[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81021.1

[Show Plain Result]


## Summary of Sequence Search
    1::301
    1::301     e-171 100%  301 aa  DDLA_CLOPE RecName: Full=D-alanine--D-alanine ligase A;       
    1::301     e-168  98%  301 aa  DDL_CLOPS RecName: Full=D-alanine--D-alanine ligase;       
    1::301     e-120  67%  301 aa  DDL_CLOBA RecName: Full=D-alanine--D-alanine ligase;       
    1::300     e-115  66%  300 aa  DDL_CLOBJ RecName: Full=D-alanine--D-alanine ligase;       
    1::300     e-115  66%  300 aa  DDL_CLOBH RecName: Full=D-alanine--D-alanine ligase;       
    1::300     e-115  66%  300 aa  DDL_CLOB1 RecName: Full=D-alanine--D-alanine ligase;       
    1::300     e-115  66%  300 aa  DDL_CLOBK RecName: Full=D-alanine--D-alanine ligase;       
    1::300     e-115  65%  300 aa  DDL_CLOBL RecName: Full=D-alanine--D-alanine ligase;       
    1::300     e-114  64%  300 aa  DDL_CLOBM RecName: Full=D-alanine--D-alanine ligase;       
    1::301     e-113  65%  301 aa  DDL_CLOBB RecName: Full=D-alanine--D-alanine ligase;       
    1::301     e-113  64%  301 aa  DDL_CLOB8 RecName: Full=D-alanine--D-alanine ligase;       
    1::297     e-109  60%  297 aa  DDL_CLOK5 RecName: Full=D-alanine--D-alanine ligase;       
    1::297     e-109  60%  297 aa  DDL_CLOK1 RecName: Full=D-alanine--D-alanine ligase;       
    1::300     e-105  61%  300 aa  DDL_CLOB6 RecName: Full=D-alanine--D-alanine ligase;       
    1::297     3e-99  57%  302 aa  DDLB_CLOPE RecName: Full=D-alanine--D-alanine ligase B;       
    1::301     6e-96  53%  304 aa  DDL_BACAN RecName: Full=D-alanine--D-alanine ligase;       
    1::301     6e-96  53%  304 aa  DDL_BACAC RecName: Full=D-alanine--D-alanine ligase;       
    1::301     6e-96  53%  304 aa  DDL_BACAA RecName: Full=D-alanine--D-alanine ligase;       
    1::297     1e-92  52%  301 aa  DDLA_CLOTE RecName: Full=D-alanine--D-alanine ligase A;       
    2::298     6e-92  53%  301 aa  DDLA_BACCR RecName: Full=D-alanine--D-alanine ligase A;       
    3::311     5e-58  39%  312 aa  DDL_DESRM RecName: Full=D-alanine--D-alanine ligase;       
    8::306     1e-57  41%  307 aa  DDL_MANSM RecName: Full=D-alanine--D-alanine ligase;       
    9::307     5e-57  41%  309 aa  DDL_PASMU RecName: Full=D-alanine--D-alanine ligase;       
    7::306     7e-57  41%  306 aa  DDL_HAEI8 RecName: Full=D-alanine--D-alanine ligase;       
    7::302     9e-57  40%  303 aa  DDL_ACTPJ RecName: Full=D-alanine--D-alanine ligase;       
    7::302     9e-57  40%  303 aa  DDL_ACTP7 RecName: Full=D-alanine--D-alanine ligase;       
    7::302     9e-57  40%  303 aa  DDL_ACTP2 RecName: Full=D-alanine--D-alanine ligase;       
    7::306     1e-56  41%  306 aa  DDL_HAEIG RecName: Full=D-alanine--D-alanine ligase;       
    7::306     2e-56  41%  306 aa  DDL_HAEIN RecName: Full=D-alanine--D-alanine ligase;       
    1::296     3e-56  43%  296 aa  DDL_THELT RecName: Full=D-alanine--D-alanine ligase;       
   10::298     6e-56  38%  305 aa  DDL_PELCD RecName: Full=D-alanine--D-alanine ligase;       
   10::305     7e-56  42%  305 aa  DDL_GEOSM RecName: Full=D-alanine--D-alanine ligase;       
   10::312     2e-55  39%  316 aa  DDL_GEOSL RecName: Full=D-alanine--D-alanine ligase;       
    1::308     2e-55  39%  312 aa  DDL_CARHZ RecName: Full=D-alanine--D-alanine ligase;       
    8::307     2e-55  38%  307 aa  DDL_ACTSZ RecName: Full=D-alanine--D-alanine ligase;       
    1::304     4e-55  40%  304 aa  DDL_THEYD RecName: Full=D-alanine--D-alanine ligase;       
    4::300     5e-55  38%  306 aa  DDL_DESAP RecName: Full=D-alanine--D-alanine ligase;       
    9::308     6e-55  40%  308 aa  DDL_HAES1 RecName: Full=D-alanine--D-alanine ligase;       
    7::303     6e-55  40%  303 aa  DDL_HAEDU RecName: Full=D-alanine--D-alanine ligase;       
    9::308     8e-55  39%  308 aa  DDL_HAES2 RecName: Full=D-alanine--D-alanine ligase;       
   10::305     1e-54  41%  305 aa  DDL_GEOBB RecName: Full=D-alanine--D-alanine ligase;       
    1::297     4e-54  41%  297 aa  DDL_HAEIE RecName: Full=D-alanine--D-alanine ligase;       
    7::302     7e-54  40%  303 aa  DDL_HAEPS RecName: Full=D-alanine--D-alanine ligase;       
   10::310     7e-54  37%  310 aa  DDL_GEOUR RecName: Full=D-alanine--D-alanine ligase;       
   10::301     7e-54  40%  313 aa  DDL_GEOLS RecName: Full=D-alanine--D-alanine ligase;       
   17::312     6e-53  36%  313 aa  DDL_THICR RecName: Full=D-alanine--D-alanine ligase;       
   17::308     8e-53  41%  334 aa  DDL_ACIAC RecName: Full=D-alanine--D-alanine ligase;       
    8::300     2e-52  38%  310 aa  DDL_PELPD RecName: Full=D-alanine--D-alanine ligase;       
    3::311     3e-52  38%  318 aa  DDL_PELTS RecName: Full=D-alanine--D-alanine ligase;       
    6::310     1e-51  37%  311 aa  DDL_SYNFM RecName: Full=D-alanine--D-alanine ligase;       
    1::304     1e-51  38%  305 aa  DDL_BACHD RecName: Full=D-alanine--D-alanine ligase;       
    1::304     2e-51  38%  323 aa  DDL_SYNJA RecName: Full=D-alanine--D-alanine ligase;       
    1::290     3e-51  41%  291 aa  DDL_AQUAE RecName: Full=D-alanine--D-alanine ligase;       
    4::354     9e-51  41%  364 aa  DDL_CALS8 RecName: Full=D-alanine--D-alanine ligase;       
   23::324     1e-50  39%  338 aa  DDL_POLSJ RecName: Full=D-alanine--D-alanine ligase;       
    1::295     2e-50  42%  303 aa  DDL_THESQ RecName: Full=D-alanine--D-alanine ligase;       
    1::295     2e-50  42%  303 aa  DDL_THEMA RecName: Full=D-alanine--D-alanine ligase;       
    3::308     2e-50  38%  309 aa  DDL_SYNWW RecName: Full=D-alanine--D-alanine ligase;       
    1::314     3e-50  41%  316 aa  DDL_FERNB RecName: Full=D-alanine--D-alanine ligase;       
    1::295     4e-50  35%  302 aa  DDL_DESAD RecName: Full=D-alanine--D-alanine ligase;       
    6::300     4e-50  41%  303 aa  DDLB_CHRVO RecName: Full=D-alanine--D-alanine ligase B;       
    9::295     8e-50  40%  303 aa  DDL_METI4 RecName: Full=D-alanine--D-alanine ligase;       
    1::339     1e-49  37%  351 aa  DDL_PEDPA RecName: Full=D-alanine--D-alanine ligase;       
   15::306     2e-49  39%  332 aa  DDL_DIAST RecName: Full=D-alanine--D-alanine ligase;       
   15::306     2e-49  39%  332 aa  DDL_ACISJ RecName: Full=D-alanine--D-alanine ligase;       
   16::307     3e-49  36%  327 aa  DDL_CUPTR RecName: Full=D-alanine--D-alanine ligase;       
    1::304     1e-48  37%  325 aa  DDL_SYNJB RecName: Full=D-alanine--D-alanine ligase;       
   12::313     1e-48  38%  319 aa  DDL_METPP RecName: Full=D-alanine--D-alanine ligase;       
   28::319     1e-48  39%  346 aa  DDL_RHOFD RecName: Full=D-alanine--D-alanine ligase;       
    3::347     1e-48  39%  351 aa  DDL_LEPIC RecName: Full=D-alanine--D-alanine ligase;       
    1::295     1e-48  37%  303 aa  DDL_DESVV RecName: Full=D-alanine--D-alanine ligase;       
    4::303     1e-48  36%  306 aa  DDLB_ECOLI RecName: Full=D-alanine--D-alanine ligase B;       
    5::354     2e-48  41%  359 aa  DDL_THEPX RecName: Full=D-alanine--D-alanine ligase;       
    5::354     2e-48  41%  359 aa  DDL_THEP3 RecName: Full=D-alanine--D-alanine ligase;       
   16::311     2e-48  36%  327 aa  DDL_RALEJ RecName: Full=D-alanine--D-alanine ligase;       
    1::295     2e-48  37%  303 aa  DDL_DESVH RecName: Full=D-alanine--D-alanine ligase;       
   15::306     2e-48  39%  326 aa  DDL_DELAS RecName: Full=D-alanine--D-alanine ligase;       
    4::303     2e-48  36%  306 aa  DDLB_ECO57 RecName: Full=D-alanine--D-alanine ligase B;       
    4::303     3e-48  36%  306 aa  DDL_SALPK RecName: Full=D-alanine--D-alanine ligase;       
    4::303     3e-48  36%  306 aa  DDL_SALPA RecName: Full=D-alanine--D-alanine ligase;       
    4::303     3e-48  36%  306 aa  DDLB_SALTI RecName: Full=D-alanine--D-alanine ligase B;       
    4::303     3e-48  36%  306 aa  DDLB_SALTY RecName: Full=D-alanine--D-alanine ligase B;       
    3::347     4e-48  39%  351 aa  DDL_LEPIN RecName: Full=D-alanine--D-alanine ligase;       
    4::303     4e-48  36%  306 aa  DDLB_SHIFL RecName: Full=D-alanine--D-alanine ligase B;       
    4::354     6e-48  41%  364 aa  DDL_ANATD RecName: Full=D-alanine--D-alanine ligase;       
   11::303     1e-47  37%  308 aa  DDL_LARHH RecName: Full=D-alanine--D-alanine ligase;       
    7::347     1e-47  37%  365 aa  DDL_BDEBA RecName: Full=D-alanine--D-alanine ligase;       
    1::295     2e-47  40%  303 aa  DDL_THEP1 RecName: Full=D-alanine--D-alanine ligase;       
    1::301     2e-47  38%  302 aa  DDL_GLOVI RecName: Full=D-alanine--D-alanine ligase;       
    9::300     4e-47  37%  306 aa  DDL_NITMU RecName: Full=D-alanine--D-alanine ligase;       
    1::297     4e-47  35%  304 aa  DDL_DESMR RecName: Full=D-alanine--D-alanine ligase;       
    7::305     5e-47  36%  310 aa  DDL_MAGSM RecName: Full=D-alanine--D-alanine ligase;       
    4::303     5e-47  36%  306 aa  DDLB_ECOL6 RecName: Full=D-alanine--D-alanine ligase B;       
   10::314     8e-47  37%  325 aa  DDL_POLNA RecName: Full=D-alanine--D-alanine ligase;       
   10::310     8e-47  37%  317 aa  DDL_MARMS RecName: Full=D-alanine--D-alanine ligase;       
    4::316     8e-47  39%  320 aa  DDL_HAMD5 RecName: Full=D-alanine--D-alanine ligase;       
    8::302     1e-46  36%  306 aa  DDL_NITEC RecName: Full=D-alanine--D-alanine ligase;       
    4::354     1e-46  39%  365 aa  DDL_NATTJ RecName: Full=D-alanine--D-alanine ligase;       
    1::308     1e-46  38%  309 aa  DDL_MOOTA RecName: Full=D-alanine--D-alanine ligase;       
    9::310     2e-46  38%  322 aa  DDL_DESPS RecName: Full=D-alanine--D-alanine ligase;       
    1::349     2e-46  39%  350 aa  DDL_LACSS RecName: Full=D-alanine--D-alanine ligase;       
    4::306     2e-46  37%  306 aa  DDL_BUCAP RecName: Full=D-alanine--D-alanine ligase;       
    6::330     2e-46  40%  346 aa  DDLA_PSEAE RecName: Full=D-alanine--D-alanine ligase A;       
    5::295     3e-46  39%  296 aa  DDL_FRATN RecName: Full=D-alanine--D-alanine ligase;       
    6::296     3e-46  38%  301 aa  DDL_DECAR RecName: Full=D-alanine--D-alanine ligase;       
    7::297     4e-46  36%  302 aa  DDL_METFK RecName: Full=D-alanine--D-alanine ligase;       
    9::305     4e-46  36%  308 aa  DDL_ACIBT RecName: Full=D-alanine--D-alanine ligase;       
    9::305     4e-46  36%  308 aa  DDL_ACIBC RecName: Full=D-alanine--D-alanine ligase;       
   25::311     5e-46  36%  327 aa  DDL_RALEH RecName: Full=D-alanine--D-alanine ligase;       
    5::295     5e-46  39%  296 aa  DDL_FRATT RecName: Full=D-alanine--D-alanine ligase;       
    5::295     5e-46  39%  296 aa  DDL_FRATO RecName: Full=D-alanine--D-alanine ligase;       
    5::295     5e-46  39%  296 aa  DDL_FRATF RecName: Full=D-alanine--D-alanine ligase;       
    5::295     5e-46  39%  296 aa  DDL_FRAT1 RecName: Full=D-alanine--D-alanine ligase;       
   11::312     5e-46  39%  313 aa  DDL_BURXL RecName: Full=D-alanine--D-alanine ligase;       
    4::303     7e-46  35%  306 aa  DDL_PHOLL RecName: Full=D-alanine--D-alanine ligase;       
    5::295     7e-46  39%  296 aa  DDL_FRATW RecName: Full=D-alanine--D-alanine ligase;       
   26::311     9e-46  38%  327 aa  DDL_RALME RecName: Full=D-alanine--D-alanine ligase;       
    4::303     1e-45  37%  306 aa  DDL_PECCP RecName: Full=D-alanine--D-alanine ligase;       
    9::305     1e-45  35%  308 aa  DDL_ACIBS RecName: Full=D-alanine--D-alanine ligase;       
   29::330     2e-45  36%  337 aa  DDL_POLNS RecName: Full=D-alanine--D-alanine ligase;       
    5::295     2e-45  39%  296 aa  DDL_FRATH RecName: Full=D-alanine--D-alanine ligase;       
    5::295     2e-45  37%  297 aa  DDL_FRAP2 RecName: Full=D-alanine--D-alanine ligase;       
    9::305     2e-45  35%  308 aa  DDL_ACIBY RecName: Full=D-alanine--D-alanine ligase;       
    9::305     2e-45  35%  308 aa  DDL_ACIB5 RecName: Full=D-alanine--D-alanine ligase;       
    9::305     2e-45  35%  308 aa  DDL_ACIB3 RecName: Full=D-alanine--D-alanine ligase;       
    9::304     2e-45  36%  309 aa  DDL_ACIAD RecName: Full=D-alanine--D-alanine ligase;       
    8::302     3e-45  35%  305 aa  DDL_NITEU RecName: Full=D-alanine--D-alanine ligase;       
   17::315     3e-45  36%  326 aa  DDL_BORPD RecName: Full=D-alanine--D-alanine ligase;       
   18::318     8e-45  35%  318 aa  DDL_XANAC RecName: Full=D-alanine--D-alanine ligase;       
   10::306     1e-44  34%  306 aa  DDL_PSEHT RecName: Full=D-alanine--D-alanine ligase;       
    4::341     1e-44  38%  343 aa  DDL_CLOAB RecName: Full=D-alanine--D-alanine ligase;       
   14::317     1e-44  35%  334 aa  DDL_HERAR RecName: Full=D-alanine--D-alanine ligase;       
    4::303     1e-44  35%  306 aa  DDL_ERWCT RecName: Full=D-alanine--D-alanine ligase;       
    8::302     1e-44  36%  308 aa  DDL_ANADF RecName: Full=D-alanine--D-alanine ligase;       
   19::311     2e-44  39%  331 aa  DDL_RALPJ RecName: Full=D-alanine--D-alanine ligase;       
    4::303     2e-44  36%  306 aa  DDL_ERWT9 RecName: Full=D-alanine--D-alanine ligase;       
    4::329     2e-44  41%  366 aa  DDL_OCEIH RecName: Full=D-alanine--D-alanine ligase;       
    1::298     3e-44  36%  306 aa  DDL_DESDA RecName: Full=D-alanine--D-alanine ligase;       
    6::302     4e-44  37%  308 aa  DDL_MESSB RecName: Full=D-alanine--D-alanine ligase;       
    7::351     6e-44  38%  380 aa  DDL_LACBA RecName: Full=D-alanine--D-alanine ligase;       
    1::298     6e-44  35%  308 aa  DDL_DESDG RecName: Full=D-alanine--D-alanine ligase;       
    7::302     6e-44  35%  317 aa  DDL_BORA1 RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERPY RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERPS RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERPP RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERPN RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERPG RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERPE RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERPB RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERPA RecName: Full=D-alanine--D-alanine ligase;       
    4::302     8e-44  36%  306 aa  DDL_YERP3 RecName: Full=D-alanine--D-alanine ligase;       
   12::309     8e-44  37%  310 aa  DDL_THIDA RecName: Full=D-alanine--D-alanine ligase;       
    7::302     8e-44  35%  308 aa  DDL_RHOPB RecName: Full=D-alanine--D-alanine ligase;       
    1::302     8e-44  33%  302 aa  DDL_LAWIP RecName: Full=D-alanine--D-alanine ligase;       
    7::307     8e-44  36%  320 aa  DDL_JANMA RecName: Full=D-alanine--D-alanine ligase;       
    3::347     1e-43  35%  351 aa  DDL_LEPBL RecName: Full=D-alanine--D-alanine ligase;       
    3::347     1e-43  35%  351 aa  DDL_LEPBJ RecName: Full=D-alanine--D-alanine ligase;       
    4::322     1e-43  36%  323 aa  DDL_FLAJ1 RecName: Full=D-alanine--D-alanine ligase;       
    7::333     1e-43  38%  350 aa  DDL_FINM2 RecName: Full=D-alanine--D-alanine ligase;       
    5::301     2e-43  37%  315 aa  DDL_WOLPM RecName: Full=D-alanine--D-alanine ligase;       
   19::311     2e-43  36%  331 aa  DDL_RALSO RecName: Full=D-alanine--D-alanine ligase;       
    7::302     2e-43  37%  308 aa  DDL_OLICO RecName: Full=D-alanine--D-alanine ligase;       
    7::353     2e-43  37%  356 aa  DDL_CORA7 RecName: Full=D-alanine--D-alanine ligase;       
    7::303     2e-43  37%  317 aa  DDL_WOLWR RecName: Full=D-alanine--D-alanine ligase;       
    4::341     2e-43  35%  343 aa  DDL_HALOH RecName: Full=D-alanine--D-alanine ligase;       
   18::318     2e-43  34%  318 aa  DDLB_XANCP RecName: Full=D-alanine--D-alanine ligase B;       
   12::304     3e-43  36%  309 aa  DDL_AZOSE RecName: Full=D-alanine--D-alanine ligase;       
    8::302     3e-43  35%  308 aa  DDL_ANADE RecName: Full=D-alanine--D-alanine ligase;       
    8::302     4e-43  35%  308 aa  DDL_ANASK RecName: Full=D-alanine--D-alanine ligase;       
    8::302     4e-43  35%  308 aa  DDL_ANAD2 RecName: Full=D-alanine--D-alanine ligase;       
    7::305     9e-43  35%  316 aa  DDL_BORPA RecName: Full=D-alanine--D-alanine ligase;       
    9::356     1e-42  36%  361 aa  DDL_COREF RecName: Full=D-alanine--D-alanine ligase;       
   15::308     2e-42  35%  331 aa  DDL_VEREI RecName: Full=D-alanine--D-alanine ligase;       
    7::305     3e-42  35%  316 aa  DDL_BORPE RecName: Full=D-alanine--D-alanine ligase;       
    7::305     3e-42  35%  316 aa  DDL_BORBR RecName: Full=D-alanine--D-alanine ligase;       
    7::302     4e-42  35%  308 aa  DDL_RHOP5 RecName: Full=D-alanine--D-alanine ligase;       
   14::310     4e-42  34%  313 aa  DDL_PSEMY RecName: Full=D-alanine--D-alanine ligase;       
    5::301     4e-42  37%  307 aa  DDL_METPB RecName: Full=D-alanine--D-alanine ligase;       
    4::348     4e-42  35%  349 aa  DDL_LEPBP RecName: Full=D-alanine--D-alanine ligase;       
    4::348     4e-42  35%  349 aa  DDL_LEPBA RecName: Full=D-alanine--D-alanine ligase;       
    3::317     6e-42  34%  325 aa  DDL_SOLUE RecName: Full=D-alanine--D-alanine ligase;       
    5::301     6e-42  36%  307 aa  DDL_METEP RecName: Full=D-alanine--D-alanine ligase;       
   16::316     6e-42  34%  317 aa  DDL_COLP3 RecName: Full=D-alanine--D-alanine ligase;       
   11::312     6e-42  37%  313 aa  DDL_BURPP RecName: Full=D-alanine--D-alanine ligase;       
    7::298     6e-42  36%  304 aa  DDL_AZOSB RecName: Full=D-alanine--D-alanine ligase;       
   12::308     8e-42  36%  316 aa  DDL_NITOC RecName: Full=D-alanine--D-alanine ligase;       
    5::352     8e-42  37%  368 aa  DDL_BACSK RecName: Full=D-alanine--D-alanine ligase;       
    5::301     1e-41  36%  307 aa  DDL_METC4 RecName: Full=D-alanine--D-alanine ligase;       
   12::304     1e-41  35%  304 aa  DDL_HALHL RecName: Full=D-alanine--D-alanine ligase;       
   20::314     1e-41  34%  319 aa  DDLB_PSEAE RecName: Full=D-alanine--D-alanine ligase B;       
    9::348     2e-41  37%  370 aa  DDL_LACPL RecName: Full=D-alanine--D-alanine ligase;       
    6::351     2e-41  38%  377 aa  DDL_LACF3 RecName: Full=D-alanine--D-alanine ligase;       
    4::356     2e-41  35%  366 aa  DDL_PROMH RecName: Full=D-alanine--D-alanine ligase;       
   19::314     3e-41  35%  324 aa  DDL_PSEPF RecName: Full=D-alanine--D-alanine ligase;       
    1::287     3e-41  37%  287 aa  DDL_FUSNN RecName: Full=D-alanine--D-alanine ligase;       
   21::355     3e-41  38%  358 aa  DDLB_CLOTE RecName: Full=D-alanine--D-alanine ligase B;       
    9::350     4e-41  35%  364 aa  DDL_LEGPL RecName: Full=D-alanine--D-alanine ligase;       
    9::350     4e-41  35%  364 aa  DDL_LEGPH RecName: Full=D-alanine--D-alanine ligase;       
    9::350     4e-41  35%  364 aa  DDL_LEGPC RecName: Full=D-alanine--D-alanine ligase;       
    9::350     4e-41  35%  364 aa  DDL_LEGPA RecName: Full=D-alanine--D-alanine ligase;       
    5::325     7e-41  34%  330 aa  DDL_PARD8 RecName: Full=D-alanine--D-alanine ligase;       
    5::354     7e-41  35%  361 aa  DDL_HERA2 RecName: Full=D-alanine--D-alanine ligase;       
    7::302     9e-41  36%  317 aa  DDL_WOLPP RecName: Full=D-alanine--D-alanine ligase;       
   24::319     9e-41  35%  325 aa  DDL_MARAV RecName: Full=D-alanine--D-alanine ligase;       
    6::299     1e-40  37%  304 aa  DDL_NEIG2 RecName: Full=D-alanine--D-alanine ligase;       
    6::299     1e-40  37%  304 aa  DDL_NEIG1 RecName: Full=D-alanine--D-alanine ligase;       
    7::306     1e-40  36%  309 aa  DDL_BUCBP RecName: Full=D-alanine--D-alanine ligase;       
    4::342     2e-40  36%  343 aa  VANA_ENTFC RecName: Full=Vancomycin/teicoplanin A-type resistance
    5::301     2e-40  36%  307 aa  DDL_BEII9 RecName: Full=D-alanine--D-alanine ligase;       
    6::299     3e-40  37%  304 aa  DDL_NEIMA RecName: Full=D-alanine--D-alanine ligase;       
    6::302     3e-40  36%  308 aa  DDLB_RHILO RecName: Full=D-alanine--D-alanine ligase B;       
    4::352     3e-40  34%  364 aa  DDLA_SALTY RecName: Full=D-alanine--D-alanine ligase A;       
    4::352     3e-40  34%  364 aa  DDLA_SALTI RecName: Full=D-alanine--D-alanine ligase A;       
   19::314     3e-40  33%  318 aa  DDL_PSEPG RecName: Full=D-alanine--D-alanine ligase;       
   19::314     3e-40  33%  318 aa  DDL_PSEE4 RecName: Full=D-alanine--D-alanine ligase;       
   19::331     4e-40  38%  339 aa  DDL_WOLTR RecName: Full=D-alanine--D-alanine ligase;       
    4::339     4e-40  36%  343 aa  DDL_CLONN RecName: Full=D-alanine--D-alanine ligase;       
    6::299     6e-40  37%  304 aa  DDL_NEIMF RecName: Full=D-alanine--D-alanine ligase;       
   15::306     6e-40  33%  307 aa  DDL_ALCBS RecName: Full=D-alanine--D-alanine ligase;       
   19::314     6e-40  33%  318 aa  DDLB_PSEPK RecName: Full=D-alanine--D-alanine ligase B;       
    4::304     7e-40  33%  304 aa  DDL_PELUB RecName: Full=D-alanine--D-alanine ligase;       
    6::299     1e-39  37%  304 aa  DDL_NEIMB RecName: Full=D-alanine--D-alanine ligase;       
   98::365     1e-39  36%  376 aa  DDL_CLOTH RecName: Full=D-alanine--D-alanine ligase;       
   11::312     1e-39  36%  313 aa  DDL_BURP8 RecName: Full=D-alanine--D-alanine ligase;       
    7::309     1e-39  34%  323 aa  DDL_ERYLH RecName: Full=D-alanine--D-alanine ligase;       
   11::311     1e-39  37%  312 aa  DDL_BURTA RecName: Full=D-alanine--D-alanine ligase;       
    4::352     1e-39  35%  364 aa  DDLA_SHIFL RecName: Full=D-alanine--D-alanine ligase A;       
    6::355     1e-39  35%  357 aa  DDLA_RHILO RecName: Full=D-alanine--D-alanine ligase A;       
    4::352     1e-39  35%  364 aa  DDLA_ECOLI RecName: Full=D-alanine--D-alanine ligase A;       
    4::352     1e-39  35%  364 aa  DDLA_ECOL6 RecName: Full=D-alanine--D-alanine ligase A;       
    4::352     1e-39  35%  364 aa  DDLA_ECO57 RecName: Full=D-alanine--D-alanine ligase A;       
    4::327     2e-39  41%  367 aa  DDL_GEOKA RecName: Full=D-alanine--D-alanine ligase;       
   11::311     2e-39  36%  312 aa  DDL_BURPS RecName: Full=D-alanine--D-alanine ligase;       
   11::311     2e-39  36%  312 aa  DDL_BURP1 RecName: Full=D-alanine--D-alanine ligase;       
   11::311     2e-39  36%  312 aa  DDL_BURP0 RecName: Full=D-alanine--D-alanine ligase;       
   11::311     2e-39  36%  312 aa  DDL_BURMS RecName: Full=D-alanine--D-alanine ligase;       
   11::311     2e-39  36%  312 aa  DDL_BURMA RecName: Full=D-alanine--D-alanine ligase;       
   11::311     2e-39  36%  312 aa  DDL_BURM9 RecName: Full=D-alanine--D-alanine ligase;       
   11::311     2e-39  36%  312 aa  DDL_BURM7 RecName: Full=D-alanine--D-alanine ligase;       
    5::300     3e-39  35%  306 aa  DDL_XANP2 RecName: Full=D-alanine--D-alanine ligase;       
    7::361     3e-39  35%  368 aa  DDL_RHOSR RecName: Full=D-alanine--D-alanine ligase;       
    5::301     3e-39  35%  307 aa  DDL_METSB RecName: Full=D-alanine--D-alanine ligase;       
    6::350     3e-39  35%  378 aa  DDL_LACS1 RecName: Full=D-alanine--D-alanine ligase;       
    5::350     3e-39  36%  378 aa  DDL_LACRD RecName: Full=D-alanine--D-alanine ligase;       
    1::320     3e-39  33%  328 aa  DDL_FLAPJ RecName: Full=D-alanine--D-alanine ligase;       
    5::300     3e-39  35%  306 aa  DDL_AZOC5 RecName: Full=D-alanine--D-alanine ligase;       
   20::316     3e-39  33%  319 aa  DDLB_PSESM RecName: Full=D-alanine--D-alanine ligase B;       
    4::326     3e-39  39%  361 aa  DDLB_BACCR RecName: Full=D-alanine--D-alanine ligase B;       
   43::319     4e-39  36%  337 aa  DDL_POLSQ RecName: Full=D-alanine--D-alanine ligase;       
