIDQGRITSEQRIIASLPTIRVALERGAAVMVTSHLGRPKGVWS
PGK_RHOFD       -----------QVSGKRVFIRADLNVPQDDGHITEDTRIRASIPCIQMALDAGAAVMVTSHLGRPEGAFK
PGK_STRMK       ---------DLDLSGKRVLIRQDLNVPIENGRITSEQRITASLPTLKRALEQGAAVMVTSHLGRPKGVWS
PGK_XYLFT       ---------DLALSGKRVLIRQDLNVPIDQGRITSEQRIIASLPTIRVALERGAAVMVTSHLGRPKGVWS
PGK_TETPY       ----------------------DFNVPLKDGQVKDPTRIQGSIPSIKKILEQNPKLVLMSHLGRPDGNRV
PGK_GLACH       ----------------------DFNVPLKEGVVKDPTRIAGSIPSIKKILETNPRLVLMSHLGRPDGQRV
PGK_HAES2       ---------DLDLAGKRVFIRADLNVPVKEGKVTSDARIKATIPTLKLALEKGAKVMVTSHLGRPEGEFK
PGK_DESVM       ---------DLDLKGKRVLLREDLNVPLKDGKVTSDKRIRAALPSIEMALKAGARVLLVSHLGRPEGEFD
PGK_PARPR       ----------------------DFNVPIKEGKVKNTTRIQGAIPTLKKILEQNPKVTLMSHMGRPDGKRV
PGK_MYCTU       ---NLKDLLAEGVSGRGVLVRSDLNVPLEDGTITDAGRIIASAPTXXXXXXXXXXXXXXXHLGRPKDGPD
PGK_MYCTA       ---NLKDLLAEGVSGRGVLVRSDLNVPLEDGTITDAGRIIASAPTXXXXXXXXXXXXXXXHLGRPKDGPD
PGK_MYCBT       ---NLKDLLAEGVSGRGVLVRSDLNVPLEDGTITDAGRIIASAPTXXXXXXXXXXXXXXXHLGRPKDGPD
PGK_MYCBP       ---NLKDLLAEGVSGRGVLVRSDLNVPLEDGTITDAGRIIASAPTXXXXXXXXXXXXXXXHLGRPKDGPD
PGK_MYCBO       ---NLKDLLAEGVSGRGVLVRSDLNVPLEDGTITDAGRIIASAPTXXXXXXXXXXXXXXXHLGRPKDGPD
PGK_WOLPM       ---NIPSIENCDLHNKTVLLRVDFNVPIKDGEIRDVTRILRALPTIQYLVNASAKIIIISHFGRPKARDN
PGK_WOLWR       ---NIPSIENCDLHNKAVLLRVDFNVPIKDGEIRDVTRILRALPTIQYLVNASAKIIIISHFGRPKARDN
PGK_METJA       ------TLDDFNFEDKRVVLRVDINCPINTGEILDDKRIREIKSTITELINKGAKVVILAHQSRP---GK
PGK_BUCAT       -----RKMTELNITEKRILIRSDLNVPIENGIIQSDARILAALPTIELALQKKAKVIIMSHLGRPKGYYT
PGK_BUCAI       -----RKMTELNITEKRILIRSDLNVPIENGIIQSDARILAALPTIELALQKKAKVIIMSHLGRPKGYYT
PGK_BUCA5       -----RKMTELNITEKRILIRSDLNVPIENGIIQSDARILAALPTIELALQKKAKVIIMSHLGRPKGYYT
PGKA_CRIFA      ----------------------------------------------------------------------
PGK_PSYWF       MNFAR--MENQDLSGKTVLIREDLNVPVQNGKISNDARLQSSLPTIKLALEKGAAVLVCSHLGRPEGDYE
PGK_BLOFL       -------MSDVDLFNKRILIRADLNVPIRNGIITSARRIHASLPTIQLALSRSNQVMVTSHLGRPEGEYD
PGK_BUCAP       MNLRKMT--ELNITGKKILIRTDLNVPIKNGVIQSDARILAALPTXXXXXXXXXXXXXLSHLGRPKGCYT
PGK_SPHAL       -----KTLDDIDVTGKRVLVRVDLNVPMIDGAVSDATRIQAAMPTIRELSDKGAIVLLLAHFGRPKGAKN