    4::304     5e-39  33%  304 aa  DDL_XYLFT RecName: Full=D-alanine--D-alanine ligase;       
    6::354     5e-39  38%  361 aa  DDL_PROVI RecName: Full=D-alanine--D-alanine ligase;       
   13::307     5e-39  35%  309 aa  DDL_METCA RecName: Full=D-alanine--D-alanine ligase;       
   11::311     5e-39  36%  312 aa  DDL_BURP6 RecName: Full=D-alanine--D-alanine ligase;       
    7::361     6e-39  35%  368 aa  DDL_RHOOB RecName: Full=D-alanine--D-alanine ligase;       
    5::301     6e-39  34%  307 aa  DDL_METRJ RecName: Full=D-alanine--D-alanine ligase;       
    8::308     6e-39  31%  309 aa  DDL_IDILO RecName: Full=D-alanine--D-alanine ligase;       
    4::327     8e-39  40%  364 aa  DDL_GEOTN RecName: Full=D-alanine--D-alanine ligase;       
    4::339     8e-39  37%  366 aa  DDLA_CHRVO RecName: Full=D-alanine--D-alanine ligase A;       
   99::356     1e-38  36%  363 aa  DDL_CHLPD RecName: Full=D-alanine--D-alanine ligase;       
   99::342     1e-38  40%  360 aa  DDL_CHLCH RecName: Full=D-alanine--D-alanine ligase;       
    4::304     1e-38  34%  304 aa  DDL_XYLFA RecName: Full=D-alanine--D-alanine ligase;       
    1::301     1e-38  34%  303 aa  DDL_GLUOX RecName: Full=D-alanine--D-alanine ligase;       
    5::358     1e-38  36%  376 aa  DDL_CLOCE RecName: Full=D-alanine--D-alanine ligase;       
    5::321     1e-38  32%  324 aa  DDL_BACFR RecName: Full=D-alanine--D-alanine ligase;       
    5::321     1e-38  32%  324 aa  DDL_BACFN RecName: Full=D-alanine--D-alanine ligase;       
   18::379     2e-38  34%  385 aa  DDL_STRAW RecName: Full=D-alanine--D-alanine ligase;       
    7::361     2e-38  34%  368 aa  DDL_RHOE4 RecName: Full=D-alanine--D-alanine ligase;       
    1::344     2e-38  33%  357 aa  DDL_LACCB RecName: Full=D-alanine--D-alanine ligase;       
    1::344     2e-38  33%  357 aa  DDL_LACC3 RecName: Full=D-alanine--D-alanine ligase;       
   24::384     2e-38  35%  391 aa  DDL_STRGG RecName: Full=D-alanine--D-alanine ligase;       
    6::308     2e-38  33%  313 aa  DDL_NOVAD RecName: Full=D-alanine--D-alanine ligase;       
    5::321     2e-38  33%  324 aa  DDL_BACV8 RecName: Full=D-alanine--D-alanine ligase;       
   21::313     3e-38  34%  314 aa  DDL_SACD2 RecName: Full=D-alanine--D-alanine ligase;       
    4::302     3e-38  35%  305 aa  DDL_MAGSA RecName: Full=D-alanine--D-alanine ligase;       
    4::337     3e-38  34%  339 aa  DDL_DEIRA RecName: Full=D-alanine--D-alanine ligase;       
   11::311     3e-38  37%  313 aa  DDL_BURM1 RecName: Full=D-alanine--D-alanine ligase;       
    8::344     5e-38  36%  348 aa  DDL_PROM1 RecName: Full=D-alanine--D-alanine ligase;       
    5::356     7e-38  35%  360 aa  DDL_PROA2 RecName: Full=D-alanine--D-alanine ligase;       
  119::372     9e-38  37%  373 aa  DDL_CORJK RecName: Full=D-alanine--D-alanine ligase;       
    5::321     9e-38  33%  324 aa  DDL_BACTN RecName: Full=D-alanine--D-alanine ligase;       
    4::322     9e-38  36%  324 aa  DDL_AZOPC RecName: Full=D-alanine--D-alanine ligase;       
    6::300     1e-37  33%  306 aa  DDL_RHISN RecName: Full=D-alanine--D-alanine ligase;       
    5::356     1e-37  35%  363 aa  DDL_NOCFA RecName: Full=D-alanine--D-alanine ligase;       
    4::323     1e-37  33%  326 aa  DDL_GRAFK RecName: Full=D-alanine--D-alanine ligase;       
   11::311     1e-37  37%  313 aa  DDL_BURCM RecName: Full=D-alanine--D-alanine ligase;       
   12::366     2e-37  34%  373 aa  DDL_MYCSM RecName: Full=D-alanine--D-alanine ligase;       
   12::366     2e-37  34%  373 aa  DDL_MYCS2 RecName: Full=D-alanine--D-alanine ligase;       
   11::311     2e-37  35%  313 aa  DDL_BURCJ RecName: Full=D-alanine--D-alanine ligase;       
    8::344     2e-37  37%  348 aa  DDL_PROMT RecName: Full=D-alanine--D-alanine ligase;       
    5::303     2e-37  34%  307 aa  DDL_GRABC RecName: Full=D-alanine--D-alanine ligase;       
    1::304     3e-37  33%  304 aa  DDL_COPPD RecName: Full=D-alanine--D-alanine ligase;       
   11::311     3e-37  35%  313 aa  DDL_BURCH RecName: Full=D-alanine--D-alanine ligase;       
   11::311     3e-37  35%  313 aa  DDL_BURCC RecName: Full=D-alanine--D-alanine ligase;       
   11::311     3e-37  35%  313 aa  DDL_BURCA RecName: Full=D-alanine--D-alanine ligase;       
   11::311     3e-37  36%  313 aa  DDL_BURA4 RecName: Full=D-alanine--D-alanine ligase;       
    6::302     3e-37  32%  308 aa  DDL_AGRT5 RecName: Full=D-alanine--D-alanine ligase;       
    8::307     3e-37  34%  308 aa  DDL_SPHAL RecName: Full=D-alanine--D-alanine ligase;       
   15::311     3e-37  34%  314 aa  DDL_PSEU5 RecName: Full=D-alanine--D-alanine ligase;       
   11::295     3e-37  32%  311 aa  DDL_ALHEH RecName: Full=D-alanine--D-alanine ligase;       
    6::349     3e-37  34%  353 aa  DDLA_BRUSU RecName: Full=D-alanine--D-alanine ligase A;       
    1::353     4e-37  33%  368 aa  DDL_TREDE RecName: Full=D-alanine--D-alanine ligase;       
    4::341     8e-37  38%  346 aa  VANL_STRCO RecName: Full=Putative D-alanine--D-lactate ligase;     
    2::292     8e-37  33%  293 aa  DDL_VESOH RecName: Full=D-alanine--D-alanine ligase;       
    2::340     8e-37  33%  361 aa  DDL_THEM4 RecName: Full=D-alanine--D-alanine ligase;       
   58::348     8e-37  35%  354 aa  DDL_RICCK RecName: Full=D-alanine--D-alanine ligase;       
    6::302     8e-37  32%  308 aa  DDL_RHIME RecName: Full=D-alanine--D-alanine ligase;       
    7::356     8e-37  34%  362 aa  DDL_CORU7 RecName: Full=D-alanine--D-alanine ligase;       
   96::351     8e-37  39%  363 aa  DDL_CHLL2 RecName: Full=D-alanine--D-alanine ligase;       
    6::349     1e-36  34%  353 aa  DDLA_BRUME RecName: Full=D-alanine--D-alanine ligase A;       
    8::339     2e-36  36%  356 aa  DDL_STAAT RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAAN RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAAM RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAAE RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAAC RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAAB RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAA9 RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAA8 RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAA3 RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAA2 RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  36%  356 aa  DDL_STAA1 RecName: Full=D-alanine--D-alanine ligase;       
    6::300     2e-36  33%  306 aa  DDL_BART1 RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  35%  356 aa  DDL_STAAW RecName: Full=D-alanine--D-alanine ligase;       
    8::339     2e-36  35%  356 aa  DDL_STAAS RecName: Full=D-alanine--D-alanine ligase;       
    4::337     2e-36  35%  339 aa  DDL_DEIGD RecName: Full=D-alanine--D-alanine ligase;       
    6::300     2e-36  33%  306 aa  DDL_BARHE RecName: Full=D-alanine--D-alanine ligase;       
    4::327     2e-36  39%  362 aa  DDL_BACCN RecName: Full=D-alanine--D-alanine ligase;       
    8::339     3e-36  35%  356 aa  DDL_STAAR RecName: Full=D-alanine--D-alanine ligase;       
    5::356     3e-36  36%  366 aa  DDL_CHLT3 RecName: Full=D-alanine--D-alanine ligase;       
   11::311     3e-36  37%  313 aa  DDL_BURVG RecName: Full=D-alanine--D-alanine ligase;       
   23::383     4e-36  33%  389 aa  DDL_STRCO RecName: Full=D-alanine--D-alanine ligase;       
    6::326     5e-36  33%  330 aa  DDL_PORGI RecName: Full=D-alanine--D-alanine ligase;       
    6::326     6e-36  34%  330 aa  DDL_PORG3 RecName: Full=D-alanine--D-alanine ligase;       
    6::356     6e-36  32%  360 aa  DDL_CHLPB RecName: Full=D-alanine--D-alanine ligase;       
   99::343     8e-36  38%  360 aa  DDL_PELPB RecName: Full=D-alanine--D-alanine ligase;       
    4::296     1e-35  32%  302 aa  DDL_RHORT RecName: Full=D-alanine--D-alanine ligase;       
    5::344     1e-35  35%  363 aa  DDLA_PSESM RecName: Full=D-alanine--D-alanine ligase A;       
   75::318     1e-35  36%  319 aa  DDL_THET2 RecName: Full=D-alanine--D-alanine ligase;       
   25::315     1e-35  33%  321 aa  DDL_RICBR RecName: Full=D-alanine--D-alanine ligase;       
    2::292     2e-35  33%  293 aa  DDL_RUTMC RecName: Full=D-alanine--D-alanine ligase;       
    6::300     2e-35  33%  306 aa  DDL_BARBK RecName: Full=D-alanine--D-alanine ligase;       
    4::362     2e-35  36%  366 aa  DDL_TRIEI RecName: Full=D-alanine--D-alanine ligase;       
    6::302     2e-35  31%  308 aa  DDL_SINMW RecName: Full=D-alanine--D-alanine ligase;       
    6::347     2e-35  34%  360 aa  DDL_LACH4 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     3e-35  33%  348 aa  DDL_STRU0 RecName: Full=D-alanine--D-alanine ligase;       
    8::339     3e-35  34%  357 aa  DDL_STAES RecName: Full=D-alanine--D-alanine ligase;       
    8::339     3e-35  34%  357 aa  DDL_STAEQ RecName: Full=D-alanine--D-alanine ligase;       
    4::352     3e-35  39%  370 aa  DDL_LISW6 RecName: Full=D-alanine--D-alanine ligase;       
    5::348     3e-35  34%  361 aa  DDL_LACJO RecName: Full=D-alanine--D-alanine ligase;       
    4::341     4e-35  34%  342 aa  VANB_ENTFA RecName: Full=Vancomycin B-type resistance protein vanB;
    2::339     4e-35  37%  367 aa  DDL_THEAB RecName: Full=D-alanine--D-alanine ligase;       
   10::300     4e-35  35%  306 aa  DDL_SILPO RecName: Full=D-alanine--D-alanine ligase;       
   25::315     4e-35  33%  321 aa  DDL_RICB8 RecName: Full=D-alanine--D-alanine ligase;       
    4::352     4e-35  37%  370 aa  DDL_LISMO RecName: Full=D-alanine--D-alanine ligase;       
    4::352     4e-35  37%  370 aa  DDL_LISMF RecName: Full=D-alanine--D-alanine ligase;       
    4::352     4e-35  35%  375 aa  DDL_BAUCH RecName: Full=D-alanine--D-alanine ligase;       
    5::306     5e-35  32%  312 aa  DDL_SPHWW RecName: Full=D-alanine--D-alanine ligase;       
    7::304     5e-35  35%  308 aa  DDL_PARL1 RecName: Full=D-alanine--D-alanine ligase;       
   10::300     7e-35  35%  306 aa  DDL_SILST RecName: Full=D-alanine--D-alanine ligase;       
   25::315     7e-35  33%  321 aa  DDL_RICFE RecName: Full=D-alanine--D-alanine ligase;       
    5::357     7e-35  34%  372 aa  DDL_COXBU RecName: Full=D-alanine--D-alanine ligase;       
    5::357     7e-35  34%  372 aa  DDL_COXBR RecName: Full=D-alanine--D-alanine ligase;       
    5::357     7e-35  34%  372 aa  DDL_COXBN RecName: Full=D-alanine--D-alanine ligase;       
    5::357     7e-35  34%  372 aa  DDL_COXB1 RecName: Full=D-alanine--D-alanine ligase;       
   25::315     9e-35  33%  321 aa  DDL_RICTY RecName: Full=D-alanine--D-alanine ligase;       
   25::315     9e-35  32%  321 aa  DDL_RICPR RecName: Full=D-alanine--D-alanine ligase;       
   25::315     9e-35  33%  321 aa  DDL_RICAE RecName: Full=D-alanine--D-alanine ligase;       
    5::360     9e-35  31%  367 aa  DDL_MYCGI RecName: Full=D-alanine--D-alanine ligase;       
    5::348     9e-35  33%  361 aa  DDL_LACGA RecName: Full=D-alanine--D-alanine ligase;       
    6::346     9e-35  34%  368 aa  DDL_BLOPB RecName: Full=D-alanine--D-alanine ligase;       
   19::309     1e-34  34%  318 aa  DDL_PSEA6 RecName: Full=D-alanine--D-alanine ligase;       
    9::356     2e-34  34%  360 aa  DDL_CORGL RecName: Full=D-alanine--D-alanine ligase;       
   25::315     2e-34  33%  321 aa  DDL_RICM5 RecName: Full=D-alanine--D-alanine ligase;       
  105::366     2e-34  31%  373 aa  DDL_MYCTU RecName: Full=D-alanine--D-alanine ligase;       
  105::366     2e-34  31%  373 aa  DDL_MYCTA RecName: Full=D-alanine--D-alanine ligase;       
  105::366     2e-34  31%  373 aa  DDL_MYCBP RecName: Full=D-alanine--D-alanine ligase;       
  102::363     2e-34  31%  370 aa  DDL_MYCBO RecName: Full=D-alanine--D-alanine ligase;       
    9::356     2e-34  34%  360 aa  DDL_CORGB RecName: Full=D-alanine--D-alanine ligase;       
    3::352     2e-34  37%  360 aa  DDL_BACP2 RecName: Full=D-alanine--D-alanine ligase;       
    5::360     4e-34  32%  367 aa  DDL_MYCVP RecName: Full=D-alanine--D-alanine ligase;       
    5::363     4e-34  32%  373 aa  DDLA_BRAJA RecName: Full=D-alanine--D-alanine ligase A;       
    3::335     5e-34  35%  343 aa  VANC_ENTGA RecName: Full=Vancomycin C-type resistance protein vanC;
    7::306     5e-34  34%  321 aa  DDL_ZYMMO RecName: Full=D-alanine--D-alanine ligase;       
    6::354     5e-34  34%  361 aa  DDL_PELLD RecName: Full=D-alanine--D-alanine ligase;       
    4::348     5e-34  34%  352 aa  DDL_CYAP7 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     6e-34  33%  348 aa  DDL_STRT2 RecName: Full=D-alanine--D-alanine ligase;       
    8::339     6e-34  34%  356 aa  DDL_STACT RecName: Full=D-alanine--D-alanine ligase;       
   25::315     6e-34  33%  321 aa  DDL_RICCN RecName: Full=D-alanine--D-alanine ligase;       
   69::309     6e-34  35%  314 aa  DDL_CHRSD RecName: Full=D-alanine--D-alanine ligase;       
   11::301     8e-34  35%  307 aa  DDL_RHOS5 RecName: Full=D-alanine--D-alanine ligase;       
   11::366     8e-34  30%  373 aa  DDL_MYCUA RecName: Full=D-alanine--D-alanine ligase;       
    4::348     8e-34  32%  352 aa  DDL_MICAN RecName: Full=D-alanine--D-alanine ligase;       
    5::346     8e-34  34%  360 aa  DDL_LACAC RecName: Full=D-alanine--D-alanine ligase;       
   92::341     8e-34  39%  364 aa  DDL_CHLP8 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     1e-33  33%  348 aa  DDL_STRT1 RecName: Full=D-alanine--D-alanine ligase;       
   14::371     1e-33  31%  378 aa  DDL_ARTAT RecName: Full=D-alanine--D-alanine ligase;       
    8::338     1e-33  35%  356 aa  DDL_MACCJ RecName: Full=D-alanine--D-alanine ligase;       
    8::370     1e-33  38%  376 aa  DDL_KINRD RecName: Full=D-alanine--D-alanine ligase;       
  126::395     1e-33  38%  395 aa  DDL_BIFLI RecName: Full=D-alanine--D-alanine ligase;       
    5::377     1e-33  39%  378 aa  DDL_BIFA0 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-33  33%  348 aa  DDL_STRTD RecName: Full=D-alanine--D-alanine ligase;       
    4::352     2e-33  36%  370 aa  DDL_LISIN RecName: Full=D-alanine--D-alanine ligase;       
    2::349     2e-33  34%  356 aa  DDL_BORBU RecName: Full=D-alanine--D-alanine ligase;       
  148::428     2e-33  36%  428 aa  DDL_BIFLO RecName: Full=D-alanine--D-alanine ligase;       
   25::315     2e-33  33%  321 aa  DDL_RICRS RecName: Full=D-alanine--D-alanine ligase;       
   25::315     2e-33  33%  321 aa  DDL_RICRO RecName: Full=D-alanine--D-alanine ligase;       
    5::351     2e-33  34%  377 aa  DDL_OENOB RecName: Full=D-alanine--D-alanine ligase;       
    4::300     2e-33  31%  304 aa  DDL_MARMM RecName: Full=D-alanine--D-alanine ligase;       
  115::395     2e-33  36%  395 aa  DDL_BIFLD RecName: Full=D-alanine--D-alanine ligase;       
    9::357     2e-33  32%  373 aa  DDLA_XANCP RecName: Full=D-alanine--D-alanine ligase A;       
    7::362     3e-33  31%  369 aa  DDL_MYCPA RecName: Full=D-alanine--D-alanine ligase;       
    7::362     3e-33  31%  369 aa  DDL_MYCA1 RecName: Full=D-alanine--D-alanine ligase;       
    5::336     3e-33  33%  354 aa  DDL_BLOFL RecName: Full=D-alanine--D-alanine ligase;       
   37::332     4e-33  32%  332 aa  DDL_PSYWF RecName: Full=D-alanine--D-alanine ligase;       
    6::302     4e-33  32%  308 aa  DDL_OCHA4 RecName: Full=D-alanine--D-alanine ligase;       
   11::301     7e-33  33%  307 aa  DDL_RHOS4 RecName: Full=D-alanine--D-alanine ligase;       
   11::301     7e-33  33%  307 aa  DDL_RHOS1 RecName: Full=D-alanine--D-alanine ligase;       
    7::354     7e-33  34%  361 aa  DDL_BORBZ RecName: Full=D-alanine--D-alanine ligase;       
    8::344     9e-33  33%  365 aa  DDL_BORHD RecName: Full=D-alanine--D-alanine ligase;       
    7::354     9e-33  36%  361 aa  DDL_BORAP RecName: Full=D-alanine--D-alanine ligase;       
    4::353     9e-33  34%  361 aa  DDL_BACLD RecName: Full=D-alanine--D-alanine ligase;       
    7::333     1e-32  32%  347 aa  DDL_STRR6 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     1e-32  32%  348 aa  DDL_STRPD RecName: Full=D-alanine--D-alanine ligase;       
    7::333     1e-32  32%  347 aa  DDL_STRP2 RecName: Full=D-alanine--D-alanine ligase;       
  123::362     1e-32  36%  383 aa  DDL_FRASC RecName: Full=D-alanine--D-alanine ligase;       
   12::312     1e-32  28%  334 aa  DDL_ANAMM RecName: Full=D-alanine--D-alanine ligase;       
   12::312     1e-32  28%  334 aa  DDL_ANAMF RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRPZ RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRPM RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRPG RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRPC RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRPB RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRP8 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRP6 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRP3 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  32%  348 aa  DDL_STRP1 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  31%  348 aa  DDL_STRA5 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  31%  348 aa  DDL_STRA3 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-32  31%  348 aa  DDL_STRA1 RecName: Full=D-alanine--D-alanine ligase;       
    6::332     2e-32  32%  356 aa  DDL_STAS1 RecName: Full=D-alanine--D-alanine ligase;       
   23::313     2e-32  36%  319 aa  DDL_ROSDO RecName: Full=D-alanine--D-alanine ligase;       
    8::333     3e-32  32%  348 aa  DDL_STRPF RecName: Full=D-alanine--D-alanine ligase;       
   10::352     3e-32  37%  366 aa  DDL_SODGM RecName: Full=D-alanine--D-alanine ligase;       
    5::349     3e-32  34%  377 aa  DDL_LEUME RecName: Full=D-alanine--D-alanine ligase;       
    7::343     3e-32  34%  364 aa  DDL_BORRA RecName: Full=D-alanine--D-alanine ligase;       
   17::360     3e-32  33%  376 aa  DDLB_BRAJA RecName: Full=D-alanine--D-alanine ligase B;       
    7::333     3e-32  32%  347 aa  DDL_STRPS RecName: Full=D-alanine--D-alanine ligase;       
   24::314     3e-32  32%  320 aa  DDL_RICAH RecName: Full=D-alanine--D-alanine ligase;       
    9::353     3e-32  32%  355 aa  DDL_PROM9 RecName: Full=D-alanine--D-alanine ligase;       
    7::343     3e-32  34%  364 aa  DDL_BORDL RecName: Full=D-alanine--D-alanine ligase;       
    4::348     4e-32  34%  351 aa  DDL_CYAP8 RecName: Full=D-alanine--D-alanine ligase;       
    7::333     7e-32  31%  347 aa  DDL_STRZJ RecName: Full=D-alanine--D-alanine ligase;       
    7::333     7e-32  31%  347 aa  DDL_STRPN RecName: Full=D-alanine--D-alanine ligase;       
    7::333     7e-32  31%  347 aa  DDL_STRPJ RecName: Full=D-alanine--D-alanine ligase;       
    8::333     7e-32  34%  348 aa  DDL_STRGC RecName: Full=D-alanine--D-alanine ligase;       
    7::333     1e-31  31%  347 aa  DDL_STRZP RecName: Full=D-alanine--D-alanine ligase;       
    7::333     1e-31  31%  347 aa  DDL_STRP4 RecName: Full=D-alanine--D-alanine ligase;       
   25::317     1e-31  32%  323 aa  DDL_RICPU RecName: Full=D-alanine--D-alanine ligase;       
    1::290     1e-31  31%  298 aa  DDL_PETMO RecName: Full=D-alanine--D-alanine ligase;       
   16::363     1e-31  30%  365 aa  DDL_CORDI RecName: Full=D-alanine--D-alanine ligase;       
    5::378     1e-31  36%  378 aa  DDL_BIFAA RecName: Full=D-alanine--D-alanine ligase;       
    1::318     1e-31  34%  319 aa  DDL_THET8 RecName: Full=D-alanine--D-alanine ligase;       
    8::335     1e-31  33%  349 aa  DDL_LACLM RecName: Full=D-alanine--D-alanine ligase;       
    7::333     2e-31  31%  347 aa  DDL_STRZT RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-31  35%  348 aa  DDL_STRSV RecName: Full=D-alanine--D-alanine ligase;       
    5::349     2e-31  34%  377 aa  DDL_LEUMM RecName: Full=D-alanine--D-alanine ligase;       
    8::335     2e-31  33%  349 aa  DDL_LACLS RecName: Full=D-alanine--D-alanine ligase;       
    9::308     2e-31  32%  310 aa  DDL_DICNV RecName: Full=D-alanine--D-alanine ligase;       
    8::351     2e-31  34%  351 aa  DDL_PROMA RecName: Full=D-alanine--D-alanine ligase;       
    7::333     3e-31  31%  347 aa  DDL_STRPI RecName: Full=D-alanine--D-alanine ligase;       
    2::366     4e-31  36%  389 aa  DDL_THETN RecName: Full=D-alanine--D-alanine ligase;       
    8::339     4e-31  34%  356 aa  DDL_STAHJ RecName: Full=D-alanine--D-alanine ligase;       
    8::344     4e-31  31%  365 aa  DDL_BORT9 RecName: Full=D-alanine--D-alanine ligase;       
   82::361     4e-31  33%  367 aa  DDL_ANAVT RecName: Full=D-alanine--D-alanine ligase;       
    8::353     6e-31  33%  355 aa  DDL_PROM2 RecName: Full=D-alanine--D-alanine ligase;       
    8::335     6e-31  32%  349 aa  DDL_LACLA RecName: Full=D-alanine--D-alanine ligase;       
    6::344     6e-31  33%  362 aa  DDL_LACDB RecName: Full=D-alanine--D-alanine ligase;       
    6::344     6e-31  33%  362 aa  DDL_LACDA RecName: Full=D-alanine--D-alanine ligase;       
   18::375     6e-31  32%  382 aa  DDL_ARTS2 RecName: Full=D-alanine--D-alanine ligase;       
    8::334     1e-30  34%  349 aa  DDL_STRMU RecName: Full=D-alanine--D-alanine ligase;       
   10::310     1e-30  34%  316 aa  DDL_JANSC RecName: Full=D-alanine--D-alanine ligase;       
    3::297     1e-30  32%  301 aa  DDL_ACICJ RecName: Full=D-alanine--D-alanine ligase;       
    3::338     2e-30  33%  354 aa  DDL_BACSU RecName: Full=D-alanine--D-alanine ligase;       
    9::364     3e-30  31%  371 aa  DDL_MYCSS RecName: Full=D-alanine--D-alanine ligase;       
    9::364     3e-30  31%  371 aa  DDL_MYCSK RecName: Full=D-alanine--D-alanine ligase;       
    9::364     3e-30  31%  371 aa  DDL_MYCSJ RecName: Full=D-alanine--D-alanine ligase;       
  448::782     4e-30  32%  803 aa  MUDD_CHLTR RecName: Full=Bifunctional enzyme murC/ddl;Includes:
  452::784     4e-30  34%  811 aa  MUDD_CHLCV RecName: Full=Bifunctional enzyme murC/ddl;Includes:
    1::346     4e-30  34%  358 aa  DDL_ENTHR RecName: Full=D-alanine--D-alanine ligase;       
   91::344     4e-30  33%  352 aa  DDLA_PSEPK RecName: Full=D-alanine--D-alanine ligase A;       
   19::377     5e-30  31%  383 aa  DDL_KOCRD RecName: Full=D-alanine--D-alanine ligase;       
    9::353     7e-30  30%  355 aa  DDL_PROM0 RecName: Full=D-alanine--D-alanine ligase;       
   97::343     7e-30  35%  364 aa  DDL_CHLTE RecName: Full=D-alanine--D-alanine ligase;       
   18::375     9e-30  31%  382 aa  DDL_ARTCA RecName: Full=D-alanine--D-alanine ligase;       
   93::338     1e-29  32%  347 aa  DDL_TROWT RecName: Full=D-alanine--D-alanine ligase;       
   93::338     1e-29  32%  347 aa  DDL_TROW8 RecName: Full=D-alanine--D-alanine ligase;       
    4::361     1e-29  35%  366 aa  DDL_NOSP7 RecName: Full=D-alanine--D-alanine ligase;       
    7::354     1e-29  33%  361 aa  DDL_BORGA RecName: Full=D-alanine--D-alanine ligase;       
    7::300     2e-29  34%  306 aa  DDL_HYPNA RecName: Full=D-alanine--D-alanine ligase;       
   12::302     2e-29  35%  308 aa  DDL_DINSH RecName: Full=D-alanine--D-alanine ligase;       
    5::343     2e-29  34%  350 aa  DDL_WIGBR RecName: Full=D-alanine--D-alanine ligase;       
    8::348     2e-29  32%  350 aa  DDL_SYNS9 RecName: Full=D-alanine--D-alanine ligase;       
    5::348     2e-29  33%  353 aa  DDL_SYNP2 RecName: Full=D-alanine--D-alanine ligase;       
  116::377     3e-29  28%  384 aa  DDL_MYCLE RecName: Full=D-alanine--D-alanine ligase;       
    6::354     3e-29  32%  366 aa  DDL_HELMI RecName: Full=D-alanine--D-alanine ligase;       
   13::309     3e-29  31%  315 aa  DDLB_BRUME RecName: Full=D-alanine--D-alanine ligase B;       