PGK_MYCPA       ---NLKDLLAEGVSGRGVLVRSDLNVPLEQGRITDPGRITASVPTLSALVEAGAKVVVAAHLGRPKNGXX
PGK_MYCA1       ---NLKDLLAEGVSGRGVLVRSDLNVPLEQGRITDPGRITASVPTLSALVEAGAKVVVAAHLGRPKNGXX
PGK_METMP       ------TLDDFELEGKTVALRVDINSPINTGDILDDTRIKACSDTIKSLSEKGAKVVILAHQSRP---GK
PGK_SHEWM       -------MSELDLQGKRVLIREDLNVPVSEGVVTSDARLRAALPSIKLALEKGAAVMVMSHLGRPEGEFN
PGK_BUCBP       -------ITDLNLLNKKVLIRSDLNVPIKNNKISSYARIHASLPTIKFALKNLAKVIVTSHLGRPEGIYK
PGK_ORITI       ------------------------NIPQEGGKITDNTRIVRTIPTIKYLILHGAKVVIISHLGNPKGRIE
PGK_ORITB       ------------------------NIPQEGGKITDNTRIVRTIPTIKYLILHGAKVVIISHLGNPKGRIE
PGK_METMA       ---NFLTIDDFDIRGKTILLRVDMNSPMDQGHILDDMRIRSHIATLKDL--ESAKVVVLAHQSRP---GK
PGK_PYRAB       ---------DFNYHNKVVFLRVDLNSPMKDGKIISDARFRAVLPTIKYLLENGARVVVGTHQGKPYSEDY
PGK_THESM       -------LSDFNYHDKVIFLRADLNSPVKDGKIISDARFRAVLHTIRYLLEHKAKVVIGTHQSKPYEE--
PGK_THEON       -------LTDFTYHGKTVFLRADLNSPVKDGRIISDARFRAVLPTIQHLLDEGAKLVIGTHQSKPKGDY-
PGK_UREPA       -SLNKKSIKDLDVNGKTIVLHLDLNVVVENKRILNDRKLRASLPTINYLINHNAKIVILSHLGRIKTLAD
PGK2_METAC      ---NFLTIDDFDIRGKTILLRVDMNSPMDQGHILDDMRIKSHIATLKDL--ESAKVVLLAHQSRP---GK
PGK1_METAC      ------TMDDVELDNKRILLRVDFNSPMDNGNILDDRKIKSHLYTLRSL--ENSRVVMMSHQGRPGD--K
PGK_PYRHO       -------LEDFNFHNKTVFLRVDLNSPMKDGKIISDARFKAVLPTIRYLIESGAKVVIGTHQGKPYSEDY
PGK_METFE       --FKFYTMDDFDYSGSRVLVRVDINSPVDPGRILDDTRMRLHSKTLKELVDENAKVAILAHQSRP---GK
PGK_PYRWO       -------LRDFEYYNRTVFLRVDLNSPMSNGKIISDARFRAVLPTIKYLIESGAKVVVGTHQGKPYSE--
PGK_PYRFU       -------LRDFEYYNRTVFLRVDLNSPMSNGKIISDARFRAVLPTIKYLIESGAKVVVGTHQGKPYSE--
PGK_ARCFU       ------TLDDIPYRGKHVLLRVDINAPIVNSTILDTSRFESHIPTIEALEDS--KLVLLAHQSRP---GK
PGK_AERPE       ------TLDDVDVRGKKVIVRFDLNSPVGNGEILDDSRIAEAAGTLRELCDRGAAVVALSHQGRP---LE
PGK_WIGBR       -------VTDLNLKDKKVLIRSDLNVPIKNGKIMCNMRIIKSLETINFVIKNEAKVIVASHLGNPIEEKY
PGK_SULSO       ------TMDDIDIQSKKVLLRIDINSPVENGKIIDDSRIKAHIGTIKELINKGNSVVLISHQGRPGD--K
PGK_PYRKO       -------ITDFTYEGKTVFLRADLNSPVEKGRITSDARFRAVLPTIQHLLDNGAKLVIATHQSRPKGDY-
PGK_METLZ       MNFG--TLADIETRGKTVLVRVDFNSPISSNTILDDKRFREHIPTLQALED--ARVVVLAHQSRP---GK
PGK_NATPD       -----RTLDDLEADGTALGVRIDINSPLSSDGLADDARLRAHVDTVEELCRRDARVALLAHQGRPGGD--