    6::348     4e-29  31%  353 aa  DDL_SYNS3 RecName: Full=D-alanine--D-alanine ligase;       
    6::349     4e-29  33%  377 aa  DDL_LEUCK RecName: Full=D-alanine--D-alanine ligase;       
   96::346     6e-29  33%  396 aa  DDL_TREPS RecName: Full=D-alanine--D-alanine ligase;       
   96::346     6e-29  33%  396 aa  DDL_TREPA RecName: Full=D-alanine--D-alanine ligase;       
    3::338     6e-29  33%  354 aa  DDL_BACA2 RecName: Full=D-alanine--D-alanine ligase;       
    6::302     8e-29  31%  308 aa  DDLB_BRUSU RecName: Full=D-alanine--D-alanine ligase B;       
   79::358     1e-28  33%  364 aa  DDL_ANASP RecName: Full=D-alanine--D-alanine ligase;       
    1::345     2e-28  31%  354 aa  DDL_SYNY3 RecName: Full=D-alanine--D-alanine ligase;       
    4::346     2e-28  32%  352 aa  DDL_ACAM1 RecName: Full=D-alanine--D-alanine ligase;       
    9::353     3e-28  32%  355 aa  DDL_PROMS RecName: Full=D-alanine--D-alanine ligase;       
  452::787     4e-28  32%  809 aa  MUDD_CHLPN RecName: Full=Bifunctional enzyme murC/ddl;Includes:
   14::310     6e-28  32%  322 aa  DDL_CAUSK RecName: Full=D-alanine--D-alanine ligase;       
    6::353     8e-28  32%  353 aa  DDL_SYNPW RecName: Full=D-alanine--D-alanine ligase;       
    9::352     8e-28  31%  355 aa  DDL_PROMP RecName: Full=D-alanine--D-alanine ligase;       
   57::300     4e-27  32%  306 aa  DDL_BARQU RecName: Full=D-alanine--D-alanine ligase;       
    9::353     7e-27  31%  355 aa  DDL_PROM5 RecName: Full=D-alanine--D-alanine ligase;       
    8::348     7e-27  31%  353 aa  DDL_PROM3 RecName: Full=D-alanine--D-alanine ligase;       
    8::348     1e-26  30%  353 aa  DDL_PROMM RecName: Full=D-alanine--D-alanine ligase;       
   64::308     1e-26  35%  316 aa  DDL_ENTGA RecName: Full=D-alanine--D-alanine ligase;       
    1::344     1e-26  33%  348 aa  DDL_ENTFA RecName: Full=D-alanine--D-alanine ligase;       
    8::346     2e-26  31%  350 aa  DDL_SYNSC RecName: Full=D-alanine--D-alanine ligase;       
    6::340     2e-26  34%  367 aa  DDL_BRASO RecName: Full=D-alanine--D-alanine ligase;       
    7::347     2e-26  32%  367 aa  DDL_BRASB RecName: Full=D-alanine--D-alanine ligase;       
    9::342     3e-26  29%  345 aa  DDL_SYNR3 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     1e-25  30%  348 aa  DDL_STREM RecName: Full=D-alanine--D-alanine ligase;       
    8::333     1e-25  31%  348 aa  DDL_STRE4 RecName: Full=D-alanine--D-alanine ligase;       
    7::329     2e-25  32%  329 aa  DDL_VIBHB RecName: Full=D-alanine--D-alanine ligase;       
    8::333     4e-25  30%  348 aa  DDL_STRS7 RecName: Full=D-alanine--D-alanine ligase;       
    7::328     5e-25  33%  329 aa  DDL_VIBPA RecName: Full=D-alanine--D-alanine ligase;       
    5::346     9e-25  31%  347 aa  DDL_SYNP6 RecName: Full=D-alanine--D-alanine ligase;       
    5::346     9e-25  31%  347 aa  DDL_SYNE7 RecName: Full=D-alanine--D-alanine ligase;       
   16::312     9e-25  29%  324 aa  DDL_CAUCR RecName: Full=D-alanine--D-alanine ligase;       
   78::333     1e-24  27%  333 aa  DDL_SHEHH RecName: Full=D-alanine--D-alanine ligase;       
   70::330     4e-24  30%  330 aa  DDL_TOLAT RecName: Full=D-alanine--D-alanine ligase;       
    8::351     4e-24  29%  353 aa  DDL_SYNPX RecName: Full=D-alanine--D-alanine ligase;       
  447::781     7e-24  31%  802 aa  MUDD_CHLMU RecName: Full=Bifunctional enzyme murC/ddl;Includes:
    5::337     7e-24  32%  382 aa  DDL_METS4 RecName: Full=D-alanine--D-alanine ligase;       
   78::340     1e-23  31%  343 aa  DDL_THEEB RecName: Full=D-alanine--D-alanine ligase;       
    8::330     4e-23  29%  334 aa  DDL_VIBCM RecName: Full=D-alanine--D-alanine ligase;       
    8::330     4e-23  29%  334 aa  DDL_VIBCH RecName: Full=D-alanine--D-alanine ligase;       
   66::331     5e-23  32%  331 aa  DDL_VIBVY RecName: Full=D-alanine--D-alanine ligase;       
    8::322     6e-23  30%  329 aa  DDL_VIBC3 RecName: Full=D-alanine--D-alanine ligase;       
   66::331     8e-23  32%  331 aa  DDL_VIBVU RecName: Full=D-alanine--D-alanine ligase;       
    8::330     1e-22  30%  331 aa  DDL_VIBSL RecName: Full=D-alanine--D-alanine ligase;       
   78::324     1e-22  27%  332 aa  DDL_SHEPW RecName: Full=D-alanine--D-alanine ligase;       
    8::333     3e-22  28%  336 aa  DDL_SHESA RecName: Full=D-alanine--D-alanine ligase;       
   74::330     2e-21  31%  330 aa  DDL_VIBFM RecName: Full=D-alanine--D-alanine ligase;       
   74::330     3e-21  30%  330 aa  DDL_VIBF1 RecName: Full=D-alanine--D-alanine ligase;       
    1::310     3e-21  30%  346 aa  DDL_SULNB RecName: Full=D-alanine--D-alanine ligase;       
    8::333     3e-21  28%  336 aa  DDL_SHESM RecName: Full=D-alanine--D-alanine ligase;       
   69::332     5e-21  27%  333 aa  DDL_SHESH RecName: Full=D-alanine--D-alanine ligase;       
    1::307     5e-21  32%  342 aa  DDL_NITSB RecName: Full=D-alanine--D-alanine ligase;       
    8::329     5e-21  26%  329 aa  DDL_AERHH RecName: Full=D-alanine--D-alanine ligase;       
   78::333     6e-21  27%  334 aa  DDL_SHEPA RecName: Full=D-alanine--D-alanine ligase;       
    8::333     8e-21  27%  336 aa  DDL_SHESR RecName: Full=D-alanine--D-alanine ligase;       
    4::327     8e-21  27%  329 aa  DDL_AERS4 RecName: Full=D-alanine--D-alanine ligase;       
    8::329     1e-20  28%  336 aa  DDL_SHEFN RecName: Full=D-alanine--D-alanine ligase;       
   78::332     1e-20  27%  335 aa  DDL_SHEWM RecName: Full=D-alanine--D-alanine ligase;       
    1::332     1e-20  30%  346 aa  DDL_CAMJ8 RecName: Full=D-alanine--D-alanine ligase;       
    3::333     3e-20  27%  335 aa  DDL_SHEDO RecName: Full=D-alanine--D-alanine ligase;       
    8::333     4e-20  27%  337 aa  DDL_SHESW RecName: Full=D-alanine--D-alanine ligase;       
    8::333     4e-20  27%  337 aa  DDL_SHEPC RecName: Full=D-alanine--D-alanine ligase;       
    8::333     8e-20  26%  337 aa  DDL_SHEB9 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     1e-19  26%  337 aa  DDL_SHEB2 RecName: Full=D-alanine--D-alanine ligase;       
    8::333     1e-19  27%  336 aa  DDL_SHEON RecName: Full=D-alanine--D-alanine ligase;       
    8::333     2e-19  26%  337 aa  DDL_SHEB8 RecName: Full=D-alanine--D-alanine ligase;       
    1::332     2e-19  29%  346 aa  DDL_CAMJD RecName: Full=D-alanine--D-alanine ligase;       
    1::332     2e-19  29%  346 aa  DDL_CAMJE RecName: Full=D-alanine--D-alanine ligase;       
   13::200     2e-19  27%  205 aa  DDL_ANACE RecName: Full=D-alanine--D-alanine ligase;       
    1::332     4e-19  28%  346 aa  DDL_CAMJR RecName: Full=D-alanine--D-alanine ligase;       
    1::332     4e-19  28%  346 aa  DDL_CAMJJ RecName: Full=D-alanine--D-alanine ligase;       
    1::313     7e-19  30%  347 aa  DDL_HELPH RecName: Full=D-alanine--D-alanine ligase;       
    1::334     2e-18  28%  345 aa  DDL_SULDN RecName: Full=D-alanine--D-alanine ligase;       
   88::315     2e-18  28%  346 aa  DDL_CAMC1 RecName: Full=D-alanine--D-alanine ligase;       
   94::323     3e-18  27%  336 aa  Y4SG_RHISN RecName: Full=Uncharacterized protein y4sG;
   78::334     3e-18  27%  336 aa  DDL_SHEAM RecName: Full=D-alanine--D-alanine ligase;       
   78::328     4e-18  25%  334 aa  DDL_SHELP RecName: Full=D-alanine--D-alanine ligase;       
    1::313     4e-18  30%  347 aa  DDL_HELPJ RecName: Full=D-alanine--D-alanine ligase;       
    1::313     1e-17  29%  347 aa  DDL_HELPS RecName: Full=D-alanine--D-alanine ligase;       
   84::313     1e-17  27%  347 aa  DDL_HELP2 RecName: Full=D-alanine--D-alanine ligase;       
    6::316     7e-17  31%  350 aa  DDL_HELAH RecName: Full=D-alanine--D-alanine ligase;       
    1::309     2e-16  30%  345 aa  DDL_WOLSU RecName: Full=D-alanine--D-alanine ligase;       
    1::314     1e-14  28%  350 aa  DDL_HELHP RecName: Full=D-alanine--D-alanine ligase;       
   77::332     3e-13  27%  346 aa  DDL_CAMLR RecName: Full=D-alanine--D-alanine ligase;       
    1::313     4e-12  28%  347 aa  DDL_HELPY RecName: Full=D-alanine--D-alanine ligase;       
  135::287     2e-11  32%  301 aa  RIMK_VIBF1 RecName: Full=Ribosomal protein S6 modification protein;
  135::287     2e-11  32%  301 aa  RIMK_ALISL RecName: Full=Ribosomal protein S6 modification protein;
  135::287     7e-11  31%  301 aa  RIMK_VIBFM RecName: Full=Ribosomal protein S6 modification protein;
  135::267     7e-11  33%  301 aa  RIMK2_SHESR RecName: Full=Ribosomal protein S6 modification protein
   99::267     7e-11  28%  301 aa  RIMK2_PSEA6 RecName: Full=Ribosomal protein S6 modification protein
  135::267     7e-11  33%  301 aa  RIMK1_SHESM RecName: Full=Ribosomal protein S6 modification protein
  135::288     1e-10  31%  298 aa  RIMK_AERHH RecName: Full=Ribosomal protein S6 modification protein;
   99::293     2e-10  29%  301 aa  RIMK_VIBPA RecName: Full=Ribosomal protein S6 modification protein;
  135::267     2e-10  30%  301 aa  RIMK_MARMS RecName: Full=Ribosomal protein S6 modification protein;
  135::288     2e-10  31%  298 aa  RIMK_AERS4 RecName: Full=Ribosomal protein S6 modification protein;
  645::846     2e-10  28% 1099 aa  CARB_THENN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  135::287     3e-10  30%  301 aa  RIMK_VIBCM RecName: Full=Ribosomal protein S6 modification protein;
  135::287     3e-10  30%  301 aa  RIMK_VIBCH RecName: Full=Ribosomal protein S6 modification protein;
  135::287     3e-10  30%  301 aa  RIMK_VIBC3 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-10  32%  301 aa  RIMK1_SHEON RecName: Full=Ribosomal protein S6 modification protein
  135::267     4e-10  32%  301 aa  RIMK1_SHESA RecName: Full=Ribosomal protein S6 modification protein
   84::267     5e-10  29%  301 aa  RIMK_NITOC RecName: Full=Ribosomal protein S6 modification protein;
  135::267     5e-10  32%  301 aa  RIMK2_SHEPC RecName: Full=Ribosomal protein S6 modification protein
  135::267     5e-10  32%  301 aa  RIMK1_SHESW RecName: Full=Ribosomal protein S6 modification protein
   99::293     6e-10  28%  301 aa  RIMK_VIBVY RecName: Full=Ribosomal protein S6 modification protein;
   99::293     6e-10  28%  301 aa  RIMK_VIBVU RecName: Full=Ribosomal protein S6 modification protein;
  135::267     6e-10  31%  301 aa  RIMK2_SHEB9 RecName: Full=Ribosomal protein S6 modification protein
  135::267     6e-10  31%  301 aa  RIMK2_SHEB8 RecName: Full=Ribosomal protein S6 modification protein
  135::267     6e-10  31%  301 aa  RIMK1_SHEB5 RecName: Full=Ribosomal protein S6 modification protein
   84::267     1e-09  27%  301 aa  RIMK_THISH RecName: Full=Ribosomal protein S6 modification protein;
   99::287     1e-09  28%  301 aa  RIMK_SACD2 RecName: Full=Ribosomal protein S6 modification protein;
   99::293     1e-09  28%  301 aa  RIMK_SHELP RecName: Full=Ribosomal protein S6 modification protein;
   99::287     1e-09  28%  302 aa  RIMK_PSYIN RecName: Full=Ribosomal protein S6 modification protein;
   84::287     1e-09  28%  301 aa  RIMK_PSEU5 RecName: Full=Ribosomal protein S6 modification protein;
  135::287     1e-09  29%  302 aa  RIMK_ALCBS RecName: Full=Ribosomal protein S6 modification protein;
  655::846     1e-09  30% 1099 aa  CARB_THEP1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  135::267     2e-09  32%  301 aa  RIMK_METBU RecName: Full=Ribosomal protein S6 modification protein;
  666::851     2e-09  25% 1057 aa  CARB_PEDPA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  652::848     2e-09  30% 1065 aa  CARB_CLOAB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  297::429     3e-09  29%  466 aa  RIMK_SYNPX RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-09  33%  301 aa  RIMK_SYNP2 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-09  30%  300 aa  RIMK_ESCF3 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-09  32%  301 aa  RIMK2_SHEAM RecName: Full=Ribosomal protein S6 modification protein
  135::287     4e-09  29%  301 aa  RIMK_PSEHT RecName: Full=Ribosomal protein S6 modification protein;
  135::267     4e-09  34%  301 aa  RIMK_MARMM RecName: Full=Ribosomal protein S6 modification protein;
   99::267     5e-09  27%  301 aa  RIMK_TERTT RecName: Full=Ribosomal protein S6 modification protein;
   84::267     5e-09  28%  300 aa  RIMK_SHIBS RecName: Full=Ribosomal protein S6 modification protein;
  135::287     5e-09  28%  301 aa  RIMK_MARAV RecName: Full=Ribosomal protein S6 modification protein;
  135::287     5e-09  29%  301 aa  RIMK_COXBU RecName: Full=Ribosomal protein S6 modification protein;
  135::287     5e-09  29%  301 aa  RIMK_COXBR RecName: Full=Ribosomal protein S6 modification protein;
  135::287     5e-09  29%  301 aa  RIMK_COXBN RecName: Full=Ribosomal protein S6 modification protein;
  135::287     5e-09  29%  301 aa  RIMK_COXB2 RecName: Full=Ribosomal protein S6 modification protein;
  135::287     5e-09  29%  301 aa  RIMK_COXB1 RecName: Full=Ribosomal protein S6 modification protein;
  135::287     5e-09  29%  299 aa  RIMK2_SHEON RecName: Full=Ribosomal protein S6 modification protein
   84::281     7e-09  29%  301 aa  RIMK_PSEF5 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     7e-09  29%  303 aa  RIMK_PECCP RecName: Full=Ribosomal protein S6 modification protein;
  135::267     7e-09  29%  300 aa  RIMK_ENT38 RecName: Full=Ribosomal protein S6 modification protein;
  135::287     7e-09  28%  301 aa  RIMK_AZOVD RecName: Full=Ribosomal protein S6 modification protein;
  135::287     7e-09  28%  299 aa  RIMK2_SHESM RecName: Full=Ribosomal protein S6 modification protein
  135::287     7e-09  28%  299 aa  RIMK2_SHESA RecName: Full=Ribosomal protein S6 modification protein
  135::267     7e-09  29%  298 aa  RIMK2_SHEFN RecName: Full=Ribosomal protein S6 modification protein
  135::287     7e-09  28%  299 aa  RIMK1_SHESR RecName: Full=Ribosomal protein S6 modification protein
  135::267     9e-09  29%  300 aa  RIMK_SHISS RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_SHIDS RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_SHIB3 RecName: Full=Ribosomal protein S6 modification protein;
  135::281     9e-09  30%  301 aa  RIMK_PSEFS RecName: Full=Ribosomal protein S6 modification protein;
   53::267     9e-09  31%  301 aa  RIMK_ERYLH RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOUT RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOSE RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOLU RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOLI RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOLC RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOL6 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOL5 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOK1 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOHS RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECODH RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECOBW RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECO8A RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECO81 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECO5E RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECO57 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECO55 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECO45 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     9e-09  29%  300 aa  RIMK_ECO27 RecName: Full=Ribosomal protein S6 modification protein;
  135::287     9e-09  28%  301 aa  RIMK2_SHEB5 RecName: Full=Ribosomal protein S6 modification protein
  135::287     9e-09  28%  301 aa  RIMK1_SHEB9 RecName: Full=Ribosomal protein S6 modification protein
  135::287     9e-09  28%  301 aa  RIMK1_SHEB8 RecName: Full=Ribosomal protein S6 modification protein
   84::267     1e-08  28%  301 aa  RIMK_PSEU2 RecName: Full=Ribosomal protein S6 modification protein;
   84::267     1e-08  28%  301 aa  RIMK_PSESM RecName: Full=Ribosomal protein S6 modification protein;
   84::267     1e-08  28%  301 aa  RIMK_PSE14 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     1e-08  29%  301 aa  RIMK_IDILO RecName: Full=Ribosomal protein S6 modification protein;
  135::267     1e-08  29%  295 aa  RIMK1_SHEDO RecName: Full=Ribosomal protein S6 modification protein
  135::281     2e-08  30%  301 aa  RIMK_PSEPF RecName: Full=Ribosomal protein S6 modification protein;
  135::287     2e-08  28%  302 aa  RIMK_HALHL RecName: Full=Ribosomal protein S6 modification protein;
  135::267     2e-08  29%  300 aa  RIMK_ECO24 RecName: Full=Ribosomal protein S6 modification protein;
   99::267     2e-08  27%  301 aa  RIMK_ALTMD RecName: Full=Ribosomal protein S6 modification protein;
  135::267     2e-08  28%  301 aa  RIMK2_SHESW RecName: Full=Ribosomal protein S6 modification protein
  135::291     2e-08  30%  301 aa  RIMK2_SHEDO RecName: Full=Ribosomal protein S6 modification protein
  135::267     2e-08  28%  301 aa  RIMK1_SHEPC RecName: Full=Ribosomal protein S6 modification protein
   99::267     2e-08  25%  301 aa  RIMK_VIBSL RecName: Full=Ribosomal protein S6 modification protein;
  135::287     2e-08  28%  301 aa  RIMK1_SHEAM RecName: Full=Ribosomal protein S6 modification protein
   84::267     3e-08  27%  301 aa  RIMK_PSEE4 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-08  32%  301 aa  RIMK_PELCD RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-08  30%  300 aa  RIMK_KLEP3 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-08  28%  303 aa  RIMK_ERWCT RecName: Full=Ribosomal protein S6 modification protein;
  135::291     3e-08  30%  301 aa  RIMK1_SHEFN RecName: Full=Ribosomal protein S6 modification protein
  698::853     3e-08  29% 1058 aa  CARB_STRPZ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     3e-08  29% 1058 aa  CARB_STRPG RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     3e-08  29% 1058 aa  CARB_STRP8 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     3e-08  29% 1058 aa  CARB_STRP6 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     3e-08  29% 1058 aa  CARB_STRP1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  135::267     3e-08  27%  300 aa  RIMK_SHIFL RecName: Full=Ribosomal protein S6 modification protein;
   84::267     3e-08  27%  301 aa  RIMK_PSEPW RecName: Full=Ribosomal protein S6 modification protein;
   84::267     3e-08  27%  301 aa  RIMK_PSEPK RecName: Full=Ribosomal protein S6 modification protein;
   84::267     3e-08  27%  301 aa  RIMK_PSEPG RecName: Full=Ribosomal protein S6 modification protein;
   84::267     3e-08  27%  301 aa  RIMK_PSEP1 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-08  29%  300 aa  RIMK_ECOSM RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-08  29%  300 aa  RIMK_ECO7I RecName: Full=Ribosomal protein S6 modification protein;
  135::267     4e-08  28%  300 aa  RIMK_CITK8 RecName: Full=Ribosomal protein S6 modification protein;
   99::267     4e-08  29%  302 aa  RIMK1_PSEA6 RecName: Full=Ribosomal protein S6 modification protein
  135::287     4e-08  28%  303 aa  RIMK1_HAHCH RecName: Full=Ribosomal protein S6 modification protein
   84::267     6e-08  26%  301 aa  RIMK_THICR RecName: Full=Ribosomal protein S6 modification protein;
  135::267     6e-08  28%  301 aa  RIMK_PSEMY RecName: Full=Ribosomal protein S6 modification protein;
  135::267     6e-08  28%  302 aa  RIMK_CHRSD RecName: Full=Ribosomal protein S6 modification protein;
  135::267     7e-08  27%  300 aa  RIMK_SHIF8 RecName: Full=Ribosomal protein S6 modification protein;
  135::287     7e-08  32%  301 aa  RIMK_PSEAE RecName: Full=Ribosomal protein S6 modification protein;
  135::287     7e-08  32%  301 aa  RIMK_PSEAB RecName: Full=Ribosomal protein S6 modification protein;
  135::287     7e-08  32%  301 aa  RIMK_PSEA8 RecName: Full=Ribosomal protein S6 modification protein;
  135::287     7e-08  32%  301 aa  RIMK_PSEA7 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     7e-08  28%  301 aa  RIMK_PHOPR RecName: Full=Ribosomal protein S6 modification protein;
  210::345     1e-07  30%  874 aa  CPHA_SYNY8 RecName: Full=Cyanophycin synthetase;       
  698::853     1e-07  29% 1058 aa  CARB_STRP3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  135::267     1e-07  27%  299 aa  RIMK_TRIEI RecName: Full=Ribosomal protein S6 modification protein;
  139::408     1e-07  26%  618 aa  CARB2_METJA RecName: Full=Carbamoyl-phosphate synthase large chain,
   83::300     2e-07  25%  400 aa  PUR2_THEMA RecName: Full=Phosphoribosylamine--glycine ligase;      
  698::853     2e-07  26% 1056 aa  CARB_LACRJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     2e-07  26% 1056 aa  CARB_LACRD RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     2e-07  30% 1062 aa  CARB_LACH4 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     2e-07  30% 1062 aa  CARB_LACDB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  663::871     2e-07  24% 1102 aa  CARB_ACIBL RecName: Full=Carbamoyl-phosphate synthase large chain; 
  135::267     2e-07  27%  301 aa  RIMK_DESAD RecName: Full=Ribosomal protein S6 modification protein;
  622::859     2e-07  23% 1051 aa  CARB_SULIM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  622::859     2e-07  23% 1051 aa  CARB_SULIK RecName: Full=Carbamoyl-phosphate synthase large chain; 
  622::859     2e-07  23% 1051 aa  CARB_SULIA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  666::851     2e-07  27% 1059 aa  CARB_STRMU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::874     2e-07  27% 1059 aa  CARB_LEUCK RecName: Full=Carbamoyl-phosphate synthase large chain; 
   59::312     2e-07  24%  482 aa  CARB1_METJA RecName: Full=Carbamoyl-phosphate synthase large chain,
  135::267     3e-07  29%  300 aa  RIMK_SALTY RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALTI RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALSV RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALPK RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALPC RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALPB RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALPA RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALNS RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALHS RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALG2 RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALEP RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALDC RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALCH RecName: Full=Ribosomal protein S6 modification protein;
  135::267     3e-07  29%  300 aa  RIMK_SALA4 RecName: Full=Ribosomal protein S6 modification protein;
   91::257     3e-07  33%  417 aa  PUR2_ZYMMO RecName: Full=Phosphoribosylamine--glycine ligase;      
  622::859     3e-07  23% 1051 aa  CARB_SULIY RecName: Full=Carbamoyl-phosphate synthase large chain; 
  622::859     3e-07  23% 1051 aa  CARB_SULIN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  622::859     3e-07  23% 1051 aa  CARB_SULIL RecName: Full=Carbamoyl-phosphate synthase large chain; 
  655::846     4e-07  28% 1099 aa  CARB_THESQ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  655::846     4e-07  28% 1099 aa  CARB_THEMA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::859     5e-07  28% 1059 aa  CARB_STRTD RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::859     5e-07  28% 1059 aa  CARB_STRT2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::859     5e-07  28% 1059 aa  CARB_STRT1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::856     5e-07  27% 1071 aa  CARB_NEIMA RecName: Full=Carbamoyl-phosphate synthase large chain; 