PGK_THEAC       --------------GKTVYLRVDINAPVNPGEIMGIDRFRAHIDTIRNL--RNSKVVIVAHQSRP---GK
PGK_THEVO       -------MDSFDLAGRTIYLRVDINSPVNPGEIMGTDRFRAHVETIRKLRDS--KVVIVAHQSRP---GK
PGK_HALLT       ------TIDDLPADSR-VLVRLDLNSPIEDGKPQDNRRFERHAETVRELADAGHRVVLMAHQGRP---GR
PGK_HALMA       -----QTLDDLD-DGQRVLVRLDLNSPVEDGTVQDNRRFDRHAETVSELVDRGFEVAVLAHQGRP---GR
PGK_METTH       VSFKFKTMDDIEVTGKTVLVRVDINSPVNDGTILDDTRMRLHAETIRELSDRGARTVVMAHQSRP---GK
PGK_SULTO       -DLNIPVIEDFDINGRKVLLRIDINSPVKTGKLLDDSRIKAHAETIRELLDKQNSVVIISHQGRPGDD--
PGK_METKA       ---NISTMDDFEFENKWVLLRIDINSTVIDGKIEDDERIKRHLGTIKELMEHDARVAILAHQGRP---GE
PGK_PICTO       MNGSFFTMDDFDLDGKRIYLRIDINSPVETGEILDDSRFRAYSKTINEL--KSSKVVIVSHQSRP---GK
PGK_HALVA       -----QTLDDLD-DGQRVLVRLDLNSPVEDGTVQDNRRFDRHAETVKELADRGFEVAVLAHQGRP---GR
PGK_METS5       ---NIPTLDDLNFSNSKVLVRIDINSPVKTGKLLDDSRIKAHVETIRELVSRGNGVVLVSHQGRPGDNDF
PGK_PYRAE       -------------KGKTLIIRIDINSPIVNGKIIDDFRIRAHSYTLRLASDAGARAVVLAHQGRP---GQ
PGK_METBR       ------TIDDFNLEDKTVLVRVDINSPVSTGSILDDTKIKLHAETIDEISKKGAKTVVLAHQSRP---GK
PGK_SULAC       ------TINDLELQNKKVLLRIDVNSPVNTGKLLDDSRIKAHSITIKELLKKGNSIVLISHQGRPGDD--
PGK_HALSA       -----RTLDDLAAANRAIGVRVDINSPLTAGGLADDARLRAHVDTXXXXXXXXXXXXXXXHQGRPGGD--
PGK_HALS3       -----RTLDDLAAANRAIGVRVDINSPLTAGGLADDARLRAHVDTXXXXXXXXXXXXXXXHQGRPGGD--
PGK_MYCAV       ----------------------------------------------------------------------
NAGZ_METFK      ------------------------------------------MQTFRQLIDDGIQAIMPAHVIYPKVDNK


                         .         .         *         .         .         .         .:140
query           PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGXXXXXXXXX
PGK_CLOPE       PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGXXXXXXXXX
PGK_CLOP1       PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGXXXXXXXXX
PGK_CLOPS       PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGXXXXXXXXX
PGK_CLOBA       PELSLAPVAKRLSELLGKEIKFAPDNTVVGENAKAAVAEMKDGDVVLLENTRYRKEETKNGEEFSKELAS
PGK_CLOBB       PELSLAPVAKRLSELLGKEIKFAPDNTVVGENAKAAVAEMKDGDVVLLENTRYRKEETKNGEEFSKELAS
PGK_CLOBH       KELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQNTRYRKEETKNEEVFSKELAS
PGK_CLOB1       KELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQNTRYRKEETKNEEVFSKELAS
PGK_CLOBL       KELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQNTRYRKEETKNEEVFSKELAS
PGK_CLOB6       KELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQNTRYRKEETKNEEVFSKELAS
PGK_CLOBK       KELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKRAVEDMKDGDVVLLQNTRYRKEETKNEEVFSKELAS
PGK_CLOBJ       KELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQNTRYRKEETKNEEVFSKELAS
PGK_CLOBM       KELSLLPVAKRLSEMLNKEVVFADDDNVVGENAKKAVEDMKDGDIVLLQNTRYRKEETKNEEIFSKELAS
PGK_CLOTE       QELSLAPVAKRLSELLNKEVLFPADNEVVGENAKKAVENMKDGDVILLQNTRYRKEETKNEETFSKELAS
PGK_CLOAB       PSKTLAPVAKRLSELLGREVKFAADDTVVGENAKKAVAELKEGEIVLLENTRFRPEEGKNDDAFSKDLAS
PGK_CLONN       PELSLAPVAKRLSELLEKEVVFAADDTVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNEENFSKELAS
PGK_CLOB8       ---SLAPVATRLSEMLGKEVVFARDEEVVGENAKKAVSEMKDGDIVLLENTRCRKEETKNIPEFSKELAS
PGK_CLOK5       PEMSLLPVAKRLSELLKKEVVFAADDNVVGENAKAAVKNMKDGDVILLQNTRYRIEETKNQDNFSKELAS
PGK_CLOK1       PEMSLLPVAKRLSELLKKEVVFAADDNVVGENAKAAVKNMKDGDVILLQNTRYRIEETKNQDNFSKELAS
PGK_CLOD6       PELSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKATEKMENGDVVLLENTRYRKEETKNEENFSKELAS
PGK_THETN       PDYSLKPVAKRLSELLKKPVIMAED--VIGEDAKVKAAALKEGEVLLLENVRFHAEEEKNDPEFAKELAS
PGK_EXIS2       PEFSLAPVVARLSELLGKDIKLV--EEAYGPVAEEAVSKLEEGDVIVLENVRFYPGETKNDPELAEGFAK
PGK_SYMTH       EKYSLAPCARRLSELLGREVVFAPD--CIGEEVERLVAEQPPGSVVLLENVRFYAEEEKNDPEFAAKLAR
PGK_BACSU       EELRLTPVAARLGELLGKEVKKA--DEAYGDAVKAQISEMKDGDVLVLENVRFYPGEEKNDPELAKAFAE
PGK_FINM2       PEFSLKPVAQKLSEMIGQXXXXXXXXXXXXXXXXEESKKLQPKEIMLIQNTRFRKEEEKNDQTFSKELSQ
PGK_BACCN       EEMRLTPVAVRLGELLGKDVKKA--DEAFGPAVQEMVAAMNEGDILVLENVRFYAGEEKNDAELAKEFAA
PGK_BACP2       EELRLTPVAKRLQELLGQEVKKA--DEAYGDNVKKQISDLKDGDVLVLENVRFYPGEEKNDPELSKAFAD
PGK_LACSS       KELTLKPVAARLGELLNKDVAFVASNE--GQELEDAINAMTDGQVLVMENTRFQKRESKNDPKLGEYWAS
PGK_BACHK       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_OCEIH       EELRLDPVADRLSDLLGKEVL--KTDQVYGEEVDQAISELENGGVLLIENVRFEAGEEKNDPELVEAFAN
PGK_BACLD       EELRLTPVAARLGELIGKEVKKA--DEAYGDAVKAQISEMKDGDILVLENVRFYPGEEKNDPELSKAFAD