   43::315     6e-07  23% 1060 aa  CARB_STRA5 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   43::315     6e-07  23% 1060 aa  CARB_STRA3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   43::315     6e-07  23% 1060 aa  CARB_STRA1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::856     6e-07  27% 1071 aa  CARB_NEIMB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     6e-07  29% 1060 aa  CARB_ENTFA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  623::837     8e-07  25% 1052 aa  CARB_SULAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  699::853     8e-07  28% 1071 aa  CARB_BACSU RecName: Full=Carbamoyl-phosphate synthase
  700::868     1e-06  26% 1058 aa  CARB_STRZT RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRR6 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRPS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRPN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRPJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRPI RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRP4 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRP2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::865     1e-06  24% 1059 aa  CARB_LEUMM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRZP RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRZJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::868     1e-06  26% 1058 aa  CARB_STRP7 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     1e-06  25% 1061 aa  CARB_LACS1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   99::247     2e-06  29%  387 aa  PURT_PROMT RecName: Full=Phosphoribosylglycinamide
  119::240     2e-06  30%  737 aa  MCCA_ORYSJ RecName: Full=Methylcrotonoyl-CoA carboxylase subunit
  207::346     2e-06  29%  873 aa  CPHA_SYNY3 RecName: Full=Cyanophycin synthetase;       
  210::320     2e-06  31%  872 aa  CPHA_CYAA5 RecName: Full=Cyanophycin synthetase;       
  700::866     2e-06  29% 1058 aa  CARB_STRU0 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  685::841     2e-06  28% 1053 aa  CARB_METB6 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::212     2e-06  28% 1072 aa  CARB_BACCN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  100::198     2e-06  40%  392 aa  PURT_SYNSC RecName: Full=Phosphoribosylglycinamide
  625::848     2e-06  21% 1030 aa  CARY_BACSU RecName: Full=Carbamoyl-phosphate synthase
  622::859     2e-06  24% 1051 aa  CARB_SULSO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  100::198     3e-06  33%  393 aa  PURT_PROMA RecName: Full=Phosphoribosylglycinamide
  509::659     3e-06  27%  778 aa  GSHAB_CLOPE RecName: Full=Glutathione biosynthesis bifunctional
  700::865     3e-06  26% 1058 aa  CARB_STRS7 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  608::848     3e-06  26% 1083 aa  CARB_PELTS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  100::198     4e-06  37%  389 aa  PURT_SYNPW RecName: Full=Phosphoribosylglycinamide
   15::204     4e-06  28%  389 aa  PURT_METJA RecName: Full=Phosphoribosylglycinamide
  612::872     4e-06  26% 1072 aa  CARB_THEP3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     4e-06  27% 1059 aa  CARB_STRSV RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     4e-06  27% 1059 aa  CARB_STRGC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  144::274     5e-06  31%  313 aa  RIMK_PASMU RecName: Full=Ribosomal protein S6 modification protein;
  612::872     5e-06  26% 1072 aa  CARB_THEPX RecName: Full=Carbamoyl-phosphate synthase large chain; 
   99::247     7e-06  28%  387 aa  PURT_PROM1 RecName: Full=Phosphoribosylglycinamide
  105::203     7e-06  34%  388 aa  PURT_METM7 RecName: Full=Phosphoribosylglycinamide
  694::843     7e-06  27% 1105 aa  CARB_THELT RecName: Full=Carbamoyl-phosphate synthase large chain; 
   43::342     7e-06  21% 1064 aa  CARB_LACLM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  105::203     9e-06  34%  388 aa  PURT_METMP RecName: Full=Phosphoribosylglycinamide
  695::846     9e-06  27% 1057 aa  CARB_STAES RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::872     9e-06  25% 1064 aa  CARB_OENOB RecName: Full=Carbamoyl-phosphate synthase large chain; 
   84::340     9e-06  26% 1062 aa  CARB_BACHD RecName: Full=Carbamoyl-phosphate synthase
   62::342     9e-06  23% 1072 aa  CARB_BACC1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::316     9e-06  24%  557 aa  CARB1_AQUAE RecName: Full=Carbamoyl-phosphate synthase large chain,
 1112::1281    1e-05  28% 2214 aa  PYR1_YEAST RecName: Full=Protein URA1;Includes:  RecName:
  122::197     1e-05  35%  390 aa  PURT_PROMP RecName: Full=Phosphoribosylglycinamide
  612::851     1e-05  28% 1072 aa  CARB_THETN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  636::858     1e-05  25% 1056 aa  CARB_PYRFU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  666::867     1e-05  25% 1070 aa  CARB_LISW6 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   43::342     1e-05  22% 1064 aa  CARB_LACLA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  647::870     1e-05  26% 1067 aa  CARB_HALOH RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     1e-05  23% 1072 aa  CARB_BACHK RecName: Full=Carbamoyl-phosphate synthase large chain; 
  107::316     1e-05  20% 1099 aa  CARB_ARTS2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  136::268     2e-05  25%  302 aa  RIMK_LEGPL RecName: Full=Ribosomal protein S6 modification protein;
  136::268     2e-05  25%  302 aa  RIMK_LEGPH RecName: Full=Ribosomal protein S6 modification protein;
  136::268     2e-05  25%  302 aa  RIMK_LEGPC RecName: Full=Ribosomal protein S6 modification protein;
  136::268     2e-05  25%  302 aa  RIMK_LEGPA RecName: Full=Ribosomal protein S6 modification protein;
  138::270     2e-05  26%  304 aa  RIMK2_HAHCH RecName: Full=Ribosomal protein S6 modification protein
  109::264     2e-05  29%  398 aa  PURT_SULAC RecName: Full=Phosphoribosylglycinamide
  117::276     2e-05  29%  389 aa  PURT_BACV8 RecName: Full=Phosphoribosylglycinamide
   85::210     2e-05  27%  802 aa  PUR2_YEAST RecName: Full=Bifunctional purine biosynthetic protein
  485::615     2e-05  28%  756 aa  GSHAB_ENTFA RecName: Full=Glutathione biosynthesis bifunctional
 1069::1169    2e-05  26% 1496 aa  CPSM_RANCA RecName: Full=Carbamoyl-phosphate synthase [ammonia],
  700::865     2e-05  26% 1058 aa  CARB_STRE4 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  723::841     2e-05  32% 1160 aa  CARB_SCHPO RecName: Full=Carbamoyl-phosphate synthase
  654::862     2e-05  23% 1075 aa  CARB_SALTY RecName: Full=Carbamoyl-phosphate synthase large chain; 
  654::862     2e-05  23% 1075 aa  CARB_SALTI RecName: Full=Carbamoyl-phosphate synthase large chain; 
  666::762     2e-05  29% 1070 aa  CARB_LISMC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::851     2e-05  27% 1060 aa  CARB_LACSS RecName: Full=Carbamoyl-phosphate synthase large chain; 
   43::342     2e-05  21% 1064 aa  CARB_LACLS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     2e-05  28% 1062 aa  CARB_LACJO RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACCZ RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACCQ RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACC7 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACC3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACC0 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACAN RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACAH RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     2e-05  23% 1072 aa  CARB_BACAA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  105::203     2e-05  33%  388 aa  PURT_METM5 RecName: Full=Phosphoribosylglycinamide
 1072::1257    2e-05  25% 1500 aa  CPSM_RAT RecName: Full=Carbamoyl-phosphate synthase [ammonia],
  210::303     2e-05  29%  901 aa  CPHA_ANAVT RecName: Full=Cyanophycin synthetase;       
  210::303     2e-05  29%  901 aa  CPHA_ANASP RecName: Full=Cyanophycin synthetase;       
  666::762     2e-05  29% 1070 aa  CARB_LISMH RecName: Full=Carbamoyl-phosphate synthase large chain; 
  666::762     2e-05  29% 1070 aa  CARB_LISMF RecName: Full=Carbamoyl-phosphate synthase large chain; 
  699::867     2e-05  26% 1070 aa  CARB_LISIN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  299::429     3e-05  26%  464 aa  RIMK_DESPS RecName: Full=Ribosomal protein S6 modification protein;
   85::201     3e-05  26%  788 aa  PUR2_YARLI RecName: Full=Bifunctional purine biosynthetic protein
   86::313     3e-05  26%  428 aa  PUR2_BACHD RecName: Full=Phosphoribosylamine--glycine ligase;      
  118::239     3e-05  31%  734 aa  MCCA_ARATH RecName: Full=Methylcrotonoyl-CoA carboxylase subunit
 1072::1257    3e-05  25% 1500 aa  CPSM_MOUSE RecName: Full=Carbamoyl-phosphate synthase [ammonia],
  700::846     3e-05  27% 1057 aa  CARB_STAEQ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAAT RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAAS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAAR RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAAN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAAM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAAE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAA9 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAA8 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAA3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAA2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-05  27% 1057 aa  CARB_STAA1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     3e-05  23% 1072 aa  CARB_BACCR RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     3e-05  23% 1072 aa  CARB_BACC4 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  107::212     3e-05  25% 1102 aa  CARB_ARTAT RecName: Full=Carbamoyl-phosphate synthase large chain; 
   57::327     3e-05  23%  537 aa  CARB2_AQUAE RecName: Full=Carbamoyl-phosphate synthase large chain,
  135::267     3e-05  30%  405 aa  RIMK_RHOBA RecName: Full=Ribosomal protein S6 modification protein;
  695::846     3e-05  29% 1057 aa  CARB_STAS1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  699::753     3e-05  36% 1070 aa  CARB_LISMO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  654::862     3e-05  23% 1073 aa  CARB_ECOLI RecName: Full=Carbamoyl-phosphate synthase large chain; 
  133::267     5e-05  31%  295 aa  RIMK_XANOR RecName: Full=Ribosomal protein S6 modification protein;
  133::267     5e-05  31%  295 aa  RIMK_XANOM RecName: Full=Ribosomal protein S6 modification protein;
  135::287     5e-05  24%  301 aa  RIMK_CELJU RecName: Full=Ribosomal protein S6 modification protein;
 1082::1261    5e-05  27% 2225 aa  PYR1_DICDI RecName: Full=Protein PYR1-3;Includes:  RecName:
   93::260     5e-05  29%  285 aa  COFF_METMP RecName: Full=Gamma-F420-2:alpha-L-glutamate ligase;    
  700::865     5e-05  26% 1057 aa  CARB_STAAW RecName: Full=Carbamoyl-phosphate synthase large chain; 
  654::862     5e-05  23% 1073 aa  CARB_SHIFL RecName: Full=Carbamoyl-phosphate synthase large chain; 
  653::861     5e-05  23% 1073 aa  CARB_PSESM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  653::854     5e-05  26% 1073 aa  CARB_PSEAE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::865     5e-05  26% 1058 aa  CARB_LACPL RecName: Full=Carbamoyl-phosphate synthase
  654::862     5e-05  23% 1073 aa  CARB_ECO57 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  107::212     5e-05  25% 1109 aa  CARB_ARTCA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  176::266     6e-05  32%  308 aa  Y815_METJA RecName: Full=Uncharacterized protein MJ0815;Flags:
  105::203     6e-05  31%  388 aa  PURT_METVS RecName: Full=Phosphoribosylglycinamide
  516::643     6e-05  33%  776 aa  GSHAB_LISW6 RecName: Full=Glutathione biosynthesis bifunctional
  695::868     6e-05  29% 1057 aa  CARB_STACT RecName: Full=Carbamoyl-phosphate synthase large chain; 
  699::963     6e-05  25% 1163 aa  CARB_RHIME RecName: Full=Carbamoyl-phosphate synthase large chain; 
  609::854     6e-05  24% 1068 aa  CARB_CLOBM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  138::274     8e-05  28%  302 aa  RIMK_HAEIG RecName: Full=Ribosomal protein S6 modification protein;
  134::270     8e-05  28%  298 aa  RIMK_HAEIE RecName: Full=Ribosomal protein S6 modification protein;
  138::274     8e-05  28%  302 aa  RIMK_HAEI8 RecName: Full=Ribosomal protein S6 modification protein;
  100::198     8e-05  33%  389 aa  PURT_SYNS3 RecName: Full=Phosphoribosylglycinamide
  653::857     8e-05  25% 1076 aa  CARB_VIBCH RecName: Full=Carbamoyl-phosphate synthase large chain; 
  623::837     8e-05  21% 1049 aa  CARB_SULTO RecName: Full=Carbamoyl-phosphate synthase large chain; 
   84::338     8e-05  23% 1057 aa  CARB_STAAB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  644::853     8e-05  22% 1059 aa  CARB_LACF3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  109::223     1e-04  30%  397 aa  PURT_SULTO RecName: Full=Phosphoribosylglycinamide
  131::293     1e-04  31%  429 aa  PURT_PYRKO RecName: Full=Phosphoribosylglycinamide
  482::603     1e-04  33%  757 aa  GSHAB_MANSM RecName: Full=Glutathione biosynthesis bifunctional
  654::862     1e-04  23% 1073 aa  CARB_ECOL6 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  609::854     1e-04  26% 1068 aa  CARB_CLOBL RecName: Full=Carbamoyl-phosphate synthase large chain; 
  664::872     1e-04  23% 1093 aa  CARB_ACIC5 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  548::636     1e-04  36%  769 aa  GSHAB_LISMO RecName: Full=Glutathione biosynthesis bifunctional
  548::636     1e-04  36%  769 aa  GSHAB_LISMF RecName: Full=Glutathione biosynthesis bifunctional
 1072::1257    1e-04  24% 1500 aa  CPSM_HUMAN RecName: Full=Carbamoyl-phosphate synthase [ammonia],
  695::846     1e-04  28% 1057 aa  CARB_STAHJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  689::933     1e-04  25% 1167 aa  CARB_RHILO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  624::870     1e-04  22% 1081 aa  CARB_RALSO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::852     1e-04  25% 1068 aa  CARB_PASMU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  684::871     1e-04  29% 1057 aa  CARB_MACCJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  624::869     1e-04  24% 1042 aa  CARB_HALSA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  131::293     2e-04  29%  429 aa  PURT_PYRAB RecName: Full=Phosphoribosylglycinamide
  128::202     2e-04  32%  402 aa  PURT_IGNH4 RecName: Full=Phosphoribosylglycinamide
  116::248     2e-04  30%  388 aa  PURT_BACTN RecName: Full=Phosphoribosylglycinamide
  646::859     2e-04  27% 1068 aa  CARB_PROAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  686::870     2e-04  27% 1029 aa  CARB_DEIGD RecName: Full=Carbamoyl-phosphate synthase large chain; 
  658::862     2e-04  23% 1079 aa  CARB_BUCAI RecName: Full=Carbamoyl-phosphate synthase large chain; 
  656::848     2e-04  27% 1126 aa  CARB_BIFAA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  133::267     2e-04  27%  291 aa  RIMK_XANCP RecName: Full=Ribosomal protein S6 modification protein;
  133::267     2e-04  27%  291 aa  RIMK_XANCB RecName: Full=Ribosomal protein S6 modification protein;
  133::267     2e-04  27%  291 aa  RIMK_XANC8 RecName: Full=Ribosomal protein S6 modification protein;
  689::862     2e-04  25% 1073 aa  CARB_HYPBU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::197     3e-04  32%  390 aa  PURT_PROM5 RecName: Full=Phosphoribosylglycinamide
  548::622     3e-04  36%  769 aa  GSHAB_LISIN RecName: Full=Glutathione biosynthesis bifunctional
  654::884     3e-04  26% 1077 aa  CARB_YERPE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  700::865     3e-04  29% 1067 aa  CARB_EXISA RecName: Full=Carbamoyl-phosphate synthase large chain; 
   77::212     3e-04  31% 1029 aa  CARB_DEIDV RecName: Full=Carbamoyl-phosphate synthase large chain; 
  656::848     3e-04  28% 1127 aa  CARB_BIFLO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  656::848     3e-04  28% 1127 aa  CARB_BIFLD RecName: Full=Carbamoyl-phosphate synthase large chain; 
   77::212     3e-04  27% 1109 aa  CARB_BEUC1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  698::853     3e-04  27% 1072 aa  CARB_BACC2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  100::198     4e-04  36%  392 aa  PURT_SYNS9 RecName: Full=Phosphoribosylglycinamide
   85::202     4e-04  36%  433 aa  PUR2_UNCMA RecName: Full=Phosphoribosylamine--glycine ligase;      
  482::596     4e-04  28%  757 aa  GSHAB_PASMU RecName: Full=Glutathione biosynthesis bifunctional
  603::857     4e-04  26% 1074 aa  CARB_METTP RecName: Full=Carbamoyl-phosphate synthase large chain; 
   62::342     4e-04  20% 1072 aa  CARB_BACWK RecName: Full=Carbamoyl-phosphate synthase large chain; 
   22::143     5e-04  27%  646 aa  SYT_OCEIH RecName: Full=Threonyl-tRNA synthetase;       
 1134::1228    5e-04  32% 2244 aa  PYR1_SCHPO RecName: Full=Protein ura1;Includes:  RecName:
   79::216     5e-04  25%  417 aa  PUR2_LEIXX RecName: Full=Phosphoribosylamine--glycine ligase;      
   91::248     5e-04  29%  422 aa  PUR2_BACSU RecName: Full=Phosphoribosylamine--glycine ligase;      
  113::234     5e-04  29%  731 aa  MCCA_SOYBN RecName: Full=Methylcrotonoyl-CoA carboxylase subunit
  682::886     5e-04  25% 1106 aa  CARB_LEPIN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  682::886     5e-04  25% 1106 aa  CARB_LEPIC RecName: Full=Carbamoyl-phosphate synthase large chain; 
   82::217     5e-04  30% 1113 aa  CARB_COREF RecName: Full=Carbamoyl-phosphate synthase large chain; 
  656::753     5e-04  27% 1136 aa  CARB_BIFA0 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  664::772     5e-04  26% 1113 aa  CARB_ASHGO RecName: Full=Carbamoyl-phosphate synthase
 1050::1224    7e-04  24% 2224 aa  PYR1_DROME RecName: Full=CAD protein;AltName: Full=Protein
  100::198     7e-04  34%  388 aa  PURT_SYNPX RecName: Full=Phosphoribosylglycinamide
  106::177     7e-04  25%  391 aa  PURT_PROMS RecName: Full=Phosphoribosylglycinamide
  106::177     7e-04  25%  391 aa  PURT_PROM0 RecName: Full=Phosphoribosylglycinamide
   82::191     7e-04  28%  415 aa  PUR2_STAAR RecName: Full=Phosphoribosylamine--glycine ligase;      
   77::212     7e-04  30% 1024 aa  CARB_DEIRA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  609::854     7e-04  24% 1069 aa  CARB_CLOBB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  701::853     7e-04  25% 1064 aa  CARB_BACST RecName: Full=Carbamoyl-phosphate synthase
  126::261     7e-04  23%  472 aa  BACD_BACSU RecName: Full=Alanine-anticapsin ligase bacD;       
 1253::1318    9e-04  31% 1713 aa  Y3934_DICDI RecName: Full=Uncharacterized membrane protein
  126::254     9e-04  29%  392 aa  PURT_WIGBR RecName: Full=Phosphoribosylglycinamide
   68::246     9e-04  29%  717 aa  MCCA_MOUSE RecName: Full=Methylcrotonoyl-CoA carboxylase subunit
  608::858     9e-04  24% 1024 aa  CARB_PYRAE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  609::854     9e-04  25% 1068 aa  CARB_CLOBJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
    1::301

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
DDLA_CLOPE      MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
DDL_CLOPS       MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
DDL_CLOBA       MKVGVIMGGISSEREISLKSGKSIVDSINKNKYEVVSIVIDEKEDIINKVKGIDFALLALHGQFGEDGTV
DDL_CLOBJ       MKIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDGTV
DDL_CLOBH       MKIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDGTV
DDL_CLOB1       MKIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDGTV
DDL_CLOBK       MKIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDGTV
DDL_CLOBL       MKIGIIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGEFGEDGTV
DDL_CLOBM       MKIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDGTV
DDL_CLOBB       MKVGVIMGGISSEREISLKSGKSIVDSINKNKYEVVSIVIDEKEDIINKVKGIDFALLALHGQFGEDGTV
DDL_CLOB8       MKIGVIMGGISSEREISLQSGKSIIENINKEKYEVLPIVIDKKEDIINKSKGIDFALLALHGQFGEDGTV
DDL_CLOK5       MKVGIIMGGISSEREVSLNSGKSIINYMDKNKYEIVPIVIDKKNDVFEKVKDIDFAFIALHGKFGEDGII
DDL_CLOK1       MKVGIIMGGISSEREVSLNSGKSIINYMDKNKYEIVPIVIDKKNDVFEKVKDIDFAFIALHGKFGEDGII
DDL_CLOB6       MKIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXXXXXXXXXXXXXXXFAFLALHGEFGEDGTV
DDLB_CLOPE      MKVGIIMGGISSEREVSLASGESIFNHIDKEKYEVSKIIINNKIDILEKVKGLDFALLALHGKFGEDGTV
DDL_BACAN       MRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTV
DDL_BACAC       MRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTV
DDL_BACAA       MRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTV
DDLA_CLOTE      MQIGVVMGGVSTEKEISNLTGKYIIENLDKSKYEILPIPINTKFELIDKIKCLEFAFIALHGNFGEDGKV
DDLA_BACCR      ----LLWAGYASEKQVSIMTGNEMIAHLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTV
DDL_DESRM       LRIGVLCGGRSAEREVSLRSGEAVYQALMAAGYNDV-VKIDVGYDLVEQLKGIQVAFLALHGKYGEDGTI
DDL_MANSM       -KIAVLLGGTSAEREVSLTSGDAVLTALRNQGYDAHPIDPKEYPVAQLKEQGFERAFNILHGRGGEDGVI
DDL_PASMU       -KIAVLLGGTSAEREVSLDSGQAVLNALLSAGFDAHPIDPKTFPVATLKEQGFDRVFNILHGRGGEDGTM
DDL_HAEI8       -KIAVLLGGTSAEREVSFNSGKAVLEALLKQGYNAHPIDPKEYNVANLKKDGFNRAFNILHGRGGEDGTM
DDL_ACTPJ       -KIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGI--DTKDFPIEKLKGIQRVFNILHGGIGENGVL
DDL_ACTP7       -KIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGI--DTKDFPIEKLKGIQRVFNILHGGIGENGVL
DDL_ACTP2       -KIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGI--DTKDFPIEKLKGIQRVFNILHGGIGENGVL
DDL_HAEIG       -KIAVLLGGTSAEREVSFNSGRAVLEALLKQGYNAHPIDPKEYNVANLKKDGFNRAFNILHGRGGEDGTM
DDL_HAEIN       -KIAVLLGGTSAEREVSLNSGKAVLEALLKQGYNAHPIDPKEYNVANLKKDGFNRAFNILHGRGGEDGTM
DDL_THELT       MKIAVLLGGISRERPISLKSGENVLKALKKLGHDVVPIDVDENFEIAPKLKEFEVVFNALHGHFGEDGTV
DDL_PELCD       -KIAVLMGGLSAEREVSLRTGKAISQALTRCGYEVTDI--DAGRDLAQQLEGVEVAFIALHGRFGEDGTV
DDL_GEOSM       -KIAVLMGGLSAEREVSLNSGKAVLASLVRQGFQAVGIDVGR--DLPQRLEKAEVAFIALHGRFGEDGSV
DDL_GEOSL       -KIGVLMGGLSAEREVSLASGGAVLKALQSRGYDAVPVDVGRDLPQVLVREWIDVAFICLHGRYGEDGTV
DDL_CARHZ       MKIGVICGGLSSEREVSLRTGDAIFRALLKKGYNVVKIDMDRNIAETLKKENIDFAFIALHGKYGEDGAI
DDL_ACTSZ       -KIAVLLGGTASEREVSLNSGAAVLDALRSQGYDAHPVDPKDMPVADLKQQGFERVFNILHGRGGEDGVI
DDL_THEYD       MKVGVIAGGISSEREVSLRSGQAVFNALKELGYDVV--FIDAGIDLCEKIKKIDIAFLVLHGGWGENGAV
DDL_DESAP       -RIGVLMGGLSAEREVSLRSGRAVCAALESRGYEVVPIDVNRDVARTVRETGIELAFIALHGPLGEDGAV
DDL_HAES1       -KIAVLLGGTSAEREVSLNSGNAVLTALRNQGFDAHPIDPKEYPVAMLKEQGFDRVFNILHGRGGEDGTI
DDL_HAEDU       -KIAVLYGGTSQEREVSLHSGAAVTEALKSLGYNVEGI--DTKDIAIEKLKGIQRVFNILHGGIGENGVL
DDL_HAES2       -KIAVLLGGTSAEREVSLNSGNAVLTALRNQGFDAHPIDPKEYPVAMLKEQGFDRVFNILHGRGGEDGTI
DDL_GEOBB       -KIAVLMGGLSAEREVSLNSGKAVLASLVKQGFRAVGIDVGR--DLPQRLEQVELAFIALHGRFGEDGSV
DDL_HAEIE       ----MLLGGTSAEREVSFNSGKAVLEALLKQGYNAHPIDPKEYNVANLKKDGFNRAFNILHGRGGEDGTM
DDL_HAEPS       -KIAVLFGGVSAEREISLNSGKSVFEALQSLGYNVEAI--DTKEFPIEKLKGIQRVFNILHGGIGENGVL
DDL_GEOUR       -KIGVLMGGLSAEREVSLKSGAAVHQALLARGYXXXXXXXXXXXXQVLVREWVDVAFIALHGRYGEDGAI
DDL_GEOLS       -RIGVLMGGLSAERDVSLKSGMAVHQALLAMGYDSTALDVRHNVALILREEKIDLAFIALHGRYGEDGCI
DDL_THICR       -KVAVLMGGVAAERDVSLRSGAEVLKALKSEGVDAVGCDVTSVAQLVEIAQKYDRAFIALHGRWGEDGGV
DDL_ACIAC       -KVAVLMGGDSAEREVSLMSGGGVLQALRARGVDAHAFDPSQSDLSELKSHGYARCFIALHGRHGEDGTV
DDL_PELPD       -KIAVLMGGLSAEREVSLASGAAVCQALVARGFDALSVDVARDLPLVLSREGIGAAFIALHGRYGEDGCV
DDL_PELTS       LKVGVLMGGRSSEREVSLKTGEAVYNALKVKNYLAVKIDVGL--DVVERIKEIDLAFIALHGRYGEDGTI
DDL_SYNFM       LTVALLSGGASAEREVSLKSGEQVFNALDKQRYLVLRYPAHDLTRLAADAEKIDVALIILHGRMGEDGTI
DDL_BACHD       MKIAVLYGGTSAEREVSLSSGKGIMEALKANGHEVIGIDFHPDQVRXXXXXXXXXXFIGLHGRLGEDGKV
DDL_SYNJA       MNIVILAGGRSAERQVSLVTGKACKRALEDLGHRAK--LIDPEEDLPERQAGCDFVWIALHGPGGEDGVV
DDL_AQUAE       MRVVVLMGGRSSEREISLKTGKAVAKALRELGHEVYELDLDK--ELPCKLLEIDKVFIALHGRYGEDGTV
DDL_CALS8       LKVAVLFGGVSTEHEVSIVSAKSVMQNLDKEKYEIIPIGITKEEDLLVKIKDIDVVFPVLHGLNGEDGTV
DDL_POLSJ       -KVAVLMGGMSAEREISLMSGRGVLQALRSRGVDAHAFDPAERD--ISELKKDEFAFIALHGRFGEDGTV
DDL_THESQ       MRVALLMGGVSREREISLRSGERVKKALEKLGYEHT--VFDVREDFLKKVKSFDVVFNVLHGTFGEDGTL
DDL_THEMA       MRVALLMGGVSREREISLRSGERVKKALEKLGYEHT--VFDVREDFLKKVKSFDVVFNVLHGTFGEDGTL
DDL_SYNWW       -KVLVLMGGTSEEREVSLKSGKAVYEGLKDAGYEVE--ALDFTPETIHRIREYDVVFITLHGKNGEDGTV
DDL_FERNB       MYLGVLLGGISREREISIRSGKRIAQALRNMGHVVDEIDVDDNFIYLSELKKYDALFNILHGTFGEDGKM
DDL_DESAD       MHVLLIAGGWSEEREVSLSGAKGIEQALLELGHDVEFVPAKDFKNILLLAEHADFAFINLHGSPGEDGLI
DDLB_CHRVO      -KVAVLMGGSSSEREVSLMSGAGVLSALRSKGVDAHGFDPSEKPLSALKEEGFDCVFNILHGPFGEDGTL
DDL_METI4       --IAVLKGGPSEEREISLRTAKAVEDALSSLGYEISSIVTTEK---FEIPRDAEICFLCIHGSFGEDGQI
DDL_PEDPA       MKIAVLAGGKSTERNVSLSSGSKITNALRSKGYDATMIVLTEEDNVLPILQAADFVFLALHGGDGENGKV
DDL_DIAST       -KVAVLMGGTSAEREVSLMSGGGVLQALRSRGVDAHAFDPAHSDLSELKAHGYSRCFIALHGRHGEDGTV
DDL_ACISJ       -KVAVLMGGTSAEREVSLMSGGGVLQALRSRGVDAHAFDPAHSDLSELKAHGYSRCFIALHGRHGEDGTV
DDL_CUPTR       -KVGVLLGGRSAEREISLMSGNGVLAALQSRGVDAHGFDPGLQGVAELAAAGFDRVFIALHGRYGEDGTI
DDL_SYNJB       MNIVVLAGGRSAERQVSWVTGKACKRALEDLGHRVK--VIDPDEDLPERQAGCDFVWIALHGPGGEDGVV
DDL_METPP       -KVAVLMGGTSAERDISLMSGGGVLKALQDAGVDAHAFDPKDHELVELRRQGFQRCFIALHGRHGEDGTV
DDL_RHOFD       -KVAVLMGGASAEREVSLMSGQGVLQALISQGVDAHAFDPAERDLAELKVEGFSHCFIALHGRFGEDGTV
DDL_LEPIC       -KIAVFFGGSSTEHSISILTGCFICKTLHTMGHSVKPILLTKDQEEFQKRYGVDIAFLGLHGGQGEDGTI
DDL_DESVV       MKVLLIAGGWSSERDVSLAGARGIEKALRALGHDVTWFPATSLDGLLEAASSHDFAFINLHGSPGEDGLV
DDLB_ECOLI      -KIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTL
DDL_THEPX       -KIAVLFGGQSGEHEVSLMSAKSIINNLDKDKYEIYMVGITKKKEGIPAIMGIDVVFPVLHGPNGEDGTI
DDL_THEP3       -KIAVLFGGQSGEHEVSLMSAKSIINNLDKDKYEIYMVGITKKKEGIPAIMGIDVVFPVLHGPNGEDGTI
DDL_RALEJ       -KVGVLYGGRSAEREISLMSGSGVLAALQSRGVDAHGFDPATQSVAELAAAGFDRVFIALHGRYGEDGTM
DDL_DESVH       MKVLLIAGGWSSERDVSLAGARGIEKALCALGHDVTWFPATSLDGLLEAASSHDFAFINLHGSPGEDGLV
DDL_DELAS       -KVAVLLGGRSAEREVSLMSGTGVLKALLSHGVDAHAFDPAERDLGELKKEGFDRCFIALHGRYGEDGTV
DDLB_ECO57      -KIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTL
DDL_SALPK       -KIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFIALHGRGGEDGTL
DDL_SALPA       -KIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFIALHGRGGEDGTL
DDLB_SALTI      -KIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFIALHGRGGEDGTL
DDLB_SALTY      -KIAVLLGGTSAERDVSLNSGAAVLAGLREGGINAHPVDPQEVDVAQLKAMGFQKVFIALHGRGGEDGTL
DDL_LEPIN       -KIAVFFGGSSTEHSISILTGCFICKTLHTMGHSVKPILLTKDQEEFQKRYGVDIVFLGLHGGQGEDGTI
DDLB_SHIFL      -KIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTL
DDL_ANATD       LKVAVLFGGVSTEHEISIVSAKSIMQNMDKEKYEVIPIGITKEEDLLVKVKDIDVVFPVLHGLNGEDGTV
DDL_LARHH       -KVAVMMGGNSCEREISLMSGQGVLNALRGQGVDAHAFDPAEKPLAALQSEGFDRVFIALHGAFGEDGTL
DDL_BDEBA       --VALIFGGKSAEHEVSLRSAKNVADALDKDKFTPVLIVFTEATKIVDSATAVDVAFPILHGTMGEDGTI
DDL_THEP1       MRVALLMGGVSREREISLRSGERVKKALEKLGYEYT--VFDVKEDFLKEVKSFDVVFNVLHGTFGEDGTL
DDL_GLOVI       MRITVLSGSDSPEREVSLVSGRAVQAALETLGHEVT--MVDPGPDLPVRLNPPDFVWIALHGDKGENGKL
DDL_NITMU       -KVAVLLGGRSAEREISLESGKAVLDALRSSGVDAHPFDPSEQHMDALLQQGYTRAHIALHGRYGEDGTV
DDL_DESMR       MKILLVAGGWSSERAVSLSGAVQIEKALTSLGHEVVPYDLSHDPGFVRRAKACDFVFLSLHGAPGEDGLP
DDL_MAGSM       -KIGVLYGGLSEEREVSLRSGQALFVALQSLGYQVVAIDVDRHITKVLEREGIEVAVLALHGPMGEDGTI
DDLB_ECOL6      -KIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTL
DDL_POLNA       -KVAVLMGGRSAEREISLMSGSGVVQALRSQGIDAHAFDPAERDLGELKTGGFARCFIALHGRFGEDGTV
DDL_MARMS       --IAVIYGGRSAEREVSLQSGPLVAEGLRAKGYQVVELDLNAALDPIVQLQSIEFAFIALHGGEGEDGRV
DDL_HAMD5       -KVAVLLGGTSSERQISLQSGHAVVAGLREAGIDARPI--DTKNFLVTKEKGFTKAFIALHGRDGEDGHL
DDL_NITEC       -KVAVLLGGRSAEREISLKSGHAVLAALQRSQVDAHAFVGQPLEDLLKQ--GFDRAFIALHGRYGEDGSV
DDL_NATTJ       LRVGVLFGGRSGEHEVSLKSANSILNALDRELFEVIPIGIRKKLDPFEKISEIDLIFPVLHGTFGEDGTV
DDL_MOOTA       MKIAVLMGGPSSEREIXXXXXXXXXXXXXXXXHQVITIDLNR--EVVARLKNFDVVFNALHGKPGEDGSV
DDL_DESPS       LRIALIAGGTSGEREVSLTGADGVERILDKEKY--LVSRYDSATDLXXXXXXXXXXXXXLHGLHGEDGTI
DDL_LACSS       MKIVVLAGGRSTERNVSLTSGHKITHALQTKGHDVAFVDLNELKDVLEICKTADIVFLALHGGDGENGKV
DDL_BUCAP       -KIAVLLGGNSSERKISIKSGYAILQSLLRSGFNAYAIDTRDFPIMQLKKQGFDSAYIALHGTGGEDGSI
DDLA_PSEAE      LKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQSLAIIRSGKQSLLSELAGVDVFFLALHGGTGEDGTL
DDL_FRATN       -KIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKE-LVAKLLELDKCFVALHGEDGENGRV
DDL_DECAR       -KVAVLFGGTSAEREVSLNSGSRVLAALQGQGIDAH--AFDPAEQPLDALKGYDRAFIALHGRHGEDGTI
DDL_METFK       -KVAVLLGGKSGEREVSLKSGAAVLAALRRNGVDAH--AFDPAERALSELAGFDRVFIALHGRYGEDGTI
DDL_ACIBT       -KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAE--AFDPQDRSVTELVNYDRAFIVLHGRGGEDGQI
DDL_ACIBC       -KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAE--AFDPQDRSVTELVNYDRAFIVLHGRGGEDGQI
DDL_RALEH       ----------SAEREISLMSGNGVLAALQSRGVDAHGFDPGLQSVAELAAAGFDRVFIALHGRYGEDGTI
DDL_FRATT       -KIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKE-LVAKLLELDKCFVALHGEDGENGRV
DDL_FRATO       -KIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKE-LVAKLLELDKCFVALHGEDGENGRV
DDL_FRATF       -KIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKE-LVAKLLELDKCFVALHGEDGENGRV
DDL_FRAT1       -KIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKE-LVAKLLELDKCFVALHGEDGENGRV
DDL_BURXL       -KVAVLLGGNSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAERPLAALKEEGFVRAFNALHGGYGENGQI
DDL_PHOLL       -KVAVLLGGTSAEREVSLLSGQAVLAGLREAGIDAHPVDTKDFPVTQLKEAGFEKVFIALHGRGGEDGTL
DDL_FRATW       -KIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKE-LVAKLLELDKCFVALHGEDGENGRV
DDL_RALME       -----------AEREISLLSGNGVLAALKSRGVDAHPFDPGLQPISELAAAGFDRVFIALHGRYGEDGTM
DDL_PECCP       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGINAHAVDTRDVSVTTLKEEGFTKIFIALHGRGGEDGTL
DDL_ACIBS       -KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAE--AFDPQDRSVTELVNYDRAFIVLHGRGGEDGQI
DDL_POLNS       -RVGVLLGGKSGEREISLMSGNGVLEALRSKGVDAFDAGLRCPTELVKEK--FDRIFISLHGRFGEDGTI
DDL_FRATH       -KIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKE-LVAKLLELDKCFVALHGEDGENGRV
DDL_FRAP2       -KIVVLYGGDSPEREVSLKSGKAVLDSLLNQGYDAVGLDASSK-DLVVKLLELDKCFIALHGEDGENGRV
DDL_ACIBY       -KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAE--AFDPQNRSVTELVNYDRAFIVLHGRGGEDGQI
DDL_ACIB5       -KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAE--AFDPQNRSVTELVNYDRAFIVLHGRGGEDGQI
DDL_ACIB3       -KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAE--AFDPQNRSVTELVNYDRAFIVLHGRGGEDGQI
DDL_ACIAD       -KVAVLFGGKSAERDVSLDSGQAVLDALLRSGVQAE--AFDPKERSVTELVGYDRAFIVLHGRGGEDGQI
DDL_NITEU       -KVAVLLGGRSAEREISLRSGQAVLAALQRSRVNAHAFAGQPLENLLQQ--GFDRVFIALHGRYGEDGSV
DDL_BORPD       -KVGVLYGGRSAERDVSLMSGKGVHQALLSAGVDAHLFDTGERTLAELAAAGFDRVFIALHGRYGEDGTL
DDL_XANAC       -RVAVLLGGTSSEREVSLNSGGNVLDALRARGVDAQPVIPALAKALVAQQFDRVFNVLHGHNGGGEDGIV
DDL_PSEHT       -KVAVLLGGNSAEREVSLRSGQAVLNALQNHGINAIAFDPKERPLWELNELAIDRVFIALHGRGGEDGTV
DDL_CLOAB       -KVAILFGGQSTEHEVSRVSAASVLRNIDTSKYDLFPIGITKKGEWFEYTKEVDVVFPVMHGLYGEDGTI
DDL_HERAR       -KVGVLFGGRSAEREVSLMSGKGVLAALQSKGVDAHAFDPAERSLAELAAEKFDRVFIALHGSYGEDGTL
DDL_ERWCT       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGINAHAVDTRDFPVTTLKEEGFTNVFIALHGRGGEDGTL
DDL_ANADF       -KVAVLYGGRSSEREVSLRTGAACADALRARGHDVTLVDVDAELPARLRELRVDVAFVALHGRWGEDGCV
DDL_RALPJ       -KVGVLMGGRSAEREISLMSGNGVLAALRARGVDAHAFDLQAVADLAKQ--GFDRVVISLHGRFGEDGTI
DDL_ERWT9       -KVAVLLGGTSAERDVSLLSGAAVLKGLKEAGIDAHAIDIRDFPAMRLKEEGFDKAFIALHGRGGEDGTL
DDL_OCEIH       -KVGIVFGGKSAEHEVSLQSAKNIVDAIDSDKYDVYLISLNKTNEGIAVIPGLDVIFPIVHGTLGEDGSL
DDL_DESDA       MKILLIAGGWSPERQVSLNGARAMVPALEARGHEVTFFDLLENNGLLAAAEQHDFALINLHGAPGEDGLV
DDL_MESSB       --VAVLMGGFSSERPVSLSSGNSCADALEAEGYXXXXXXXXXXXXXXLSELKPDVAFNALHGPFGEDGTV
DDL_LACBA       LHVGLLFGGNSSEHDVSKRSAHNIYDAMDKDRYNVSLFLLTRKVDALSQAKDIDVFFPIIHGNLGEDGTI
DDL_DESDG       MRILLIAGGWSEERDVSLSGARGIHAALERLGHQVTLFPCRTLAGLLEAAQAHDFAFLNLHGQPGEDGLV
DDL_BORA1       -KVGVLYGGRSAEREVSLMSGAGVHEALRSAGVDAHLFDTGLQDLTALEAAGFERVFIALHGRFGEDGAI
DDL_YERPY       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_YERPS       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_YERPP       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_YERPN       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_YERPG       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_YERPE       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_YERPB       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_YERPA       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_YERP3       -KVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTL
DDL_THIDA       -KVAVMLGGTSAERPVSLNSGNAVLAALTRQGIDAHAFDPATRS-LGDLMSGFDRVFIALHGRYGEDGCM
DDL_RHOPB       --VAVLLGGWSSEREVSLRSGKACADALERCGYQVTRVDVQRNIGTVLDQLKPDVALVMLHGRPGEDGTI
DDL_LAWIP       MNILLLAGGWSSEREVSLQSAELITSAMIEYGHTVTCLPLYDFDKIVEVAEKQDVAFILLHGSPGEDGIL
DDL_JANMA       -KVGVLFGGRSAEREVSLMSGKGVLAALLSKGIDAHPFDPAERSLAELAAEKFDRVFIALHGRFGEDGSL
DDL_LEPBL       -KIAVFFGGSSTEHSISIRTGCFICRTLHTMGHSVKPILLTQDEEEFQKTNGVDIVFLGLHGGKGEDGSI
DDL_LEPBJ       -KIAVFFGGSSTEHSISIRTGCFICRTLHTMGHSVKPILLTQDEEEFQKTNGVDIVFLGLHGGKGEDGSI
DDL_FLAJ1       --IAIIMGGYSSEYKISLISGNVVYQYLDKTKYNGFRIIFKEKNDFSVTVNGFDCVFNAIHGTPGEDGLM
DDL_FINM2       ----VLYGGPSTEHEVSITSARTLINNLSKEKYNVNAIFVRRKENITEEIKSDEELILAIHGSYGEDGTI
DDL_WOLPM       --IAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVDS--NIAEKLKKINLAFIALHGPYGEDGCI
DDL_RALSO       -KVGVILGGRSAEREISLLSGNGVLAALRSRGVDAHPFDPGTQPVAGLAAQGFHRVVISLHGRFGEDGTI
DDL_OLICO       --VAVLMGGWSSEREVSLRSGAACAAALERKGYRVTRIVQRDIATVLQNLKP-DVALVMLHGKPGEDGTI
DDL_CORA7       VRVAVVYGGRSSEHSVSCISAGAIMEHLDPEKYEVVPIGITREDELAEHYTEVDVIVPVLHGPYGEDGTV
DDL_WOLWR       --IAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVDS--NIAEKLKKINLAFIALHGPYGEDGCI
DDL_HALOH       LRLGVLFGGRSQEHEVSVMSARSVVKMAKKEKYKVIPFGITKKNNGINEVKALDIVFPVLHGPYGEDGKL
DDLB_XANCP      -RVAVLLGGTSSEREVSLNSGSNVLDALRARGVDAQPVIPALAQALVAQRFDRVFNVLHGHNGGGEDGIV
DDL_AZOSE       -KVAVLLGGTSAEREVSLMSXXXXXXXXXXXXXXXXXFDPAQQDLHILKEQGFDRAFIALHGRGGEDGTV
DDL_ANADE       -RVAVLYGGRSSEREVSLRTGAACAEALRQKGHXXXXXXXXXXXXXXXXXXXXXXXXXXXHGRWGEDGSI
DDL_ANASK       -RVAVLYGGRSSEREVSLRTGAACADALRQKGHXXXXXXXXXXXXXXXXXXXXXXXXXXXHGRFGEDGSI
DDL_ANAD2       -RVAVLYGGRSSEREVSLRTGAACADALRQKGHXXXXXXXXXXXXXXXXXXXXXXXXXXXHGRFGEDGSI
DDL_BORPA       -KVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFERVFIALHGRYGEDGTL
DDL_COREF       VRVAVLYGGRSAEHSVSCVSAGAIIAHLDPEKYEVIPVGITERLRLVDRTMPADVIFPVLHGRFGEDGTI
DDL_VEREI       -KVAVLMGGVSAEREVXXXXXXXXXXXXXXXXXDAHAFDTAQGDLGALKREGYARCFIALHGRHGEDGTV
DDL_BORPE       -KVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFERVFIALHGRYGEDGTL
DDL_BORBR       -KVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFERVFIALHGRYGEDGTL
DDL_RHOP5       --VAVLLGGWSSEREVSLRSGNACADALERRGFEVTRIVARDIATVLDQLRP-DSALMMLHGHPGEDGSI
DDL_PSEMY       -RVAVLFGGKSAEREVSLKSGNAVLSALQAAGVDAFGIDVGD--DFLQRLASIDRAFIVLHGRGGEDGSM
DDL_METPB       --VAVLMGGWSSEREISLRSGNACAEALEGEGYRVTRVDVGPDIATVLTDLKPDAALNALHGPAGEDGTI
DDL_LEPBP       IKIALLFGGISGEHIISVRSSAFIFATIDREKYDVCPVYINEIEFLQEFNKGFLSAFLGLHGGAGEDGRI
DDL_LEPBA       IKIALLFGGISGEHIISVRSSAFIFATIDREKYDVCPVYINEIEFLQEFNKGFLSAFLGLHGGAGEDGRI
DDL_SOLUE       LRVAVIYGGRTGEHEVSVRSAKSILAGLDCEKYETIEYFIDQNGKWSPGPANIDVVFPVLHGTFGEDGTV
DDL_METEP       --VAVLMGGWSSEREISLRSGNACAEALEGEGYRVTRVNVGPDIATVLTELRPDAALNALHGPAGEDGTI
DDL_COLP3       -KIAVLYGGNSAEREVSLNSGQAIAKGLEDAGFNVV-LIDTKVVPLTDLVSNIDRVFIALHGRGGEDGCL
DDL_BURPP       -KVAVLLGGNSAEREVSLNSGRLVLQGLRDAGVDAHPFDPAERPLAALKEEGFVRAFNALHGGYGENGQI
DDL_AZOSB       -KVAVLFGGSSAERDVSLMSXXXXXXXXXXXXXXXHAFDPAERDLHILKEEGYDRVFIALHGRGGEDGTV
DDL_NITOC       -KVVVLMGGYSAEREISLKSGTAVLQSLLRQGIEAHGIDV-DKGVLTQLSKGFTRAFIALHGRGGEDGVI
DDL_BACSK       -RVGIIFGGKSAEHEVSLQSAKNIVEAIDKDRFEASNFLLNDNPALIELNKSLDVVFPIVHGTLGEDGSL
DDL_METC4       --VAVLMGGWSSEREISLRSGNACAAALEGEGYRVTRVDVGPDIATVLTELRPDAALNALHGPAGEDGTI
DDL_HALHL       -RVAVLMGGTSAERDISLRSGGAILAALQRCGYDAE--AYDPRDRALEGLRGYDVVFIALHGRGGEDGTV
DDLB_PSEAE      -RVAVLFGGKSAEREVSLKSGAMVLQSLLAAGVDAFGIDVGE--DLLQRLEKIDRAFIILHGRGGEDGSM
DDL_LACPL       --VGMLFGGNSSEHDVSKRSAHNIYDAMDKNKYEIDLFLITEPEDQVVAAKDIDIFYPVVHGNLGEDGTL
DDL_LACF3       LHVALLFGGNSSEHDVSKRSAHNIYDGMDKDKYDVSIFMFTEPEDQVVQVKEIDFFYPVIHGNLGEDGTV
DDL_PROMH       LRVAIIFGGKSTEHQVSLQSAKNIINELDRTKFDLCLIGINERQQFISLTDGIDVVFPIVHGAYGEDGTL
DDL_PSEPF       -RVAVLFGGLSAEREVSLKSGNAVLTALQSAGVDAFGIDVGA--DILQRLEKIDRAFIILHGRGGEDGSM
DDL_FUSNN       MRIAVFMGGTSSEKEISLKSGEAVLESLQKQGYDAYGVILDERNQVSAFVDNYDLAYLVLHGGNGENGKI
DDLB_CLOTE      IKIAIVFGGQSTEHEVSRNSVTSILKNINRDKYEICPIINNIKNGQWEKDKEVELVFPVLHGLYGEDGTI
DDL_LEGPL       ----LLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSNDLLEKSTPLEGLLIVVHGPLYEDGCL
DDL_LEGPH       ----LLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSNDLLEKSTPLEGLLIVVHGPLYEDGCL
DDL_LEGPC       ----LLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSNDLLEKSTPLEGLLIVVHGPLYEDGCL
DDL_LEGPA       ----LLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSNDLLEKSTPLEGLLIVVHGPLYEDGCL
DDL_PARD8       --IAIVAGGDSSEIVISLKSADGIYSFIDKDKYNLYIAIVKDKNDFSFKENGVDFAYITIHGTPGEDGRL
DDL_HERA2       -RVGIVFGGKSGEHEVSLKSARAVMNALDPEKYTVIPIGITRNGQWLSNVAALDVIIPVLHGPFGEDGTI
DDL_WOLPP       --IAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVDS--NIAQKLKKTNPALIALHGPYGEDGCI
DDL_MARAV       -RVAVFMGGDSAEREVSLKSGKAVLAALQSAGIDAVGRDI--QGCLLRTVDEPDFVFIALHGRGGEDGTL
DDL_NEIG2       -KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKERGFQTAFNILHGTYGEDGAV
DDL_NEIG1       -KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKERGFQTAFNILHGTYGEDGAV
DDL_BUCBP       -KIAVLLGGTSQERNISLISGYNILNSLLKSGIHAVAI--DTKDFPITQLPHQKFAFIALHGRDGEDGTI
VANA_ENTFC      IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITKKKNHEYEINHVDVAFSALHGKSGEDGSI
DDL_BEII9       --VAVLMGGLSAEREVSLCSGAACAEALRGEGFEVTEVDVDRQ--IGERLAALDVAFNALHGRFGEDGII
DDL_NEIMA       -KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTAFNILHGTYGEDGAV
DDLB_RHILO      --VAVLLGGFSSERPVSLSSGKACADALENEGYQVTRVDVGRDVGSVLAELKPDVAFNALHGPFGEDGTI
DDLA_SALTY      LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGINDAENYLQQVPGVDVIFPIVHGTLGEDGSL
DDLA_SALTI      LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGINDAENYLQQVPGVDVIFPIVHGTLGEDGSL
DDL_PSEPG       -RVAVLYGGKSAEREVSLKSGAAVIDALTTXXXXXXXXXXXXXLLARLQSEEIDRAFIILHGRGGEDGSM
DDL_PSEE4       -RVAVLYGGKSAEREVSLKSGAAVIEALTSXXXXXXXXXXXXXLLARLQNEKIDRAFIILHGRGGEDGSM
DDL_WOLTR       --ITILSGGFSRERKISLMSGKAVKKALDSLSYNAIEIDVNS--NTAEKLKKIDLAFIALHGPYGEDGCI
DDL_CLONN       -KVAILFGGQSTEHEVSRVSASSVLKNIDLSKYDVYPIGITEKDEFYKNPNGVDVVFPVMHGLYGEDGTI
DDL_NEIMF       -KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTAFNILHGTYGEDGAV
DDL_ALCBS       -RVAVLAGGRSAERAVSLKSG-AAVHAGLRN-LGLLAELVDPADKSVDTLRGFDAAFIALHGRGGEDGVI
DDLB_PSEPK      -RVAVLYGGKSAEREVSLKSGAAVIDALSTXXXXXXXXXXXXXLLARLQSEKIDRAFIILHGRGGEDGSM
DDL_PELUB       -KILILSGGISKERLISLDTGKQVAKELIKNGYKVL--ISEPDKNLSKNITSFDVIFNALHGQFGEDGYI
DDL_NEIMB       -KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTAFNILHGTYGEDGAV
DDL_CLOTH       -----------------------------------------EKASENEKSKKIDVVFPVLHGCNGEDGTI
DDL_BURP8       -KVAVLLGGASAEREVSLNSGRLVLQGLRDAGVDAYAFDPAERPLAALKDEGFVRAFNALHGGYGENGQI
DDL_ERYLH       LHVVVLMGGWANEREVSLMSGEGVAKALEKRGHTVTRIDMDRQVAAKIAEAAPDVVFNALHGVPGEDGTV
DDL_BURTA       -KVAVLLGGESAERDVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDLA_SHIFL      LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQHQLIDAQNGVDVIFPIVHGTLGEDGSL
DDLA_RHILO      -RVAILYGGRSAEHDVSRLSAANVLKAIDRTRYEVVPIAISRDEDGVEVAKGVDVVFPVLHGPFGEDGSV
DDLA_ECOLI      LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQHQLIDAQNGVDVIFPIVHGTLGEDGSL
DDLA_ECOL6      LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQHQLIDAQNGVDVIFPIVHGTLGEDGSL
DDLA_ECO57      LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQHQLIDAQNGVDVIFPIVHGTLGEDGSL
DDL_GEOKA       -KVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPEEQLIEEIKQLQFTSAALHGPNGEDGTV
DDL_BURPS       -KVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDL_BURP1       -KVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDL_BURP0       -KVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDL_BURMS       -KVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDL_BURMA       -KVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDL_BURM9       -KVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDL_BURM7       -KVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDL_XANP2       --VAVLMGGWSSEREVSLRSXXXXXXXXXXXXYRVTRVVGRDVAEVLTHLKP-DVAFNVLHGQPGEDGTI
DDL_RHOSR       -RVAVIFGGRSNEHSVSCVSAGSVLRNLDPERYEVVPIVLGSTDPETLSIRGVDVVFPVLHGAYGEDGTI
DDL_METSB       --VAVLMGGLSAEREVSLRSGAACAKALEAEGFRVT--TLDVDRDIAQKLAALDAALNALHGRYGEDGVI
DDL_LACS1       LHIALLFGGNSSEHDVSKRSAHNIYDALDKDKYDVSVFMFNEDDVVTEVIKDVDFSYPVIHGNMGEDGTV
DDL_LACRD       LHIALLFGGNSSEHDVSKRSAHNIYDALDKEKYDVSLFMFTEPEDQVNEQKEIDFFFPVIHGNLGEDGTI
DDL_FLAPJ       MNVAVVMGGYSDESVISLRSGQLILNNLDKSKYNIVHILLKDWSVVIEGEKKFDVAINTVHGTPGEDGHL
DDL_AZOC5       --VAVLMGGWSPEREVSLRSGAGCAKALEEVGYXXXXXXXXXXXEVLARLKP-DVALNLLHGCPGEDGTI
DDLB_PSESM      -RVAVLFGGKSAEREVSLNSGNAVLKALLDAGVDAFGIDVGD--DFLQRLEKIDRAFIVLHGRGGEDGTM
DDLB_BACCR      IKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVERIEGIDVIFPLLHGPNGEDGTV
DDL_POLSQ       ---------------ISLMSGNGVLQALGVDAHGFDPGLRNPTELATEK---FDRIFISLHGRFGEDGTI
DDL_XYLFT       -RVAVLLGGTSAEREVSLLSGRNVLEVLDAQSVDGVPALA---QALVERRFDRVFNVLHGHNGGGEDGVV
DDL_PROVI       --VALLFGGRSAEHEISIISAQSVARHINPDHYRVVPIYITRNAALIRKFAGIDIAFPILHGSYGEDGRI
DDL_METCA       -KVAVLMGGSAAEREISLKSGKAVLEALRSGGIDAEGIDVGR--DLIAPLRRFDRVFNVIHGRGGEDGVL
DDL_BURP6       -KVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDEGFVRAFNALHGGYGENGQI
DDL_RHOOB       -RVAVIFGGRSNEHSVSCVSAGSVLRNLDPERYEVVPIVLGSTDPESLSIRGVDVVFPVLHGAYGEDGTI
DDL_METRJ       --VAVLLGGTSAEREVSLNSGKACADALEGEGYRVTRVDVGPDIASVLTALRPDAAFNALHGPDGEDGTI
DDL_IDILO       -KVAVMLGGTSAERDVSLKSGMAVLKGLVAKGIDAHAFAAHSLQELVEQK--FDRVFIALHGRGGEDGSM
DDL_GEOTN       -RVGVLYGGKSPEHQVSLSTARAVMNAIDPHKFDVIPIYITPEGQWIEEVKQLQFTSTALHGPNGEDGTV
DDLA_CHRVO      IRVGLIFGGQSSEHEVSLQSARNILQAIDGERFEVSRIALRESGENLALVPGIDVAFPIVHGTLGEDGSL
DDL_CHLPD       ---------------------------------------------------GIDLAFIALHGSYGEDGRI
DDL_CHLCH       ---------------------------------------------------GVDVAFLALHGSFGEDGRM
DDL_XYLFA       -RVAVLLGGTSAEREVSLLSGRNVLEVLDAQSVDGVPALA---QALVERRFDRVFNVLHGHNGGGEDGVV
DDL_GLUOX       MKVAVLLGGTSSERPVSLVSGEAAIEALREKGHDVTPIDVGP--DIATTIASLDVVFNALHGPRGEDGAI
DDL_CLOCE       -RVAIIFGGQSSEHEVSRVSAQSVIENIDKQKYDVEIIGITKSDGPVEKIGNGDWEAIALHGCNGEDGTI
DDL_BACFR       --IAIVAGGDTSEIVVSLRSAQGIYSFIDKEKYNLYIVEMEGRRWEVQLPDGFDFAYITIHGTPGEDGRL
DDL_BACFN       --IAIVAGGDTSEIVVSLRSAQGIYSFIDKEKYNLYIVEMEGRRWEVQLQDGFDFAYITIHGTPGEDGRL
DDL_STRAW       -RVAVVFGGRSSEHGISVVTAGAVLRAIDRTKYDVLPIGITRDEELAESNEGVDVVFPVLHGPYGEDGTL
DDL_RHOE4       -RVAVIFGGRSNEHSVSCVSAGSVLSNLDPDRYDVVPIVLGSSDPSSLAISGVDVVFPVLHGAYGEDGTI
DDL_LACCB       MKIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDLNTSKDLINKLKAADIVFLALHGGDGENGKV
DDL_LACC3       MKIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDLNTSKDLINKLKAADIVFLALHGGDGENGKV
DDL_STRGG       -RVAVVFGGRSSEHGISVVTAGAVMRAIDRTTYDVLPIGITDVDRLTESAEGVDVVFPVLHGPYGEDGTL
DDL_NOVAD       LHVAVLMGGWSSERPVSLMSGEGVAKALESKGHQVTRIDMDRDVALRLAEAKPDVVFNALHGTPGEDGSI
DDL_BACV8       --IAIVAGGDSSELVVSLRSAQGLYSFIDKERYNLYPIDRNDFSFMENEKKQFDFAYITIHGTPGENGIL
DDL_SACD2       ----VLFGGTSSEREVSLRSXXXXXXXXXXXXXDAHG--LDVQADAIAKIEAFDRVFIALHGPGGEDGKM
DDL_MAGSA       -RVTVLMGGASAERDVSLRSGXXXXXXLEQAGFEVALVDCDRNP--AELVRAIDVVFNALHGRFGEDGCV
DDL_DEIRA       -RILLLAGGQSGEHEVSLRSARSVLAALPRDQFDVTPVVISETQKALETAEGYDAVFPLLHGPMGEDGTI
DDL_BURM1       -KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAHPFDPAERPLSALKDEGFVRAFNALHGGYGENGQI
DDL_PROM1       --IGVVFGGKSSEHEVSIKSAKTIYNALNKERYVARPVILYDKKDHLSNMEDIDVWFPCLHGPNGEDGVI
DDL_PROA2       -RVALIFGGQSTEHEISIISARAIANHIDTEAYELYPIYVGHKGETAQKVEGIDVALPIIHGSTGEDGKI
DDL_CORJK       ----------------------------------------------------VDVVFPVLHGVNGEDGTV
DDL_BACTN       --IAIVAGGDTSEFHVSLRSAQGIYSFIDKEKYTLYPVDRNDFSFMLEKIR-FDFAYITIHGTPGEDGRL
DDL_AZOPC       --VAIVSGGYSSECVISLKSAEEVYLSIDKTRYNPYIVLITRKNDFSFIYKGFDFAYIIIHGTPGEDGLL
DDL_RHISN       --VAVLMGGFSSERPVSLSSGAACADALEAEGYRVSRVDVGRDVAAVLADLRPDIVFNALHGPFGEDGTI
DDL_NOCFA       IRVAVVFGGRSNEHAVSCVSAGSVLRHLDPTRYEAVPIGITPQDDAGAVLGTVDVVFPILHGPFGEDGTL
DDL_GRAFK       -KIAIAMGGYSSEYRISINSGNIVYKHLDHDLYEPYPYPINKSNFTVDKVIQFDCVFNTIHGTPGENGLL
DDL_BURCM       -KVAVLFGGESAEREVSLTSGRLVLQGLRDAGIDAHPFDPAERPLSALKDEGFVRAFNALHGGYGENGQI
DDL_MYCSM       -RVAVVYGGRSSEHAISCVSAGSILRNLDPERFEVVAIITDGKLPAVTEASGTELALPALHGPYGEDGTI
DDL_MYCS2       -RVAVVYGGRSSEHAISCVSAGSILRNLDPERFEVVAIITDGKLPAVTEASGTELALPALHGPYGEDGTI
DDL_BURCJ       -KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAHPFDPAERPLSALKDEGFVRAFNALHGGYGENGQI
DDL_PROMT       --IGVVFGGKSSEHEVSIKSAKTIYNALNKERYIARPIYIDKKDHLISNMEDIDVWFPCLHGPNGEDGVI
DDL_GRABC       -RVVVLYGGISEERAVSLISGQQVVAALREAGYEVTPIEVGA--DLRDTIAALDVVFNALHGRFGEDGAI
DDL_COPPD       MNIVVLFGGTSPEREISLKSGENIAATLRARGHQVETLVPNFVEQLMQLKP--DCVFPALHGADGEDGKI
DDL_BURCH       -KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAHPFDPAERPLSALKDEGFVRAFNALHGGYGENGQI
DDL_BURCC       -KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAHPFDPAERPLSALKDEGFVRAFNALHGGYGENGQI
DDL_BURCA       -KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAHPFDPAERPLSALKDEGFVRAFNALHGGYGENGQI
DDL_BURA4       -KVAVLFGGESAEREVSLTSGRLVLQGLRDAGIDAHPFDPAERPLSALKDEGFVRAFNALHGGYGENGQI
DDL_AGRT5       --VAVLLGGFSSERPVSLSSGNACALALEGEGYKVTRVDVGRDVAAVLDELRPDVAFNALHGPFGEDGTI
DDL_SPHAL       --VAVLMGGWSAEREVSLMSGKGVADALESRGHKVTRIDMDRDVALRLAEAKPDVVFNALHGVPGEDGTV
DDL_PSEU5       -RVAVLFGGKSAEREVSLKSXXXXXXXXXXXXXXXFGI--DAGDDLLQRLSSIDRAFIVLHGRGGEDGSM
DDL_ALHEH       -RVAVLMGGDSAEREISLISGRAVFEALRRRGVDAEAV--DTAQVALAELTGFDRAFIALHGRGGEDGVI
DDLA_BRUSU      MRIVVLFGGRSAEHDVSVLSATNVMNALDPAKYEAVPVFVTRANGALEKPSSIDIIFPVLHGLHGEDGAV
DDL_TREDE       MNIAIIYGGKSSEHEVSLQSASSIIRTIDKKKLHLIGISKNERERIIKNEKAVDAVFAVLHGRFGEDGTI
VANL_STRCO      LKVGIVFGGSSEEHAVSVKSAQEVARNLDTEKYQPFPVVLSPDRSLLVLEQGLDVVLPVLHGTLGEDGAT
DDL_VESOH       --IAILMGGNSAERAISLKSGEAIYQTLNNQNIDCF--TFDWYGDNLSEFQEFDQVFIILHGRGGEDGYI
DDL_THEM4       LNIGIFFGSKSVEHEISIITAQQVLSSIDRKKYNVIPIYISKSEDLXXXXQTIDFCFLVFHGTNGEDGTF
DDL_RICCK       --IALVAGGMSAEREVSLVSSKGVSKALIALGYKVTFIDMGA--DIAFKLQEIDIVFNCLHGTYGEDGCL
DDL_RHIME       --VAVLLGGFSSERPVSLSSGTACADALEAEGYRVTRVDVGRDVAAVLQELRPDVVFNALHGPFGEDGTI
DDL_CORU7       LTVAVVYGGQSTEHSVSCISAGAIIDNLDPERFTVVPVGITDHGEHIQPMLGADVIFPVLHGANGEDGTI
DDL_CHLL2       ------------------------------------------------RAAGIDVVFIALHGSYGEDGRV
DDLA_BRUME      MRIVVLFGGRSAEHDVSVLSATNVMNALDPAKYEAVPVFVTRANGALEKPSSIDIIFPVLHGLHGEDGAV
DDL_STAAT       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAAN       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAAM       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAAE       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAAC       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAAB       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAA9       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAA8       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAA3       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAA2       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_STAA1       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
DDL_BART1       --IAVLMGGFSSERSISLSSGAACADVLEEQGYRVSRVDVGAHIASVLEQLQPDIAFNALHGPFGEDGRI
DDL_STAAW       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWLENGEALEISQLLLHGPNGEDGTI