PGK_ANOFW       EEMRLNAVAERLSELLGKRVV--KTDEAYGDTVKAAIAEMNEGDVLLLENVRFYPGEEKNDPELAKAFAE
PGK_BACC3       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACC0       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACAH       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACAN       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACAC       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACAA       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACC7       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACC2       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACCQ       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACME       EELRLNAVAERLQALLGKDVAKA--DEAFGEEVKKTIDGMSEGDVLVLENVRFYPGEEKNDPELAKAFAE
PGK_BACCZ       EEMRLTPVAARLGELLGKDVKKA--DEAFGPAVQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_CHLT3       AEMSLKPAADRLAELLGKPVQMAPD--CIGDEVKNMAAAMKAGDVLMLENLRFHKEEEANDPEFAKSLAS
PGK_BACC4       EEMRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACWK       EELRLTPVAARLGELLGKDVKKA--DEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_BACC1       EEMRLTPVAARLGELLGKDVKKA--DEAFGPAVQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAA
PGK_THEM4       PEFSLKPVSERLSELLGKQVTFVPE--LYGEEVKMAIDNAKPGDVILLENTRFDKGETKNDPELAKKWAD
PGK_GEOKA       EELRLDAVAKRLGELLERPV--AKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPGEEKNDPELAKAFAE
PGK_MOOTA       EELRLDPVARELESLLGRQVHKVND--CVGPEVEAAAAALKPGEVLLLENLRFHPEEEKNDPGFARQLAS
PGK_GEOSW       EELRLNAVARRLSELLGKHVT--KTDEAYGDAVKEAISKMNEGDVLLLENVRFYPGEEKNDPELAKAFAE
PGK_BACST       EELRLDAVAKRLGELLERPV--AKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPGEEKNDPELAKAFAE
PGK_LACAC       KELSLKPVAERLSELLDKPVTFVPSNE--GKEVEEAIDNMKDGDVVVLENTRFQKRESGNDPKLGEYWAS
PGK_LACH4       KELSLKPVAERLSELLKKPVTFVPSNE--GKEVEDAINNMKDGDVVVLENTRFQKRESGNDPKLGEYWAS
PGK_DICT6       DDLRLDPVAKRLSELLGKPVKKLND--CIGEEVEKEISNMKEGDVVLLENIRFYKEEEANDPEFAKKLAK
PGK_ELUMP       SEFSLAPVATEVANVFGVKVHFASD--CIGEPAAKTIAEAKNGEIVLLENLRFHPEEEKNDETFAAQLAK
PGK_MACCJ       ANLSLQPVANRLSELLDKEVQFVAETR--GEKLESAINALQPGDVLLFENTRFEKKESKNDAELGKYWAS
PGK_EXISA       PEFSLAPVAKRLAELLGKDVPLV--EEAYGPVAEEAVANLSEGDVVVLENVRFYPGETKNDPELAKGFAA
PGKH_VOLCA      DKYRLTPVVARLSELLGKEVKKV--DDCIGPSVEQAVASLKSGELLLLENVRFYKEEEKNDPEFAKKLAS
PGK_DICTD       DDLRLDPVAKRLSELLGKPVKKLND--CIGEEVEREISNMKEGDVILLENIRFYKEEEANDPEFAKKLAS
PGK_BREBN       EEMRLTPVAAHLSSLLGKDVRKLEDCQ--GADVEAAVERMESGDVILLENVRFHAGEEKNDPELAKSFAA
PGK_LACRJ       PGLSLRPVAERLSNLLNKPVTFVPVTE--GKQLEDAIDNMKNGDVLLVQNTRYEKRESGNDPELGKYWAS
PGKH_SPIOL      PKFSLAPLVPRLSELLGLQVVKA--DDCIGPDVEKLVAELPEGGVLLLENVRFYKEEEKNDPEFAKKLAS
PGK_STACT       EKLTLRPVAERLSEKLGKDVNFIPHTR--GEVLEKAIAELKDGEVLLVENTRFEKKESKNDPELGKYWAS
PGK_LACS1       KELSLRPVAERLAELLNKPVTFVPATR--GAQLEDAINNMNDGDVLLVENTRFEKKESGNDPELGKYWAS
PGK_THEAB       PEFSLLPVAKRLSELLGKEVTFIPE--LYGEIVNEKVKNAKEGDVILLENTRFDKGETKNDPELAKKWAE
PGKY_TOBAC      PKYSLKPLVPRLSELLGVEVKIANDS--IGPEVEKLVAEIPEGGVLLLENVRFYKEEEKNEPEFAKKLAS
PGK_PEDPA       KELTLRPVAQRLSDLLGKPVTFVPVTR--GAQLEDAVNGMNDGDVLLFENTRFEKKESKNDPELGKYWAS
PGK_ACIBL       PKMSLKPVAERLRVMLGQNVGFSPD--CIGMQAQEMAKQLEKGQALLLENVRFHAEEEKNDPAFAKELAS
PGK_LACDL       KSLSLAPVAKRLGELLEKPVTFVPSNE--GKEVEDAINNMKDGDVVVLENTRFQKRESKNDPKLGEYWAS
PGK_GLOVI       DQLRLTPVAKRLGELLG-QTVYKADD-VIGPEVEEAVKKLEDGDVLLLENVRFYPEEEKNNPEFAQKLAG
PGK_CHLAD       PKYSLRPVVERLFELLPEATEVKKTEAITGPAAEAAVSMLKPGQVLVLENTRFDPREEANDPQMAAELAK
PGK_BACHD       EELRLDPVAARLQELLGKPV---AKVNVAGPEAEQAANELKDGDVLLLENVRFYPGEEKNDPELAKAFAS
PGK_LACCB       AKLTLKPVAERLSELLKKPVTFVPATR--GKELEDAINKMNDGDVLVMENTRFEKKESGNDPELGKYWAS
PGK_LACC3       AKLTLKPVAERLSELLKKPVTFVPATR--GKELEDAINKMNDGDVLVMENTRFEKKESGNDPELGKYWAS
PGKH_TOBAC      PKYSLAPLVPRLSELLGIQVVKVED--CIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLAS
PGK_ANADF       EKFSLEPAAQRLSELLKQDVILA--DDCIGDGVKKLVRDLKEGQVLLLENLRFHPQEEKNDEGFARELAT
PGK_LACJO       KELSLRPVAERLSELLEKPVTFVPENE--GKEVEEAIDNMKDGDVVVLENTRFQKRESKNDPKLGEYWAS
PGK_LACGA       KELSLRPVAERLSELLKKPVTFVPENE--GKEVEETIDKMKDGDVIVLENTRFQKRESKNDPKLGEYWAS
PGK_THELT       PKYSLKPIAEHLKNISGLNVIFVP--HVVGEEVKEAVKNMKVGDVLLLENTRFHPGEEKNDQELAKAWAE
PGK_LACBA       PGLSMRPVAERLSNLLNKPVTFVPTTE--GKQLEDAIDGLNDGDVLVMENTRYEKRESGNDPELGKYWAS
PGK_ANADE       TKLTLEPAAVRLSELLSQDVILA--DDCVGDGVKKLVRDLKDGHVLLLENLRFHPEEEKNDEAFARELAS
PGK_BORT9       LKYSLMPVAKRLSELLGQDVKMLPD--CIGDEVATTVSCMKNGDIVLL