DDL_STAAS       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWLENGEALEISQLLLHGPNGEDGTI
DDL_DEIGD       -RILLLAGGQSEEHEVSLRSARSVLAALPRDQFDVTPVVISPQGDLVASAEGYDAVFPLLHGPMGEDGTI
DDL_BARHE       --IAVLMGGFSSERSVSLSSGTACADVLEAQGYRVSRVDVDGHIASVLEQLQPDIAFNALHGPFGEDGRI
DDL_BACCN       IKLGLLYGGKSAEHQVSLQTALAAIKALNQEKFEIHPIYITEQGQWMERIEGIDVIFPLLHGPNGEDGTV
DDL_STAAR       ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITTEIKSTDELHLELHGPNGEDGTI
DDL_CHLT3       -KVALLFGGRSSEHEISVISARSIANALDKTKYKIQPIYITKKEHLIEKTAKIDVAFPVLHGPYGEDGTV
DDL_BURVG       -KVAVLFGGESAEREVSLTSGRLVLQGLRDAGIDAHLFDPAERPLSALKDEGFVRAFNALHGGYGENGQI
DDL_STRCO       --VAVVFGGRSSEHGISVVTAGAVLAAIDRTRYDVLPIGITDVEELAESTEGVDVVFPVLHGPYGEDGTL
DDL_PORGI       --VAVIAGGYSGEHSVSLKSAAGILSWLGSEPFSTFLVLIEDKNDFSFDLDGFDYAYITIHGTPGENGLL
DDL_PORG3       --VAVIAGGYSGEHSVSLKSAAGILSWLGSEPFSAF-LVLIERDDLDDERIRFDYAYITIHGTPGENGLL
DDL_CHLPB       --VALLFGGKSSEHEISIISAKAVSAHIDRTTYTLFPLYINRDEDLFDQKEGIEVAFPVLHGAYGEDGKI
DDL_PELPB       ---------------------------------------------------GIEVAFLTLHGTYGEDGRI
DDL_RHORT       -RVTVLMGGFSTERAVSLNSGAAAGEALRQAGYAVT--LLDVGRDVAAFIAALDVVFNALHGRFGEDGAI
DDLA_PSESM      --VAIVFGGQSSEHEVSLQSARNVINAIDRESYALTLILLNANDQFVEVESGIDVVFPLIHGAFGEDGAL
DDL_THET2       -----------------------------------------------------DVVFPLLHGRFGEDGTV
DDL_RICBR       --IALVAGGMSAEREVSLISAEGVGKALIEAGYKVTFIDMGA--DITVKLHEIDIVFNCLHGTYGEDGCL
DDL_RUTMC       --IAVLMGGNSAERAVSLKSGEAVYQALINQNINCFEFDWHGYNLSELWQQEFDQAFIVLHGRGGEDGYI
DDL_BARBK       --VTVLMGGWSSERSVSLSSGTACADILEAQGYNXXXXXXXXXXXXXLEELRPTTVFNALHGPFGEDGCI
DDL_TRIEI       LRVGLLFGGCSGEHEVSIRSAKVIATALNKEKYELIPIYIQKNSDFSQKVLNSDHPSLLLHGPNGEDGTI
DDL_SINMW       --VAVLLGGFSSERPVSLSSGTACADALEGEGYRVTRVDVGHDVAAVLQELRPDVVFNALHGPFGEDGTI
DDL_LACH4       -QVGLIFGGNSSEYEVSIVSCRNIYKAIDKEKFDVHPIWINEEESFLENLPEIDVFFPIVHGNLGEDGVL
DDL_STRU0       ----LLYGGRSAEREVSVLSAESVMRAINYDKFESEKLMTNASLDASLKIKASDIVFPLLHGPMGEDGSI
DDL_STAES       ----IVFGGKSAEHDVSILTAQNVLNAIDKERYQVDIIYITKKDNITQEIKNTDELVILLHGPNGEDGTI
DDL_STAEQ       ----IVFGGKSAEHDVSILTAQNVLNAIDKERYQVDIIYITKKDNITQEIKNTDELVILLHGPNGEDGTI
DDL_LISW6       -KLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAEPILLTGKLDFVEQLRAISPAVLELHGPNGEDGTV
DDL_LACJO       IKVGLIFGGNSSEYEVSIMSAHNIYEEIDTNKFDVYPMWINPKMEVANPHKEIDVFFPIVHGNLGEDGCL
VANB_ENTFA      IKVAIIFGGCSEEHDVSVKSAIEIAANINTEKFDSLPLVMKERE---YETRRIDVAFPVLHGKCGEDGAI
DDL_THEAB       INVGLLFGSKSVEHEISIITAHQVLSFVDKNKYNIIPIYITKDEDLIKKIT-IDVCLLTFHGSNGEDGSI
DDL_SILPO       -KVAVLMGGPSAEREVSLVSGRECAAALRGEGFEVVE--LDAGSDLCDRLRASDVVFNALHGRWGEDGCV
DDL_RICB8       --IALVAGGMSAEREVSLISAEGVGKALIEAGYKVTFIDMGA--DIAVKLHEIDIVFNCLHGTYGEDGCL
DDL_LISMO       -KLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPILLSGKLDFVEQLRAISPAVLELHGPNGEDGTV
DDL_LISMF       -KLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPILLSGKLDFVEQLRAISPAVLELHGPNGEDGTV
DDL_BAUCH       LRVGIIFGGQSAEHEVSLQSAKNIVETIDENKFEVVLIALNKSNDMLEQLVQLDVIFPIVHGTLGEDGNL
DDL_SPHWW       LHIAVLMGGWSSEREVSLTSGNGVADALESLGHKVTRIDMDRDVALRLAEAKPDVVFNALHGTPGEDGTV
DDL_PARL1       --VAVLKGGWSAEREVSLVSGKGCAEALRKHGYRVTEIDAGDLADQILKVKP-DVAFNALHGRWGEDGCV
DDL_SILST       -KVAMLMGGPSAEREVSLSTGRECARALRGQGYEVVEV--DAGPDLVAQLNDIDVAFNALHGRWGEDGCV
DDL_RICFE       --IALVAGGMSAEREVSLVSSEGVSKALIELGYKVTFIDMGA--DIAVKLQEIDIVFNCLHGTYGEDGCL
DDL_COXBU       LHISVLCGGQSTEHEISIQSAKNIVNTLDAAKYRPITIAFGDAAKPWQSLNGADCVFPMVHGTQGEDGAX
DDL_COXBR       LHISVLCGGQSTEHEISIQSAKNIVNTLDAAKYRPITIAFGDAAKPWQSLNGADCVFPMVHGTQGEDGAX
DDL_COXBN       LHISVLCGGQSTEHEISIQSAKNIVNTLDAAKYRPITIAFGDAAKPWQSLNGADCVFPMVHGTQGEDGAX
DDL_COXB1       LHISVLCGGQSTEHEISIQSAKNIVNTLDAAKYRPITIAFGDAAKPWQSLNGADCVFPMVHGTQGEDGAX
DDL_RICTY       --IALVAGGMSAEREVSLISSVGVSKALIELGYKVTFIDMGA--DIAVKLQEIDIVFNCLHGTYGEDGCL
DDL_RICPR       --IALVAGGMSAEREVSLVSSAGVSKALIELGYKVTFVDMGA--DIAVKLQEIDIVFNCLHGTYGEDGCL
DDL_RICAE       --IALMVGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGA--DIAVRLQEIDIVFNCLHGTYGEDGCL
DDL_MYCGI       IRVAVVYGGRSSEHAISCVSAGSILRNLDPDRFEVTAVGITPEGSWVEVLASADVVFPVLHGPYGEDGTI
DDL_LACGA       IKVGLIFGGNSSEYEVSIMSAHNIYEEIDTNKFDVYPMWINPKMEVANPHKEIDVFFPIVHGNLGEDGCL
DDL_BLOPB       --IGIICGGRSLEHEISLKSAMCIAQFIDKFRFEAMILWIDKKNDLSEKIKNINILLKVVHGTLGEDGAL
DDL_PSEA6       -KVAVMFGGRSAEREVSLRSGQAVLSALISAGVNAHGFDPAESEQLVEQK--FDRVLIMLHGRGGEDGSL
DDL_CORGL       VRVAVVYGGRSSEHSVSCVSAGAIMAHLDPEKYDVIPVGITQKLTLIDRTMPADVIFPVLHGRFGEDGTV
DDL_RICM5       --IALMAGGMSAEREVSLVSSEGVSKALIELGYSVTFIDMGA--DITVRLQEIDIVFNCLHGTYGEDGCL
DDL_MYCTU       -----------------------------------------------EVLESVDVVFPVLHGPYGEDGTI
DDL_MYCTA       -----------------------------------------------EVLESVDVVFPVLHGPYGEDGTI
DDL_MYCBP       -----------------------------------------------EVLESVDVVFPVLHGPYGEDGTI
DDL_MYCBO       -----------------------------------------------EVLESVDVVFPVLHGPYGEDGTI
DDL_CORGB       VRVAVVYGGRSSEHSVSCVSAGAIMAHLDPEKYDVIPVGITQKLTLIDRTMPADVIFPVLHGRFGEDGTV
DDL_BACP2       ISLGLIYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEEEKLTEPVSNIDVVFPLLHGPNGEDGTM
DDL_MYCVP       IRVAVVYGGRSSEHAISCVSAGSILRNLDPQRFEVVPVGITPEETLVSGSSGTELALAALHGPYGEDGTI
DDLA_BRAJA      IRVVVLYGGRSGEHEVSLKSAASVFRHLDRTRFEVIPVSIDKRGVLVPITQGIDVVFPVIHGPLCEDGTV
VANC_ENTGA      -KIAVLFGGNSPEYSVSLTSAASVIQAIDPLKYEVMTILANVRNDLGEKRIVPDVLFPVLHGKYGEDGCI
DDL_ZYMMO       --VVVLMGGWSSEREISLLSGRHVGKALEEAGYRVT--LLDMDRDIAFKLREADVVFNALHGTPGEDGSI
DDL_PELLD       --VALLFGGRSLEHEISVISARAVAANIDRDRYRVLAVYITRKLDIADLIRGIDVAFPVLHGSYGEDGRV
DDL_CYAP7       LRVGLLFGGRSGEHEVSINSAKAIATALSASKYDILPVYIRKDQQVLEQVNQVDVWFPILHGPNGEDGTL
DDL_STRT2       ----LLYGGRSAEREVSVLSAESVMRAVDYNAFEVKTYFITQSGDFIKETPGDDEKLMTLHGPMGEDGSI
DDL_STACT       ----IIYGGKSAEHDVSILTAQNVLNAINKDDYQVDIIYITKKDDITENVEDVDSLRLELHGPNGEDGTI
DDL_RICCN       --IALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGA--DIAVRLQEIDIVFNCLHGTYGEDGCL
DDL_CHRSD       -----------------------------------------------------DRVFIAMHGRDGEDGSL
DDL_RHOS5       -RVAVLMGGTSSEREVSLSSGHSCSAALRDAGYEVTEV--DAGPDLARVLAEVDAVFNALHGRWGEDGCV
DDL_MYCUA       LRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFEVIAIGITPQGSWVEVLASVDVVFPVLHGPYGEDGTI
DDL_MICAN       IKVGLLFGGRSGEHEVSINSARSILQAFNYDKYAVIPFYIDKNESNIKEVREMEVWFPILHGPNGEDGTL
DDL_LACAC       IQVGLIFGGNSSEYEVSIVSGHNIYKAIDKDKFDVHPIWINNISNIIENLPEIDVFFPIVHGNLGEDGVL
DDL_CHLP8       --------------------------------------------DLTAFFDSIDVAFLTLHGSYGEDGKI
DDL_STRT1       ----LLYGGRSAEREVSVLSAESVMRAVDYNAFEVKTYFITQSGDFIKETPGDDEKLMTLHGPMGEDGSI
DDL_ARTAT       -RVAILFGGRSSEHAVSCVTAAGVMGAIDKNKYEVIPIIVTEPNAVPQELGSVDVVFPLLHGPWGEDGTI
DDL_MACCJ       ----IIYGGKSAEHDVSLLTAQSVINAMDKDKYAIDTIITNDGEWLIERLKAYDAVFPLLHGPNGEDGTI
DDL_KINRD       -RVAVVFGGRSSEHAISCVTAAGVLAALDGDVYDVVPIVLVEDPARFELTDGVDVVLPLLHGPFGEDGTL
DDL_BIFLI       ----------------------------------------------------VDAVLPVLHGPYGEDGTV
DDL_BIFA0       -RVAVLYGGKADEHSISCISAASFMRALDPELFEAVPIGINLAEGLPEAVETIDVVLPALHGPFGEDGTI
DDL_STRTD       ----LLYGGRSAEREVSVLSAESVMRAVDYNAFEVKTYFITQSGDFIKETPGDDEKLMTLHGPMGEDGSI
DDL_LISIN       -KLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAEPILLSGKLDFVEQLRAISPAVLELHGPNGEDGTV
DDL_BORBU       ----LIFGGVSFEHEISCKSAYSIYLALDLNKYNIYPVYIDKCTGLLDSVSDIDVVFPVVHGRTGEDGAI
DDL_BIFLO       -----------------------------------------EMHHVLTSLGHVDAVLPVLHGPYGEDGTV
DDL_RICRS       --IALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGA--DIAVRLQEIDIVFNCLHGTYGEDGGL
DDL_RICRO       --IALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGA--DIAVRLQEIDIVFNCLHGTYGEDGGL
DDL_OENOB       IRVGLFFGGNSSEHDVSKRSAKNYYDALDPEKYQIFPVLISKKEDEDELLAGLDVLFPSVHGNLGEDGTL
DDL_MARMM       -RIAVLMGGLSPERDVSLVTGAACAKGLRDAGYEVVEIDAGRHLSQQLADADPDVVFNALHGEWGEDGLV
DDL_BIFLD       -----------------------------------------EMHHVLTSLGHVDAVLPVLHGPYGEDGTV
DDLA_XANCP      IRVGLIFGGKSAEHEVSLQSARNILQALDPQRFEPVLIGIDKQGDAEQALAQIDVVFPIVHGTLGEDGSL
DDL_MYCPA       VRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFEVVAIGITPQGSWVEVLASVDVVFPVLHGPYGEDGTI
DDL_MYCA1       VRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFEVVAIGITPQGSWVEVLASVDVVFPVLHGPYGEDGTI
DDL_BLOFL       LRVGLVCGGCSLEHEVSLKSAIYIMKYINKRFFEVVVLWISKQGDYINNILSLDVIFPIIHGALGEDGSL
DDL_PSYWF       -KVAVVFGGNSNERAVSLDSGNAVLQALQSQGIDATHF--DPKDQDVTELKNYDRVFNVLHGRXXXXXXX
DDL_OCHA4       --VAVLMGGFSSERPVSLSSGTACAATLEERGYCVTRIDVDRNVASVLAELKPDVAFNALHGPFGEDGAI
DDL_RHOS4       -RVAVLMGGASTEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLAELSPDAVFNALHGRWGEDGCV
DDL_RHOS1       -RVAVLMGGASTEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLAELSPDAVFNALHGRWGEDGCV
DDL_BORBZ       ----LIFGGVSFEHEISCKSAYSIYLALDLNKYNIYPVYIDKCTGLLDSVSDIDVVFPVVHGRTGEDGAI
DDL_BORHD       ----LIFGGVSFEHEISLRSAYGIYSALMKDKYNLYPLIKRDSSAIISLIPGIDVVFPIVHGRTGEDGAI
DDL_BORAP       ----LIFGGVSFEHEISCKSAYSVYLALDLNKYNGIWYLLDSVSDIVSLLPGIDVVFPVVHGRTGEDGAI
DDL_BACLD       -RLGLVYGGKSAEHNVSLQTALAVTKALDTEKFDIHPIYITEKGEWVRKEDSIDVVFPLLHGPNGEDGTI
DDL_STRR6       ----LLYGGRSAEREVSVLSAESVMRAVDYDRFTVKTFFISQSGDFIKTQEGQEDRLMTLHGPMGEDGSV
DDL_STRPD       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRP2       ----LLYGGRSAEREVSVLSAESVMRAVDYDRFTVKTFFISQSGDFIKTQEGQEDRLMTLHGPMGEDGSV
DDL_FRASC       ----------------------------------------------------IDVVFPLLHGPFGEDGTV
DDL_ANAMM       LSVAVLCGGSSPEREVSLAGGKRVADALGRLGYNATVLDLNRESVGQLLAMAPDLVYNALHGVQGEDGCV
DDL_ANAMF       LSVAVLCGGSSPEREVSLAGGKRVADALGRLGYNATVLDLNRESVGQLLAMAPDLVYNALHGVQGEDGCV
DDL_STRPZ       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRPM       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRPG       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRPC       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRPB       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRP8       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRP6       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRP3       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRP1       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_STRA5       ----LLYGGRSAEREVSVLSAESVMRAINYDKFDEMPLMTNQTVDLDKMVRPSDIVFPVLHGPMGEDGSI
DDL_STRA3       ----LLYGGRSAEREVSVLSAESVMRAINYDKFDEMPLMTNQTVDLDKMVRPSDIVFPVLHGPMGEDGSI
DDL_STRA1       ----LLYGGRSAEREVSVLSAESVMRAINYDKFDEMPLMTNQTVDLDKMVRPSDIVFPVLHGPMGEDGSI
DDL_STAS1       --VCIVYGGKSAEHDVSILTAQNVLNAIDKEQYQIDIIYIKKKENIVDTINDIDSLRLLLHGPNGEDGTI
DDL_ROSDO       -KVAVLLGGPSVEREVSLSSGQACAAALRDEGYDVVEI--DAGHDLGARLAGPDAVLNCLHGRWGEDGCV
DDL_STRPF       ----LLYGGRSAEREVSVLSAESVMRAVNYDKFESERLMTNETIELTQKIKPSDIVFPVLHGPMGEDGSI
DDL_SODGM       -RVAVLFGGQSTEHEVSLRSSMNVIRAIDRQKYDLTLITLCDEQDLIDAANGIDVAFSVLHGASGEDGSV
DDL_LEUME       -RVALIFGGNSSEHDVSKRSAQNFYNAIEADKYEIIVLALEDEQPIVDSAGDFDIFFPVVHGNLGEDGTL
DDL_BORRA       ----LIFGGVSFEHEISLRSAYGIYSSLLKDKYNVFSIFVDKSAELIKRIPGIDVIFPIIHGRTGEDGAI
DDLB_BRAJA      --VGLLFGGRSAEHEVSRASAANILRALNSDRYDSTALTISDEAPEIGLVPGIDVAFPILHGPNGEDGTV
DDL_STRPS       ----LLYGGRSAEREVSVLSAESVMRAVDYDRFTVKTFFISQSGDFIKTQEGQEDRLMTLHGPMGEDGSV
DDL_RICAH       --IALVAGGMSAEREVSLVSSEGVQQALIALGYKVTFIDMGA--DIAVKLQEIDIVFNCLHGTYGEDGCL
DDL_PROM9       --IGLIFGGYSNEHDVSISSAKTVFNAFNSEKYGSVKILIGEKQELFNQKKGIEFQNILLHGFNGEDGSI
DDL_BORDL       ----LIFGGVSFEHEISLRSAYGIYSSLLKDKYNVFSVFVDKSAELIKRIPGIDVIFPIIHGRTGEDGAI
DDL_CYAP8       LRVGLLFGGRSGEHEVSLNSAKAIATALQSQKYDIIPIVLNDAKPLPPQVSEVDVWFPILHGPNGEDXXX
DDL_STRZJ       ----LLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQQEDRLMTNETIDWVFPVLHGPMGEDGSV
DDL_STRPN       ----LLYGGRSAEREVSVLSAESVMRAVDYDRFTVKTFFISQSGDFIKTQEGQEDRLMTLHGPMGEDGSV
DDL_STRPJ       ----LLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQQEDRLMTNETIDWVFPVLHGPMGEDGSV
DDL_STRGC       ----LLYGGRSAEREVSVLSAESVMRAINYDLFEDVRLMTNDTVDMSRKIKPSDIVFPVLHGPMGEDGSI
DDL_STRZP       ----LLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDFIKTQEGQEDRLMTLHGPMGEDGSV
DDL_STRP4       ----LLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDFIKTQEGQEDRLMTLHGPMGEDGSV
DDL_RICPU       --IALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGA--DIAVRLQEIDIVFNCLHGTYGEDGCL
DDL_PETMO       MYIPIITGGKSKEREISLTSAKNVFNSISNLGYKPVILDLID-DDFINKIQNYKFAFNVVHGDYGEDGRL
DDL_CORDI       IKVAIIYGGRSSEHSVSCVSAGAIMAHLDPQRYEVFPVGITHRLKTVDRVMPVDVVFPVLHGRFGEDGTI
DDL_BIFAA       -RIVVMYGGKADEHSISCISAASALRALDTDKFEAIPVSLDEGLPTVEKTPGVDAVFPVLHGPYGEDGTI
DDL_THET8       MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
DDL_LACLM       ----LLYGGRSAEREVSVLSAESVMRAVNYSRFIVKTYFITKTNDLAESYPKISPAAIVLHGPMGEDGSI
DDL_STRZT       ----LLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDFIKTQEGQEDRLMTLHGPMGEDGSV
DDL_STRSV       ----LLYGGRSAEREVSVLSAESVMRAVNYDRFEAKPLMTNATVDMSQKIKPSDIVFPVLHGPMGEDGSI
DDL_LEUMM       -RVALIFGGNSSEHDVSKRSAQNFYNAIEATKYEIIVLALEDEQPIVDSAGDFDIFFPVVHGNLGEDGTL
DDL_LACLS       ----LLYGGRSAEREVSVLSAESVMRAVNYSRFIVKTYFITKTNDLAESYPKISPAAIVLHGPMGEDGSI
DDL_DICNV       -KVAVLYGGNSSEREISLIGGRAVHAALCAAGIDAHLLDTGDPNRIWTKDEHFSRAFVMLHGRGGEDGEI
DDL_PROMA       --VGIVFGGVSGEHEVSIKSARTIIHALKHNKFDVISIYIDKKSEIAEKVKQVEFIGLVLHGPNGEDGSI
DDL_STRPI       ----LLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDFIKQTPGQEDRLMTLHGPMGEDGSV
DDL_THETN       LKVAVMFGGKSVEHEVSIITGLQVIENMNKEKYEPIPVISNYKDSLLKKCEDVDVIFPAFHGTHGEDGTM
DDL_STAHJ       ----IVYGGKSAEHDVSKLTAQNVLNAIDKERYEAGEITILLKESSNGKPYDAIFPLL--HGPNGEDGTI
DDL_BORT9       ----LIFGGVSFEHEISLRSACGIYSALMKDKYDSVPLIKKDSSAIISLIPGIDVVFPIVHGRTGEDGAI
DDL_ANAVT       --------------------------------------LVNSQQQTLERVAEVDVWFPILHGPNGEDGTI
DDL_PROM2       -RIGLIFGGYSNEHEVSISSAKTVFQAFNSDKYDLSEKILNDKQEIVNQQKGIEFQNILLHGLNGEDGSI
DDL_LACLA       ----LLYGGRSAEREVSVLSAESVMRAVNYSRFVVKTYFITKTNDLAESYPKISPAAIVLHGPMGEDGSI
DDL_LACDB       -QVGLIFGGNSSEYEVSITSAGNIYKAIDKDKFDVHPIVLEEPGYMVEKNDKLDVLFPIVHGNLGEDGVL
DDL_LACDA       -QVGLIFGGNSSEYEVSITSAGNIYKAIDKDKFDVHPIVLEEPGYMVEKNDKLDVLFPIVHGNLGEDGVL
DDL_ARTS2       -RVAVLFGGRSSEHAVSCVTAAGVLGAIDYDKYDVIPIIVASPNEVPQELGAVDVVFPLLHGPFGEDGTI
DDL_STRMU       ----LLYGGRSAERDVSVLSAESVMRAINYDNFLVKTYFITQAGDFIQKIKPSDIVFPVLHGPMGEDGSI
DDL_JANSC       -RVVVLMGGPSAEREVSLSTGRGCAEALRGEGFDVIPGVTHAGAELCARLQEIDVVFNALHGRWGEDGCV
DDL_ACICJ       -RVAVLLGGISEEREVSLASGRQVAAALRKAGYDVFEIEVGA--DLGAVIAALDAVFNALHGRFGEDGTI
DDL_BACSU       -------GGKSAEHNVSLQTALAVIKALNTEKFDIHPIYITEKGEWVQQNEAIDVVFPLLHGPNGEDGTI
DDL_MYCSS       -RVAVVYGGRSSEHAISCVSAGSILRNLDPERFDALPADPGRRGELVEVLAAVDVVFPVLHGPYGEDGTI
DDL_MYCSK       -RVAVVYGGRSSEHAISCVSAGSILRNLDPERFDALPADPGRRGELVEVLAAVDVVFPVLHGPYGEDGTI
DDL_MYCSJ       -RVAVVYGGRSSEHAISCVSAGSILRNLDPERFDALPADPGRRGELVEVLAAVDVVFPVLHGPYGEDGTI
MUDD_CHLTR      LHLGIICGGKSCEHEISVLSAKNIAKHLSKSFYDVSYFLITREPEIAQRLEKVDVVLPILHGPYGEDGAM
MUDD_CHLCV      LSVGVVCGGQSCEHDVSLLSARNVVQYLSPQHYDVQYFVINRQSKIAEALANLDFVLPILHGPFGEDGTL
DDL_ENTHR       MKITLLYGGRSAEHDVSVLSAFSVLNAIYYTYYQVQLIFISKKEDLIKEEGTIVFPVL--HGPNGEDGTI
DDLA_PSEPK      ---------------------------------------------------GIDLLFPALHGRWGEDGTI
DDL_KOCRD       --IAVVFGGRSSEHSISLITARSVLRAIDRDRWDVVSVGISELEALLDRGRHIDAVFPLLHGPFGEDGTL
DDL_PROM0       --IGLIFGGHSNEHEVSISSAKTVFKAINRERFTVKAFYINKDSDISEKIQNIDVWFPLLHGFNGEDGSI
DDL_CHLTE       -------------------------------------------------LKNTDVAFIALHGSYGEDGKL
DDL_ARTCA       -RVAVLFGGRSSEHAVSCVTAAGVLGAINKDKYDVIPIIVAAPNEVPQELGTVDVVFPLLHGPFGEDGTI
DDL_TROWT       -----------------------------------------------------DLVFPLLHGVFGEDGTI
DDL_TROW8       -----------------------------------------------------DLVFPLLHGVFGEDGTI
DDL_NOSP7       LRVGLLFGGRSGEHEVSIKSARAIAKALSVDKYEILPFVLETGSPLLEQVAQVDIWFPVLHGPNGEDGTI
DDL_BORGA       ----LIFGGVSFEHEISCKSAYSIYLALDLNKYNIYPVYIDDPPKLIDKNLDIDVVFPVVHGRTGEDGAI
DDL_HYPNA       -RVAVIYGGWSSERPVSLSSGQQMAAAARKAGYDVTEIVTRELASQLAEAEP-DVVLNGLHGPWGEDGCV
DDL_DINSH       -KVAMMMGGTSSERAVSLSSGRECGAALRAEGFEVID--LDAGPDLAARLEDLDVVFNALHGRWGEDGCV
DDL_WIGBR       --VAVLFGGESKEHEISLQSSISIINAIDKKKYNIILIGV-EKNGKIKKMLKIDVIFSILHGSNGENGAF
DDL_SYNS9       --IGLVFGGYSGEHEVSIRSATTVIHGLNSQRYRVIPFYIDQERELPEGSETVQVWYPVLHGPNGEDGTV
DDL_SYNP2       -RVGLLFGGKSGEHDVSIVSXXXXXXXXXQDKYELLPFYIDRNPEISQQVPSIDAWFPIVHGPNGEDGTL
DDL_MYCLE       -----------------------------------------------EVLTSVDVVFPVLHGPYGEDGTI
DDL_HELMI       --IAVICGGRSGEHEVSLTSAQSIVDALDRFRFNVLTIGIDEENPVTRKPVPVDVFFPVLHGPNGEDGTI
DDLB_BRUME      --VAVLMGGFXXXXXXXXXXGVACATTLEECGYRVTRIDVDRNVASILVELKPDVVFNALHGPFGEDGAI
DDL_SYNS3       VRIGVVFGGASGEHAVSIRSAITVINALNRDHFEVVPLVLEQKQPLAEDSDRVDVWFPVLHGPNGEDGTV
DDL_LEUCK       --VALIFGGNSSEHDVSKRSAQNFYDALDPERSKRIPIVADDQQDPLSRINALDIFFPVVHGNLGEDGTL
DDL_TREPS       -----------------------------------------------------DVVFPVLHGSYGEDGTV
DDL_TREPA       -----------------------------------------------------DVVFPVLHGSYGEDGTV
DDL_BACA2       -------GGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEKGELTEPVNGESFALSALHGPNGEDGTI
DDLB_BRUSU      --VAVLMGGFXXXXXXXXXXGVACATTLEECGYRVTRIDVDRNVASILVELKPDVVFNALHGPFGEDGAI
DDL_ANASP       --------------------------------------LVNSQQQTLERVAEVDVWFPILHGPNGEDGTI
DDL_SYNY3       MRVGLLFGGCSGEHEVSIKSAQAIAKALASDKYQVSPFYIQKNPDVSQQVQGVPWGFPILHGPNGEDGTV
DDL_ACAM1       LRVGLVFGGCSGEHEVSITSAKAVCGALNPDKYEVIPFYIHKNQDQAEEAASIDVWFPILHGPNGEDGTI
DDL_PROMS       --IGLIFGGNSNEHEVSISSAKTVFQALDSDSSEKILIDESKNKNTTKKLDGVDFQNVLLHGINGEDGSI
MUDD_CHLPN      LSIGLVCGGKSCEHDISLLSAQHVSKYISPEFYDVSYFIINRQPHLIEETQGVDCLFPVLHGPFGEDGTI
DDL_CAUSK       --IAVLLGGPSAEREVSLVTXXXXXXXXXXXXXXVSRVDPGKDVAQVLTALAPDLVFNGLHGRWGEDGCV
DDL_SYNPW       LRVGVVFGGASGEHAVSIRSARTVIEAFNQERFAVIPHYIDREERALEQNKALDAHELVLHGPNGEDGTV
DDL_PROMP       --IGIIFGGESNEHDVSVSSAKTVFKALDNDQ-SLVLLKEKRKNETIDKFQGIDIWFPLLHGVNGEDGAI
DDL_BARQU       -----------------------------------------------------DVAFNALHGPFGEDGCI
DDL_PROM5       --IGIIFGGTSNEHYVSISSAKTVFKALDSDKYQELP---NRKINFLNNLENIDIWFPLLHGCNGEDGAI
DDL_PROM3       --VGVVFGGASEEHAVSIRSAITVVGALNNNRFEVIAIYIDQREQLSTPLAPQGFTKLVLHGPNGEDGTV
DDL_PROMM       --VGVVFGGASEEHAVSIRSAITVVGALNNNRFEVIAIYIDQREQLSTPLAPQGFTKLVLHGPNGEDGTV
DDL_ENTGA       ---------------------------LTDSAYQGTPIQPGE----IKEEDAIVFPLL--HGPNGEDGTI
DDL_ENTFA       MKIILLYGGRSEEHDVSVLSAYSVLNAIYY-KYYQVQLVFISKDGLSERPQNKEVLHLTLHGPNGEDGTI
DDL_SYNSC       --VGLVFGGRSGEHDVSIRSAATVVRGLNTERYTVQPIYIDRDTDLAEATDAIDLWYPVLHGPNGEDGTI
DDL_BRASO       IRVAILFGGRSAEHDVSRASAANIFRSLDAGRYALTLIGITHSAALIVPADGPQIVLLVLHGPNGEDGTV
DDL_BRASB       -RVAILFGGRSAEHDVSRASAANIFRSLDASRYAVTLIGITPEQALTVPPDGPQIVLLVLHGPNGEDGTM
DDL_SYNR3       --VGLIFGGASGEHDVSIRSAATVAEGLNKERYRVQHVYIDRQDATARQVLSSGQALAVLHGPNGEDGTI
DDL_STREM       ----LLYGGRSAEREVSVLSAESVMRAIDYTKFFVKTYFISQTGQFIQQIRPSDIVFPVLHGPMGEDGSI
DDL_STRE4       ----LLYGGRSAEREVSVLSAESVMRAVDYTKFFVKTYFISQRPTLTERLMTNDTIRLVLHGPMGEDGSI
DDL_VIBHB       ----LLCGGGSSEHEISLLSANFVEQQLNTNQGELVYLDPNQKKLCSDNLSDVDFIVPCIHGFPGETGDI
DDL_STRS7       ----LLYGGRSAEREVSVLSAESVMRAVDYTKFFVKTYFISQRPTLTERLMTNDTIRLVLHGPMGEDGSI
DDL_VIBPA       ----LLCGGGSSEHEISLLSANFVEQQLNTDQGELVYLDLNTKQLCSESNQTIDFIVPCIHGFPGETGDI
DDL_SYNP6       -KVGLLFGGRSGEHEVXXXXXXXXXXXXNRDRYQVLPVLANQKPLFVEECRDVEVWFPILHGPNGEDGTI
DDL_SYNE7       -KVGLLFGGRSGEHEVXXXXXXXXXXXXNRDRYQVLPVLANQKPLFVEECRDVEVWFPILHGPNGEDGTI
DDL_CAUCR       --IAVLLGGPSSERKVSLVSGAACAEALERLGAKVSRIDPGPDVAQVLAATKPDMVFNALHGEWGEDGCV
DDL_SHEHH       ----------------------------------------------------VDYVIPCIHGYPGETGDI
DDL_TOLAT       ------------------------------------------------EAKPVDFVVPCIHGFPGETGDI
DDL_SYNPX       --VGVVFGGCSGEHDVSIRSAQTVAKGLNRERYRVVLVYIDRDPDLAGKVAGTDVVAVVLHGPNGEDGTI
MUDD_CHLMU      LSLGLICGGRSCEHDISILSAQNIAKYLSHSFYEVQYFLITREPEIAGKLSKVDVILPILHGPYGEDGAM
DDL_METS4       --VALLFGGRSAEHEVSIVSAGNVARALDPDRYAVTPIAIDKETETASVSEPFDVVVPVLHGPNGEDGTV
DDL_THEEB       -------------------------------------------------VDTIDVWFPIVHGPNGEDGTI
DDL_VIBCM       ----LLCGGGSSEHEISLVSANYIQQQLETPEFHVIRVEMKKEGWFSEQSYPIDFVVPCIHGFPGETGDI
DDL_VIBCH       ----LLCGGGSSEHEISLVSANYIQQQLETPEFHVIRVEMKKEGWFSEQSYPIDFVVPCIHGFPGETGDI
DDL_VIBVY       ------------------------------------------KSDEFNESIDIDFIVPCIHGFPGETGDI
DDL_VIBC3       ----LLCGGGSSEHEISLVSANYIQQQLETPEFHVIRVEMKKEGWFSEQSYPIDFVVPCIHGFPGETGDI
DDL_VIBVU       ------------------------------------------KSDEFNESIHIDFIVPCIHGFPGETGDI
DDL_VIBSL       ----LLCGGGSSEHEVSIVSANYLFEQLNSDSGELVYLDINDQTLRGDNLESVDFIVPCIHGFPGETGDI
DDL_SHEPW       ----------------------------------------------------VDFAIPCIHGFPGETGDI
DDL_SHESA       ----LLCGGGSAEHDISLLSANYFETSLAKEQFNVLRVVLNNREDETKPAWPVDYVIPCIHGYPGETGDI
DDL_VIBFM       ----------------------------------------------------VDYVVPCIHGYPGETGDI
DDL_VIBF1       ----------------------------------------------------VDYVVPCIHGYPGETGDI
DDL_SULNB       MNIAILFGGSSFEHEISIVSAITMKKVLKKSTLTYIFVSADRKFYLIDTEKAFDVLLNLIHGRDGEDGKV
DDL_SHESM       ----LLCGGGSAEHDISLLSANYFETSLAKEQFNVLRVVLNNREDETKAPWPVDYVIPCIHGYPGETGDI
DDL_SHESH       -------------------------------------------EDESKRPWPVDYVIPCIHGYPGETGDI
DDL_NITSB       MQYAVVFGGKSYEHEISIVSGNRDFYLIEKGNYKKSPKLFYQKSLLKEKKIPADVVINLVHGADGEDGKL
DDL_AERHH       ----LLCGGGGSEHEVSLRSANSLLPGVEVTRVEMFALGLDKLLSFDSVARPVDYVVPCIHGYPGETGDL
DDL_SHEPA       ----------------------------------------------------VDYVIPCIHGYPGETGDI
DDL_SHESR       ----LLCGGGSAEHDISLLSANYFETSLAKSEQVNVLRVVLDKFGQYQTAAGVDYVIPCIHGYPGETGDI
DDL_AERS4       MHVLLLCGGGGSEHEVSLRSANGLVPGVEVTRVEMFALGLDKLLSFDSVARPVDYVVPCIHGYPGETGDL
DDL_SHEFN       ----LLCGGGGAEHDISLMSARFFESSLAKDKFSVLKLVLDKHEDNSTPAWSVDYVIPCIHGFPGETGDI
DDL_SHEWM       ----------------------------------------------------VDYVIPCIHGFPGETGDI
DDL_CAMJ8       MKFAILFGGNSYEHEISIVSAVVLKKVINQNRFYHIPAYKNEKELFIKQSKGFECVINLIHGRDGEDGKI
DDL_SHEDO       -KINVLLGGGGAEHDISLMSARFFETSLAKDQFSVLTLTLDKQEDPSIAPWAVDYVIPCIHGFPGETGDI
DDL_SHESW       ----LLCGGGSAEHDISLMSANYFESSLAKDQFSVLRVELNNREDETKAPWPVDYVIPCIHGYPGETGDI
DDL_SHEPC       ----LLCGGGSAEHDISLMSANYFESSLAKDQFSVLRVELNNREDETKAPWPVDYVIPCIHGYPGETGDI
DDL_SHEB9       ----LLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGVDYVIPCIHGYPGETGDI
DDL_SHEB2       ----LLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGVDYVIPCIHGYPGETGDI
DDL_SHEON       ----LLCGGGSAEHDISLLSANYFETSLAKEQFNVLRVVLNNREDESKAPWPVDYVIPCIHGYPGETGDI
DDL_SHEB8       ----LLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGVDYVIPCIHGYPGETGDI
DDL_CAMJD       MKFAILFGGNSYEHEISIVSAVALKKVINQNRFYHIPAYKKEKELFIQQSKGFECVINLIHGGDGEDGKI
DDL_CAMJE       MKFAILFGGNSYEHEISIVSAVVLKKVINQNRFYHIPAYKKEKELFIKQSKGFECVINLIHGRDGEDGKI
DDL_ANACE       LSIAVLCGGSSPEREVSLAGGKRIADALGRLGHRAAVVDLNRESAHQLLAMAPDLVYNALHGGQGEDGCA
DDL_CAMJR       MKFAILFGGNSYEHEISIVSAVVLKKVINQNRFYHIPAYKKEKELFIKQSKGFECVINLIHGRDGEDGKI
DDL_CAMJJ       MKFAILFGGNSYEHEISIVSAVVLKKVINQNRFYHIPAYKKEKELFIKQSKGFECVINLIHGRDGEDGKI
DDL_HELPH       MEFCVLFGGASFEHEISIVSAIALKGVLDRIKYKLPPLILTHKGLLKNSFLGAKIIELPLHGGDGEDGKL
DDL_SULDN       MKLTILFGGASFEHEISIVSAITLKEKLDQDEYKKMPKLTLSHGSFVQKFGSVDISLNLIHGGDGEDGTI
DDL_CAMC1       -----------------------------------------------------DVIINLIHGMDGEDGKI
Y4SG_RHISN      ---------------------------------------------------------------------V
DDL_SHEAM       ----------------------------------------------------VDYVIPCIHGYPGETGDI
DDL_SHELP       ----------------------------------------------------VDYVIPCIHGYPGETGDI
DDL_HELPJ       MEFCVLFGGASFEHEISIVSAIALKGVLDRIKYKLPPLILTKNSFLGAKIIELPLVINLVHGGDGEDGKL
DDL_HELPS       MEFCVLFGGASFEHEISIVSAIALKEALKHSKYFAQPLILTKNSFLGAKIIELPLVINLVHGGDGEDGKL
DDL_HELP2       ------------------------------------------------KIIELPLVINLVHGGDGEDGKL
DDL_HELAH       ----VLFGGASFEHEISIVSAIALKEVLDQIKYKKLPPLMLTHNGLLKNAKTIELPLMIVHGGDGEDGKL
DDL_WOLSU       MNLAVIFGGASYEHEISIVSAISLKKILNRDFYWIPASEMRSKHDGIYKAKGLDTALNLIHGGDGEDGKL
DDL_HELHP       MKFDVLFGGVSFEHEISIVSGESIGNFIFLDRFYLIPLIFLQRGAFVKKTPIIPHTLINLHGADGEDGSV
DDL_CAMLR       ------------------------------------------KTMLGEKKLDMDVAVNIVHGKDGEDGKI
DDL_HELPY       MEFCVLFGGASFEHEISIVSAIALKGVLDRIKYKLPPLILTKNSFLGAKIIELPLVINLVHGGDGEDGKL
RIMK_VIBF1      ----------------------------------------------------------------------
RIMK_ALISL      ----------------------------------------------------------------------
RIMK_VIBFM      ----------------------------------------------------------------------
RIMK2_SHESR     ----------------------------------------------------------------------
RIMK2_PSEA6     ----------------------------------------------------------------------
RIMK1_SHESM     ----------------------------------------------------------------------
RIMK_AERHH      ----------------------------------------------------------------------
RIMK_VIBPA      ----------------------------------------------------------------------
RIMK_MARMS      ----------------------------------------------------------------------
RIMK_AERS4      ----------------------------------------------------------------------
CARB_THENN      ----------------------------------------------------------------------
RIMK_VIBCM      ----------------------------------------------------------------------
RIMK_VIBCH      ----------------------------------------------------------------------
RIMK_VIBC3      ----------------------------------------------------------------------
RIMK1_SHEON     ----------------------------------------------------------------------
RIMK1_SHESA     ----------------------------------------------------------------------
RIMK_NITOC      ----------------------------------------------------------------------
RIMK2_SHEPC     ----------------------------------------------------------------------
RIMK1_SHESW     ----------------------------------------------------------------------
RIMK_VIBVY      ----------------------------------------------------------------------
RIMK_VIBVU      ----------------------------------------------------------------------
RIMK2_SHEB9     ----------------------------------------------------------------------
RIMK2_SHEB8     ----------------------------------------------------------------------
RIMK1_SHEB5     ----------------------------------------------------------------------
RIMK_THISH      ----------------------------------------------------------------------
RIMK_SACD2      ----------------------------------------------------------------------
RIMK_SHELP      ----------------------------------------------------------------------
RIMK_PSYIN      ----------------------------------------------------------------------
RIMK_PSEU5      ----------------------------------------------------------------------
RIMK_ALCBS      ----------------------------------------------------------------------
CARB_THEP1      ----------------------------------------------------------------------
RIMK_METBU      ----------------------------------------------------------------------
CARB_PEDPA      ----------------------------------------------------------------------
CARB_CLOAB      ----------------------------------------------------------------------
RIMK_SYNPX      ----------------------------------------------------------------------
RIMK_SYNP2      ----------------------------------------------------------------------
RIMK_ESCF3      ----------------------------------------------------------------------
RIMK2_SHEAM     ----------------------------------------------------------------------
RIMK_PSEHT      ----------------------------------------------------------------------
RIMK_MARMM      ----------------------------------------------------------------------
RIMK_TERTT      ----------------------------------------------------------------------
RIMK_SHIBS      ----------------------------------------------------------------------
RIMK_MARAV      ----------------------------------------------------------------------
RIMK_COXBU      ----------------------------------------------------------------------
RIMK_COXBR      ----------------------------------------------------------------------
RIMK_COXBN      ----------------------------------------------------------------------
RIMK_COXB2      ----------------------------------------------------------------------
RIMK_COXB1      ----------------------------------------------------------------------
RIMK2_SHEON     ----------------------------------------------------------------------
RIMK_PSEF5      ----------------------------------------------------------------------
RIMK_PECCP      ----------------------------------------------------------------------
RIMK_ENT38      ----------------------------------------------------------------------
RIMK_AZOVD      ----------------------------------------------------------------------
RIMK2_SHESM     ----------------------------------------------------------------------
RIMK2_SHESA     ----------------------------------------------------------------------
RIMK2_SHEFN     ----------------------------------------------------------------------
RIMK1_SHESR     ----------------------------------------------------------------------
RIMK_SHISS      ----------------------------------------------------------------------
RIMK_SHIDS      ----------------------------------------------------------------------
RIMK_SHIB3      ----------------------------------------------------------------------
RIMK_PSEFS      ----------------------------------------------------------------------
RIMK_ERYLH      -----------------------------------------------ETIKGYD----AVIPRIGASITN
RIMK_ECOUT      ----------------------------------------------------------------------
RIMK_ECOSE      ----------------------------------------------------------------------
RIMK_ECOLU      ----------------------------------------------------------------------
RIMK_ECOLI      ----------------------------------------------------------------------
RIMK_ECOLC      ----------------------------------------------------------------------
RIMK_ECOL6      ----------------------------------------------------------------------
RIMK_ECOL5      ----------------------------------------------------------------------
RIMK_ECOK1      ----------------------------------------------------------------------
RIMK_ECOHS      ----------------------------------------------------------------------
RIMK_ECODH      ----------------------------------------------------------------------
RIMK_ECOBW      ----------------------------------------------------------------------
RIMK_ECO8A      ----------------------------------------------------------------------
RIMK_ECO81      ----------------------------------------------------------------------
RIMK_ECO5E      ----------------------------------------------------------------------
RIMK_ECO57      ----------------------------------------------------------------------
RIMK_ECO55      ----------------------------------------------------------------------
RIMK_ECO45      ----------------------------------------------------------------------
RIMK_ECO27      ----------------------------------------------------------------------
RIMK2_SHEB5     ----------------------------------------------------------------------
RIMK1_SHEB9     ----------------------------------------------------------------------
RIMK1_SHEB8     ----------------------------------------------------------------------
RIMK_PSEU2      ----------------------------------------------------------------------
RIMK_PSESM      ----------------------------------------------------------------------
RIMK_PSE14      ----------------------------------------------------------------------
RIMK_IDILO      ----------------------------------------------------------------------
RIMK1_SHEDO     ----------------------------------------------------------------------
RIMK_PSEPF      ----------------------------------------------------------------------
RIMK_HALHL      ----------------------------------------------------------------------
RIMK_ECO24      ----------------------------------------------------------------------
RIMK_ALTMD      ----------------------------------------------------------------------
RIMK2_SHESW     ----------------------------------------------------------------------
RIMK2_SHEDO     ----------------------------------------------------------------------
RIMK1_SHEPC     ----------------------------------------------------------------------
RIMK_VIBSL      ----------------------------------------------------------------------
RIMK1_SHEAM     ----------------------------------------------------------------------
RIMK_PSEE4      ----------------------------------------------------------------------
RIMK_PELCD      ----------------------------------------------------------------------
RIMK_KLEP3      ----------------------------------------------------------------------
RIMK_ERWCT      ----------------------------------------------------------------------
RIMK1_SHEFN     ----------------------------------------------------------------------
CARB_STRPZ      ----------------------------------------------------------------------
CARB_STRPG      ----------------------------------------------------------------------
CARB_STRP8      ----------------------------------------------------------------------
CARB_STRP6      ----------------------------------------------------------------------
CARB_STRP1      ----------------------------------------------------------------------
RIMK_SHIFL      ----------------------------------------------------------------------
RIMK_PSEPW      ----------------------------------------------------------------------
RIMK_PSEPK      ----------------------------------------------------------------------
RIMK_PSEPG      ----------------------------------------------------------------------
RIMK_PSEP1      ----------------------------------------------------------------------
RIMK_ECOSM      ----------------------------------------------------------------------
RIMK_ECO7I      ----------------------------------------------------------------------
RIMK_CITK8      ----------------------------------------------------------------------
RIMK1_PSEA6     ----------------------------------------------------------------------
RIMK1_HAHCH     ----------------------------------------------------------------------
RIMK_THICR      ----------------------------------------------------------------------
RIMK_PSEMY      ----------------------------------------------------------------------
RIMK_CHRSD      ----------------------------------------------------------------------
RIMK_SHIF8      ----------------------------------------------------------------------
RIMK_PSEAE      ----------------------------------------------------------------------
RIMK_PSEAB      ----------------------------------------------------------------------
RIMK_PSEA8      ----------------------------------------------------------------------
RIMK_PSEA7      ----------------------------------------------------------------------
RIMK_PHOPR      ----------------------------------------------------------------------
CPHA_SYNY8      ----------------------------------------------------------------------
CARB_STRP3      ----------------------------------------------------------------------
RIMK_TRIEI      ----------------------------------------------------------------------
CARB2_METJA     ------------------------------DKLYFEPITFEEVLNIAEREKEKG-ELLGVIVQFGGQTAI
PUR2_THEMA      ----------------------------------------------------------------------
CARB_LACRJ      ----------------------------------------------------------------------
CARB_LACRD      ----------------------------------------------------------------------
CARB_LACH4      ----------------------------------------------------------------------
CARB_LACDB      ----------------------------------------------------------------------
CARB_ACIBL      ----------------------------------------------------------------------
RIMK_DESAD      ----------------------------------------------------------------------
CARB_SULIM      --------------------------------------------DLIKKEK---FRYVATFSGGQIGNSI
CARB_SULIK      --------------------------------------------DLIKKEK---FRYVATFSGGQIGNSI
CARB_SULIA      --------------------------------------------DLIKKEK---FRYVATFSGGQIGNSI
CARB_STRMU      ----------------------------------------------------------------------
CARB_LEUCK      ----------------------------------------------------------------------
CARB1_METJA     ------------------------------DKVYLEPLHPTIVEKIIEKERP-DAILPTMGGQTGLNLAL
RIMK_SALTY      ----------------------------------------------------------------------
RIMK_SALTI      ----------------------------------------------------------------------
RIMK_SALSV      ----------------------------------------------------------------------
RIMK_SALPK      ----------------------------------------------------------------------
RIMK_SALPC      ----------------------------------------------------------------------
RIMK_SALPB      ----------------------------------------------------------------------
RIMK_SALPA      ----------------------------------------------------------------------
RIMK_SALNS      ----------------------------------------------------------------------
RIMK_SALHS      ----------------------------------------------------------------------
RIMK_SALG2      ----------------------------------------------------------------------
RIMK_SALEP      ----------------------------------------------------------------------
RIMK_SALDC      ----------------------------------------------------------------------
RIMK_SALCH      ----------------------------------------------------------------------
RIMK_SALA4      ----------------------------------------------------------------------
PUR2_ZYMMO      ----------------------------------------------------------------------
CARB_SULIY      --------------------------------------------DLIKKEK---FRYVATFSGGQIGNSI
CARB_SULIN      --------------------------------------------DLIKKEK---FRYVATFSGGQIGNSI
CARB_SULIL      --------------------------------------------DLIKKEK---FRYVATFSGGQIGNSI
CARB_THESQ      ----------------------------------------------------------------------
CARB_THEMA      ----------------------------------------------------------------------
CARB_STRTD      ----------------------------------------------------------------------
CARB_STRT2      ----------------------------------------------------------------------
CARB_STRT1      ----------------------------------------------------------------------
CARB_NEIMA      ----------------------------------------------------------------------
CARB_STRA5      --------------QVVLVNSNPATIMTDKDIADKVPITLEFVTRILRKERP-DALLPTLGGQTGLNMAM
CARB_STRA3      --------------QVVLVNSNPATIMTDKDIADKVPITLEFVTRILRKERP-DALLPTLGGQTGLNMAM
CARB_STRA1      --------------QVVLVNSNPATIMTDKDIADKVPITLEFVTRILRKERP-DALLPTLGGQTGLNMAM
CARB_NEIMB      ----------------------------------------------------------------------
CARB_ENTFA      ----------------------------------------------------------------------
CARB_SULAC      --------------------------------------------DLVRKEK-FNYVATFAGGQIGN--TI
CARB_BACSU      ----------------------------------------------------------------------
CARB_STRZT      ----------------------------------------------------------------------
CARB_STRR6      ----------------------------------------------------------------------
CARB_STRPS      ----------------------------------------------------------------------
CARB_STRPN      ----------------------------------------------------------------------
CARB_STRPJ      ----------------------------------------------------------------------
CARB_STRPI      ----------------------------------------------------------------------
CARB_STRP4      ----------------------------------------------------------------------
CARB_STRP2      ----------------------------------------------------------------------
CARB_LEUMM      ----------------------------------------------------------------------
CARB_STRZP      ----------------------------------------------------------------------
CARB_STRZJ      ----------------------------------------------------------------------
CARB_STRP7      ----------------------------------------------------------------------
CARB_LACS1      ----------------------------------------------------------------------
PURT_PROMT      ----------------------------------------------------------------------
MCCA_ORYSJ      ------------------------------------------------------------YGFLSESADF
CPHA_SYNY3      ----------------------------------------------------------------------
CPHA_CYAA5      ----------------------------------------------------------------------
CARB_STRU0      ----------------------------------------------------------------------
CARB_METB6      ----------------------------------------------------------------------
CARB_BACCN      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
PURT_SYNSC      ----------------------------------------------------------------------
CARY_BACSU      ----------------------------------------------VAEQENIDFAIVQFGGQTAINAA-
CARB_SULSO      --------------------------------------------DLIKKEK---FRYVATFSGGQIGNSI
PURT_PROMA      ----------------------------------------------------------------------
GSHAB_CLOPE     ----------------------------------------------------------------------
CARB_STRS7      ----------------------------------------------------------------------
CARB_PELTS      ------------------------------DKLYFEPLTLEDVLNVIEKEKPLGVIV-----QFGGQTAI
PURT_SYNPW      ----------------------------------------------------------------------
PURT_METJA      ----LLLGSGELGKEVVIEAQRLGIECIAVDRYQNAPAMQVAHKSYVIDMKDYD-ALMAIIEREEPDYIV
CARB_THEP3      ------------------------------------PITLEDVLNIYEKEKPLGVMVM-----FGTEGLV
CARB_STRSV      ----------------------------------------------------------------------
CARB_STRGC      ----------------------------------------------------------------------
RIMK_PASMU      ----------------------------------------------------------------------
CARB_THEPX      ------------------------------------PITLEDVLNIYEKEKPLGVMVM-----FGTEGLV
PURT_PROM1      ----------------------------------------------------------------------
PURT_METM7      ----------------------------------------------------------------------
CARB_THELT      ----------------------------------------------------------------------
CARB_LACLM      --------------EVVLVNSNPATIMTDREIADTVPITLEFVSKILRKERP-DALLPTLGGQTGLNMAM
PURT_METMP      ----------------------------------------------------------------------
CARB_STAES      ----------------------------------------------------------------------
CARB_OENOB      ----------------------------------------------------------------------
CARB_BACHD      -----------------------------------------------------DGILPTLGGQTGLNMAV
CARB_BACC1      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB1_AQUAE     ------------------------------DKTYIEPLTADILEEIIKKERP-DALLPTLGGQTGLNLAV
PYR1_YEAST      ----------------------------------------------------------------------
PURT_PROMP      ----------------------------------------------------------------------
CARB_THETN      ------------------------------------PITLEDVLNIYEKEKPLG-VMVMFGGQTAINLTV
CARB_PYRFU      ----------------------------------------------------------------------
CARB_LISW6      ----------------------------------------------------------------------
CARB_LACLA      --------------EVVLVNSNPATIMTDREIADTVPITLEFVSKILRKERP-DALLPTLGGQTGLNMAM
CARB_HALOH      ----------------------------------------------------------------------
CARB_BACHK      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_ARTS2      ----------------------------------------------------------------------
RIMK_LEGPL      ----------------------------------------------------------------------
RIMK_LEGPH      ----------------------------------------------------------------------
RIMK_LEGPC      ----------------------------------------------------------------------
RIMK_LEGPA      ----------------------------------------------------------------------
RIMK2_HAHCH     ----------------------------------------------------------------------
PURT_SULAC      ----------------------------------------------------------------------
PURT_BACV8      ----------------------------------------------------------------------
PUR2_YEAST      ---------------------------------------------------------------------I
GSHAB_ENTFA     ----------------------------------------------------------------------
CPSM_RANCA      ----------------------------------------------------------------------
CARB_STRE4      ----------------------------------------------------------------------
CARB_SCHPO      ----------------------------------------------------------------------
CARB_SALTY      ----------------------------------------------------------------------
CARB_SALTI      ----------------------------------------------------------------------
CARB_LISMC      ----------------------------------------------------------------------
CARB_LACSS      ----------------------------------------------------------------------
CARB_LACLS      --------------EVVLVNSNPATIMTDREIADTVPITLEFVSKILRKERP-DALLPTLGGQTGLNMAM
CARB_LACJO      ----------------------------------------------------------------------
CARB_BACCZ      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACCQ      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACC7      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACC3      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACC0      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACAN      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACAH      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACAC      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACAA      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
PURT_METM5      ----------------------------------------------------------------------
CPSM_RAT        ----------------------------------------------------------------------
CPHA_ANAVT      ----------------------------------------------------------------------
CPHA_ANASP      ----------------------------------------------------------------------
CARB_LISMH      ----------------------------------------------------------------------
CARB_LISMF      ----------------------------------------------------------------------
CARB_LISIN      ----------------------------------------------------------------------
RIMK_DESPS      ----------------------------------------------------------------------
PUR2_YARLI      ---------------------------------------------------------------------I
PUR2_BACHD      ----------------------------------------------------------------------
MCCA_ARATH      ------------------------------------------------------------YGFLSESSDF
CPSM_MOUSE      ----------------------------------------------------------------------
CARB_STAEQ      ----------------------------------------------------------------------
CARB_STAAT      ----------------------------------------------------------------------
CARB_STAAS      ----------------------------------------------------------------------
CARB_STAAR      ----------------------------------------------------------------------
CARB_STAAN      ----------------------------------------------------------------------
CARB_STAAM      ----------------------------------------------------------------------
CARB_STAAE      ----------------------------------------------------------------------
CARB_STAAC      ----------------------------------------------------------------------
CARB_STAA9      ----------------------------------------------------------------------
CARB_STAA8      ----------------------------------------------------------------------
CARB_STAA3      ----------------------------------------------------------------------
CARB_STAA2      ----------------------------------------------------------------------
CARB_STAA1      ----------------------------------------------------------------------
CARB_BACCR      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_BACC4      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DAILPTLGGQTGLNMAV
CARB_ARTAT      ----------------------------------------------------------------------
CARB2_AQUAE     ------------------------------DKLYFEPIVFEHVMDIIEREKPEGVIL-----QFGGQTPL
RIMK_RHOBA      ----------------------------------------------------------------------
CARB_STAS1      ----------------------------------------------------------------------
CARB_LISMO      ----------------------------------------------------------------------
CARB_ECOLI      ----------------------------------------------------------------------
RIMK_XANOR      ----------------------------------------------------------------------
RIMK_XANOM      ----------------------------------------------------------------------
RIMK_CELJU      ----------------------------------------------------------------------
PYR1_DICDI      ----------------------------------------------------------------------
COFF_METMP      ----------------------------------------------------------------------
CARB_STAAW      ----------------------------------------------------------------------
CARB_SHIFL      ----------------------------------------------------------------------
CARB_PSESM      ----------------------------------------------------------------------
CARB_PSEAE      ----------------------------------------------------------------------
CARB_LACPL      ----------------------------------------------------------------------
CARB_ECO57      ----------------------------------------------------------------------
CARB_ARTCA      ----------------------------------------------------------------------
Y815_METJA      ----------------------------------------------------------------------
PURT_METVS      ----------------------------------------------------------------------
GSHAB_LISW6     ----------------------------------------------------------------------
CARB_STACT      ----------------------------------------------------------------------
CARB_RHIME      -----------------------------------------------------------LHGVIVQFGKL
CARB_CLOBM      ------------------------------DKLYFEPLTEEDVLNIVEKEKPNGIIL-----QFGGQTAI
RIMK_HAEIG      ----------------------------------------------------------------------
RIMK_HAEIE      ----------------------------------------------------------------------
RIMK_HAEI8      ----------------------------------------------------------------------
PURT_SYNS3      ----------------------------------------------------------------------
CARB_VIBCH      ----------------------------------------------------------------------
CARB_SULTO      --------------------------------------------DLIRKEK-FTYVATFTGGQIGNN--I
CARB_STAAB      -----------------------------------------------------DALLPTLGGQTGLNMAI
CARB_LACF3      ----------------------------------------------------------------------
PURT_SULTO      ----------------------------------------------------------------------
PURT_PYRKO      ----------------------------------------------------------------------
GSHAB_MANSM     ----------------------------------------------------------------------
CARB_ECOL6      ----------------------------------------------------------------------
CARB_CLOBL      ------------------------------DKLYFEPLTEEDVLNIVEKEKPDGVIL-----QFGGQTAI
CARB_ACIC5      ----------------------------------------------------------------------
GSHAB_LISMO     ----------------------------------------------------------------------
GSHAB_LISMF     ----------------------------------------------------------------------
CPSM_HUMAN      ----------------------------------------------------------------------
CARB_STAHJ      ----------------------------------------------------------------------
CARB_RHILO      -------------------------------------------EDVLEILRAEQASLLGVIVQFGGQTPL
CARB_RALSO      ------------------------------------PVTLEDVLEIVDKEKPVGVIV-----QYGGQTPL
CARB_PASMU      ----------------------------------------------------------------------
CARB_MACCJ      ----------------------------------------------------------------------
CARB_HALSA      ------------------------------------PITAEEVADVVEATNA-DGVMVQFGGQTSVDAPL
PURT_PYRAB      ----------------------------------------------------------------------
PURT_IGNH4      ----------------------------------------------------------------------
PURT_BACTN      ----------------------------------------------------------------------
CARB_PROAC      ----------------------------------------------------------------------
CARB_DEIGD      ----------------------------------------------------------------------
CARB_BUCAI      ----------------------------------------------------------------------
CARB_BIFAA      ----------------------------------------------------------------------
RIMK_XANCP      ----------------------------------------------------------------------
RIMK_XANCB      ----------------------------------------------------------------------
RIMK_XANC8      ----------------------------------------------------------------------
CARB_HYPBU      ----------------------------------------------------------------------
PURT_PROM5      ----------------------------------------------------------------------
GSHAB_LISIN     ----------------------------------------------------------------------
CARB_YERPE      ----------------------------------------------------------------------
CARB_EXISA      ----------------------------------------------------------------------
CARB_DEIDV      -------------------------------------IIALEKPDAILPTLGGQTAL-NLAMELHERGT-
CARB_BIFLO      ----------------------------------------------------------------------
CARB_BIFLD      ----------------------------------------------------------------------
CARB_BEUC1      -------------------------------------IIAKERPDALLPTLGGQTALIALH----EAG--
CARB_BACC2      ----------------------------------------------------------------------
PURT_SYNS9      ----------------------------------------------------------------------
PUR2_UNCMA      ----------------------------------------------------------------------
GSHAB_PASMU     ----------------------------------------------------------------------
CARB_METTP      ------------------------------DKLFFEPVTLEDVMNVIEKER-----YWGVMVQFGGQTAV
CARB_BACWK      ------------------------------DKVYIEPLTLEFVSRIIRKERP-DALLPTLGGQTGLNMAV
SYT_OCEIH       ----------------------------------------------------------------------
PYR1_SCHPO      ----------------------------------------------------------------------
PUR2_LEIXX      ---------------------------------------------------------------------V
PUR2_BACSU      ----------------------------------------------------------------------
MCCA_SOYBN      ------------------------------------------------------------YGFLSESADF
CARB_LEPIN      ----------------------------------------------------------------------
CARB_LEPIC      ----------------------------------------------------------------------
CARB_COREF      ----------------------------------------------IEQGHPIDTVLATLGGQTALNAAI
CARB_BIFA0      ----------------------------------------------------------------------
CARB_ASHGO      ---------------------------------------------------------------------I
PYR1_DROME      ----------------------------------------------------------------------
PURT_SYNPX      ----------------------------------------------------------------------
PURT_PROMS      ----------------------------------------------------------------------
PURT_PROM0      ----------------------------------------------------------------------
PUR2_STAAR      ----------------------------------------------------------------------
CARB_DEIRA      -------------------------------------IIEKEKPDAILPTLGGQTAL-NLAMELHERGS-
CARB_CLOBB      ------------------------------DKLYFEPLTEEDVLNIIEKENPYGVIL-----QFGGQTAI
CARB_BACST      ----------------------------------------------------------------------
BACD_BACSU      ----------------------------------------------------------------------
Y3934_DICDI     ----------------------------------------------------------------------
PURT_WIGBR      ----------------------------------------------------------------------
MCCA_MOUSE      --------GVQSVAVYSEADRNSMHVDMADEAYSIGPAPSQQSYLAMEKIIQVSSAAQAIHPGYGENMEF
CARB_PYRAE      --------------------------------------------DIVEKEGNGVTVVLYAGGQIGQRLYV
CARB_CLOBJ      ------------------------------DKLYFEPLTEEDVLNIVEKEKPDGVIL-----QFGGQTAI


                         .         .         *         .         .         .         .:140
query           QSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNG
DDLA_CLOPE      QSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNG
DDL_CLOPS       QSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWVMVSSVDEIDYEKIENLGYPVFIKPNNG
DDL_CLOBA       QSVLQTLGIPYSGCGPLSSSMCMDKDISKCILKAANIRTAPWINLRKNDAINYEEIEKMGYPVVVKPTHG
DDL_CLOBJ       QSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADWVNVSSVENIDYEAIEKIGYPVFVKPNSG
DDL_CLOBH       QSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADWVNVSSVENIDYEAIEKIGYPVFVKPNSG
DDL_CLOB1       QSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADWVNVSSVENIDYEAIEKIGYPVFVKPNSG
DDL_CLOBK       QSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADWVNVSSAENIDYEAIEKIGYPVFVKPNSG
DDL_CLOBL       QSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADWVNVSSVENIDYEAIEKIGYPVFVKPNSG
DDL_CLOBM       QSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADWVNVTNAEDIDYEAIEKIGYPVFVKPNSG
DDL_CLOBB       QSVLQTLEIPYSGCGPLSSSMCMDKDISKCILKAANIRTAPWINLRRNDKINYEKIEGMGYPVVVKPTHG
DDL_CLOB8       QSVLQTLGIPYSGCGPLSSAMCMDKDVSKSVLEANGIRTAPWINLRKGDNIDFNKINELGYPVVVKPTHG
DDL_CLOK5       QSVFQTMDIPYSGCSPLTSGICMDKDISKKLLYSANINTAEWICIKSIENIDYDYLEKMGYPVVVKPNSG
DDL_CLOK1       QSVFQTMDIPYSGCSPLTSGICMDKDISKKLLYSANINTAEWICIKSIENIDYDYLEKMGYPVVVKPNSG
DDL_CLOB6       QSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADWVNVSSVEDIDYEAIEKIGYPVFVKPNSG
DDLB_CLOPE      QAFLDIMDIPYSGCGALSSSLCMDKNLSKKVLKAENIRTAKWITVKSXXXXXXXXXXXXGYPVFVKPNNG
DDL_BACAN       QGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSG
DDL_BACAC       QGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSG
DDL_BACAA       QGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSG
DDLA_CLOTE      QALLETMGVPYSGSGVLASSLCMDKNMSKKILQGEGIKTPRWIMLYKNEDIDFESIKNIGYPLVVKPNSG
DDLA_BACCR      QGTLESLGIPYSGSNMLSSSICMDKNISKKILRYEGVETPDWIELTKMEDLNLDELDKLGFPLVVKPNSG
DDL_DESRM       QGLLEMLDIPYTGSGVLASALAINKIATKKIFKMEGIPTPAFSVITSLQEAALRAIKEVGVPAVVKANTQ
DDL_MANSM       QGVLEQIGLPYTGCGVMTSALTMDKMRTKMLWKGFGLPIADMEIVTTVDELNLEVVERLGLPLMVKPSRE
DDL_PASMU       QGLLEQIGIPYTGCGVMTSALTMDKMRTKMLWKAFGLPVAEMEIVTNVGELNPSAVEKLGLPVMVKPSLE
DDL_HAEI8       QGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMKVVTTFSELDPQAVAKLGLPLMVKPSLE
DDL_ACTPJ       QGALEQMGIPYTGCGVMASAVTLDKFRTKLMWQAVGLPTADMVVVRRGEAVDSEQIAKLGLPVFVKPSSE
DDL_ACTP7       QGALEQMGIPYTGCGVMASAVTLDKFRTKLMWQAVGLPTADMVVVRRGEAVDSEQIAKLGLPVFVKPSSE
DDL_ACTP2       QGALEQMGIPYTGCGVMASAVTLDKFRTKLMWQAVGLPTADMVVVRRGEAVDSEQIAKLGLPVFVKPSSE
DDL_HAEIG       QGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMKVVTTFSELDPQAVAKLGLPLMVKPSLE
DDL_HAEIN       QGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMKVVTTFSELDPQAVAKLGLPLMVKPSLE
DDL_THELT       QAILDWVGVSYTGSKVLASAICFDKVMTYRVLD-GYVNFPEYTIVKKVKESPY------GFPCVIKPRKE
DDL_PELCD       QGLLELADIPYTGSGVLASSLAMDKVATKKMLCYHGIATPGFAVMRRGQKICGTLPD---YPLVVKPARE
DDL_GEOSM       QGLLELMGIPYTGSGVLASALAIDKIASKVIFASAGLTLAPYQVLRRGEEF---KLAN-PLPVVVKPSRE
DDL_GEOSL       QGLLELMGIPYTGSGVLASALAMNKIVAKEVFAARGLTIAPYRVVRRGETVD-PVAEGFGYPVVVKPSQE
DDL_CARHZ       QGLLEIMDIPYTGSGILASSLAIDKIMTKKILKAEGIPTPNYIAFSNFEAISSEILQTLKLPVVIKAPRE
DDL_ACTSZ       QGVLEQIGLPYTGCGVMTSALTMDKMRTKMLWKGFGLPIADMEIVTKNTALSLEPVARLGLPLMVKPSRE
DDL_THEYD       QGMLEVMGIPYTGSGVLASALAMDKEASKKIFLYHGIPVPPFKVLNKKDYIXXXXXXXXXFPCVVKPAEE
DDL_DESAP       QGLLEVLGIPYTGSGVLASALAMDKIATKKILAHAGLPVPEYRELEAGDDSARAVVAELGLPVVVKAPTQ
DDL_HAES1       QGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMEVVTSFSQLNPQVVEKLGLPLMVKPSLE
DDL_HAEDU       QGALEQMGIPYTGCGVMASAITLDKFRTKLLWNAVGLPTADMVVVQRGQAIDINQIAKLSLPVFVKPSSE
DDL_HAES2       QGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMEVVTSFSQLNPQVVEKLGLPLMVKPSLE
DDL_GEOBB       QGLLELMGIPYTGSGVLASALAIDKIASKVIFASAGLKLAPYQVLRRGEEL---KLAN-PLPVVVKPSRE
DDL_HAEIE       QGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMKVVTTFAELDPQAVAKLGLPLMVKPSLE
DDL_HAEPS       QGALEQLGIPYTGCGVMASAITLDKFRTKLLWNAVGLPTAAMEVVRRGQAVNSDEIAKLGLPLFVKPASE
DDL_GEOUR       QGLLEIMGIPYTGSGVLASALAMNKIFAKQAFQAARLTVAPYKVFCRGDKAALAELE-FSLPVVVKPSQE
DDL_GEOLS       QGLLELMQIPYTGSGVLASALAMHKLYSKQAFAAAGLTITPYATVRQGDRCNAEQLP-FGLPVVVKPVQE
DDL_THICR       QAVLDSLALPYTGSGMTASALAMDKLRTKWLWKGVGLPTPAFIVVSPSRPLDVETFD-LTFPVIVKPSHE
DDL_ACIAC       QGALELLGIPYTGPGVMASAIAMDKIMTKRIWRFEGLPTPDWRLVSSAAE-TAQALEDLGSPMIVKPSRE
DDL_PELPD       QGLLELMAIPYTGSGVLASALAMHKLYSKQAFVSAGILTAPFHHFRRGERVSLSHL-SFGLPLVVKPVQE
DDL_PELTS       QGLLEMLDIPYTGSGVLASALAMDKAATKKIIQYEGLPTPPFMLVEKKEALKSERIREMGLPLVVKAPTQ
DDL_SYNFM       QGLLESLGIPYQGSGVLGSAVAMNKILSKQLYIHAGLPVAPHLVADRREPPDLDTVDRLGLPVVVKPEHE
DDL_BACHD       QALLDLLNIPYVGTGVQGSALAMDKAKAKLFFEKAGIRVAE-EVVLHSFTYDANAFNFTGYPVVVKPNQE
DDL_SYNJA       QGMLEWLGLPYQGSGPLASALAMDKLVSKQIFRAEGIPTPEWLVWDEAQPLSWECVARLGSPLVVKPSNS
DDL_AQUAE       QGLLEILDIPYTGSDTIASAVSIDKDFTKRIVKSLGINTPDWE--TFISEGDVLNTEWNKFPAVVKPVRE
DDL_CALS8       QGLLELSGIPYVGCGVLSSALCMDKAFAKKLALLEGIPQGHFLVILSKKEYFIRRIESFSYPVFVKPANS
DDL_POLSJ       QGALELLGIPYTGSGVMASSMAIDKVMTKRVMLAEGLPTPTYVLLGSYGSADVSAVDKLGLPLIVKPARE
DDL_THESQ       QAILDFLGIRYTGSDAFSSMICFDKLVTYRFLK-GTV-----EIPDFVEIKEFMKTSPLGYPCVVKPRRE
DDL_THEMA       QAILDFLGIRYTGSDAFSSMICFDKLVTYRFLK-GTV-----EIPDFVEIKEFMKTSPLGYPCVVKPRRE
DDL_SYNWW       QGYLELLGIPYTGSGVLASAVCMNKVITKKLLSYEGLPTADFQVIKNRDLFNPDLLEDFGLPLVVKPATQ
DDL_FERNB       QAILDSIGIPYTGSGVETSVIAFDKYLCN---LFVENTIERYEELSVVKIPNFLLIEKIGLPCVVKPRKE
DDL_DESAD       QAMLNQVNCPYQGAEPESSFLTLNKAATKTVFDHHGILTPKWELVCAADGC--KGLQDLEPPVFIKPNSG
DDLB_CHRVO      QGALEALGMPYTGCGVMASAIAMDKWRTKLLWKGAGLPIPAFELLD--ENSDFDAIEQLGLPIFVKPSTE
DDL_METI4       QRLLMRRGIPFTGSDASSSEKAFDKAWSKTLFIKGGIPTPPFCVVGDGKKIPFDP------PYVIKPSRQ
DDL_PEDPA       QAVLDLNHIKYTGSGSLASGIAMDKAISKEIMLYNNIKTAQFAVLHAKDGIHPQLA--FDYPMVVKPNSG
DDL_DIAST       QGALELLGIPYTGPGVMASSIAMDKIMTKRIWRADGLPTPDWRLVSSSAE-TAQAFQELGAPMIVKPSRE
DDL_ACISJ       QGALELLGIPYTGPGVMASSIAMDKIMTKRIWRADGLPTPDWRLVSSSAE-TAQAFQELGAPMIVKPSRE
DDL_CUPTR       QGLLEQLGVPYTGSGVLASALAMDKQATKRLWMTHGLATPRFAMLHADTDFD-AVVADLGLPLIVKPARE
DDL_SYNJB       QGMLDWLGLPYQGSGPLASALAMDKLVSKQIFRAAGIPTPDWQVWDDQNPLTWDCAAELGSPLVIKPSNN
DDL_METPP       QGALELLRIPYTGSGVMASAIAMDKIMTKRVWLAEGLPTPRYVRLAP-DEQTPERVDDLGLPLIVKPPRE
DDL_RHOFD       QGALELLGIPYTGSGVMASSIAIDKVMTKRIWRSEGLPTPEWRQVDS-XXXXXXXXXXLGSPMIVKPDRE
DDL_LEPIC       QGFLEILGIPYTGSGVLASAIAMDKTRANQIFLQSGQKVAKLEYLNSTDAV-ITKLETLGFPQFLKPVEG
DDL_DESVV       QAMLDTAGCPYQGSGPAGSFLALNKAVSKQLLRRHGILTPDWAFLAARPAADWE--PGLGYPLFVKPNTG
DDLB_ECOLI      QGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLSDKQLAEISALGLPVIVKPSRE
DDL_THEPX       QGLLELLDMPYVGANVLSSALCMDKVFTKRIFKEAGLPTPDFVVVYGKEIEDLEKIEHLGYPCFVKPANL
DDL_THEP3       QGLLELLDMPYVGANVLSSALCMDKVFTKRIFKEAGLPTPDFVVVYGKEIEDLEKIEHLGYPCFVKPANL
DDL_RALEJ       QGLLEQLGVPYTGSGVLASALAMDKQATKRLWMTHDLSTPRFAMLYADTDFD-AVVADLGLPLIVKPARE
DDL_DESVH       QAMLDTAGCPYQGSGPAGSFLALNKAVSKQLLRRHGILTPDWAFLAARPAADWE--PGLGYPLFVKPNTG
DDL_DELAS       QGALELLGIPYTGPGVMASSIAMDKIMTKRIWRFEGLPTPDWRLVASAGE-TRAALQALGAPMIVKPSRE
DDLB_ECO57      QGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLSDKQLAEISALGLPVIVKPSRE
DDL_SALPK       QGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLSEEQKARISALGLPLIVKPSRE
DDL_SALPA       QGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLSEEQKARISALGLPLIVKPSRE
DDLB_SALTI      QGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLSEEQKARISALGLPLIVKPSRE
DDLB_SALTY      QGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLSEEQKARISALGLPLIVKPSRE
DDL_LEPIN       QGFLEILGIPYTGSGVLASAIAMDKTRANQIFLQSGQKVAKLEYLNSTDAV-ITKLETLGFPQFLKPVEG
DDLB_SHIFL      QGMLELMGLPYTGSGVMASALSIDKLRSKLLWQGAGLPVAPWEFEKGLSDKQLAEISALGLPVIVKPSRE
DDL_ANATD       QGLLELSGIPYVGCGVLSSAICMDKAFAKKLALLEGIPQGHFLVVSAKKDYFIRRIESFSYPVFVKPANS
DDL_LARHH       QGALETMGIPYTGCGVMASAIGMDKWRSKLVWKAAGLPVPDFRLLA--DDSDFAAIEELGLPMFVKPACE
DDL_BDEBA       QGLFKMVQLPFVGCGVWSSAAGMDKEIMKRLLAVAKIPNARYLLLTPHQKNDYEIVKELGSPFFIKPANA
DDL_THEP1       QAILDFLGIRYTGSDAFSSMICFDKLATYRFL------KDIVEIPDFIEIREFMETSPLGYPCVVKPRRE
DDL_GLOVI       QGLLDWLGLPYNGSGVTASAIAMDKVVSKRLFVAEGIPTPAYRVAEAVPQVSECQLAALGSPVVVKPADG
DDL_NITMU       QGALELLGIPYTGSGVLASALAMDKWRTKLLWQSAGINTPRHILLDEQSDFD-AVAKELGLPLIVKPSRE
DDL_DESMR       QALLDAAGVPYQGSGPAGSFLALNKAASKQLFLEACLPTPRWTFVPR--DAGTSARPDFPLPWFVKPNLG
DDL_MAGSM       QGLLEFMGIPYTGPNVAASAICMDKGLSKRLFHSEGLPTPAWELAGDHEEADELVDHFLGGAAFVKPLDS
DDLB_ECOL6      QGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLNDKQLAEISSLGLPVIVKPSRE
DDL_POLNA       QGALELLGIPYTGSGVMASSMAIDKVMTKRLLLSESLPTPRYVLLAQVDAI----VDTLGLPLIVKPARE
DDL_MARMS       QALLEMFGKPYTGSSPLACGLAMDKVLTKRFWNGIGIPTPAY--LSFVDHANADLIEEMSYPVIVKPSRE
DDL_HAMD5       QAVLEFLKIPYTGSGVMASALAMDKHRSKMIFQGAGLREQIWPNVTQNTSNDLKNINQLGLPLIVKPSRE
DDL_NITEC       QGALELMDLPYTGSGILASALAMDKWRTKMIWQAAGISTPDYVMLDA-DSNFQEVTDRLGLPLIIKPARE
DDL_NATTJ       QGFLDLCGIPYVGSGVLGSSLAMDKVMMKKILRRHGLQVARSEWEQDRDEIIFSIEKQLSYPIFVKPANL
DDL_MOOTA       QGLLEVLGLPYTGSRVLASAITMDKIMTKRVLLQAGIPTPKFEYATGKKEIKAAILKELGLPVVIKAPTQ
DDL_DESPS       QGFLDLLGIPYQGSGVLGSALAMDKDLAKEFYYNAELPVADWHTIAAGDFFSEELIEDLGLPLVVKPACA
DDL_LACSS       QAVLDVFEIPYTGSDTLAAGITMSKKVSKEILLFNNIPTARFVAAQPMPEMPFE------YPVVVKPSNG
DDL_BUCAP       QGILEYLNIPYTGSGIMSSAISLDKWRTKSLRVLPDIYLQKKDXXXXXXXXXXXXXXXXXFPVVIKPNNA
DDLA_PSEAE      QALLDAGGFAYTGSGHLASAMAMDKDVAKRLFLAAGVETASWLMAPASEE---EVREQLGFPLVVKPNSQ
DDL_FRATN       SALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLT--DKLVAE--DEISFPVAVKPSSG
DDL_DECAR       QGALEVMHIPYTGSGVLASALAMDKFRTKLMWRAAGLAIPEYALLTA--DSDFADIEELGLPLFVKPARE
DDL_METFK       QGALELMGIPYTGSGVMASSVGMDKWRTKLLWRAAGVVTPDFELVTA--DSNFDAIEKLGLPLFVKPANE
DDL_ACIBT       QGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLD-SVIAELGLPVIIKPVHE
DDL_ACIBC       QGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLD-SVIAELGLPVIIKPVHE
DDL_RALEH       QGLLEQLGVPYTGSGVLASAMAMDKQATKRLWMTYGLATPRFAMLHA--DTDFDAVADLGLPLIVKPARE
DDL_FRATT       SALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLT--DKLVAE--DEISFPVAVKPSSG
DDL_FRATO       SALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLT--DKLVAE--DEISFPVAVKPSSG
DDL_FRATF       SALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLT--DKLVAE--DEISFPVAVKPSSG
DDL_FRAT1       SALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLT--DKLVAE--DEISFPVAVKPSSG
DDL_BURXL       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQLGIPTPPFEAVLRGDDYEKEIVAKLGLPLFVKPASE
DDL_PHOLL       QGVLEFLQLPYTGSGVMASALSMDKLRTKQVWQGIGLTVSPYVSINSTDSQLQEYVADLGLPLIVKPSLE
DDL_FRATW       SALLEMLEIKHTSSSMKSSVITMDKMISKEILMHYRMPTPMAKFLT--DKLVAE--DEISFPVAVKPSSG
DDL_RALME       QGLLEQLGIPYTGSGVLASALAMDKQATKRLWMTHGLATPRFAMLYANTDFD-AVVADLGLPLIVKPARE
DDL_PECCP       QGVLEFLGLPYTGSGVMASALTMDKLRTKQV----------WQAVGALDRRQYSEMTHLGLPLIVKPSRE
DDL_ACIBS       QGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLD-SVIAELGLPVIIKPVHE
DDL_POLNS       QGLLELLGLPYTGSAVLASALAIDKIVTKQVWISNGLATPEYEELTATSDWN-AVVQHLGLPLIVKPAHE
DDL_FRATH       SALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLT--DKLVAE--DEISFPAAVKPSSG
DDL_FRAP2       AALLELLGIKHTGSTMKSCVVTMDKMISKEILMHHRMPTPMAKFLTD----RLVEADEISFPVAVKPSSG
DDL_ACIBY       QGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLD-SVIAELGLPVIIKPVHE
DDL_ACIB5       QGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLD-SVIAELGLPVIIKPVHE
DDL_ACIB3       QGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLD-SVIAELGLPVIIKPVHE
DDL_ACIAD       QGVLEWLDIPYTGTGVQGSAIGMDKIKTKQIWQGSDLPTAPYRIVSKDSDLN-EIVASLGLPVIIKPVHE
DDL_NITEU       QGALELMELPYTGSGILASALAMDKWRTKMIWQAAGINTPDYVMLDASSRF-RDVADRLGLPLIIKPARE
DDL_BORPD       QGALELLGLPYTGSGPMASSLSMDKIMTKRVWLQHGLRTPAFEVLDAQAELRTVP-DRLGLPLILKPPHE
DDL_XANAC       QGLMEAFGVPYTGSDVLGSALSMDKIRTKQVLGLSTPRYARLAAGASAEDI-HAAARQIGLPIIVKPANE
DDL_PSEHT       QGALEFMNLPYTGSNVLGSALAMDKVRCKHLFKSAGLSTAPYTVVDAKKGFDAAAIMQQFKKVMVKPSHE
DDL_CLOAB       QGLCKLVGVPCVGPSVLSSSVCMDKVYTKYVLEHFNIKQADYVVVTSXXXXXXXXXXXLGYAVFIKPSNS
DDL_HERAR       QGALEQLGIPYTGPGVMASAISMDKVMTKRVCLSHGVPTPRFTVLTSAAQLQSVAAE-FGLPLMLKAPHE
DDL_ERWCT       QGVLEFLGLPYTGSGVMASALTMDKLRTKQVWQAVGLPVSPYVALDRRQYLDTEQFTHLGLPLIVKPSRE
DDL_ANADF       QGLLECMGIPYTGSGVTASAMGMDKTVSKAIFALGDVIEYRAFPPARAAEIDLRDLP-FGVPCVVKPAGE
DDL_RALPJ       QGLLEQFGIPYTGSGVLASALAMDKEATKRQWQTHGLPTPDFVMLHA--GADWQAVDRLGLPLIVKPARE
DDL_ERWT9       QGVLEFLAIPYTGSGVMASAITMDKLRSKYLWVSPFVALNRAQMDAGLDAQLMTSIDALGLPLFVKPSRE
DDL_OCEIH       QGMLRMANIPFVGSSVLGSAISMDKDIAKRLLKDAGLKVAKGYAYRSVDKIHFDSLEELGLPMFIKPANQ
DDL_DESDA       QAMLDQVGCPYQGAGPAGSFLALNKCAAKQIFRRAGLPTADWDFVPAFPGKDWQ--PRLPYPLFVKSNTG
DDL_MESSB       QGVLEYLGIPYTHSGVLASALAMDKDLAKTVAKSAGIPVASSRVMNRFEIGDKHPMEP---PYVVKPVAE
DDL_LACBA       QGLFRLLKKPFVGSGVLASAVSFDKDMTKQVLTAHGIRNTKYVVLTPDNDFDYATIQSLGDNVFIKPANQ
DDL_DESDG       QALLETAGVPYQGSGPAGSFLALNKAAAKEVFVRNGLPTPEWVFLPAHPGADWE--PPFAFPAFIKSNNG
DDL_BORA1       QGALELLNIPYTGSGVTASALAMDKIMTKRVWLQHGLPTPAFEEIDSDTEL-RRVPDRLGLPLILKPPHE
DDL_YERPY       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_YERPS       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_YERPP       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_YERPN       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_YERPG       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_YERPE       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_YERPB       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_YERPA       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_YERP3       QGVLEFLQLPYTGSGVMASALTMDKLRTKLVWALGYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHE
DDL_THIDA       QGALELLGIPYTGSGVMASAVGMDKWRTKLLWRAAGLPTADWAMLDATS--DFAATERLGLPIFVKPARE
DDL_RHOPB       QGVLETLGIPYSHSGVLASALAMQKDLAKTVMATAGVPVAEGLTLS---RAEVAKRHVMAPPYVIKPVAD
DDL_LAWIP       QALLERVGCPYQGASPAGSXXXXXXXXXXXXFRREGLLTPKSVFLPLKPEVTWEP--GLNYPIFVKSNIG
DDL_JANMA       QGALEQLGIPYTGPGVMASAIAMDKVITKRVCLSHGVPTPKFTAL-EVEATTAEQLQEFGMPLMLKAPHE
DDL_LEPBL       QGFLRVLGVPYTGSGVAASALAMDKTRANQIFLQSGQKVAPFFEVEKLPEETVIKLMSLGFPQFLKPVEG
DDL_LEPBJ       QGFLRVLGVPYTGSGVAASALAMDKTRANQIFLQSGQKVAPFFEVEKLPEETVIKLMSLGFPQFLKPVEG
DDL_FLAJ1       QAYFELIGLPQSSCDYYQSALTFNKRDLLSVLKPYGIKTAISYYLNKGDEINTEIVKKVGLPCFVKPNKA
DDL_FINM2       QGFIKVLDLPFVGCNVLGSALCMDKGYTNDIFELNKIPQAKYVVLCKNDDYNLKEIEKTSKAVYVKPCNA
DDL_WOLPM       QGLLEILGIKYTHSGVMASAVAINKVMSKHIFRSLNIDTPKGYVISREDVL--KNNIKIDYPYVLKPINE
DDL_RALSO       QGLLEQFGIPYTGSGVLASALAMDKEATKRLWQTHSLPTPDFVMLHA--GADWQAVDRLGLPLIVKPARE
DDL_OLICO       QGVLETLGIPYSHSGVLSSSLAMRKDLAKTVMATAGVPVAEG---LTLTRAEIAKAHVMAPPYVIKPVAD
DDL_CORA7       QGLFELSGIPYVGAGVLASAVGMDKEFTKKLLVAEGLPVAPQEVLTGEATLDDLQKERLGLPVFVKPARG
DDL_WOLWR       QGLLEILGIKYTHSGVMASAVAINKVMSKHIFRSLNIDTPKGYVISREDVL--KNNIKIDYPYVLKPINE
DDL_HALOH       QGFLDCLDIPYIGASVLSSAAGMDKEIMKNLFSYHKIPQARYRVYNGLDGIISEIDRFLGWPCFVKPANM
DDLB_XANCP      QGLMEAFGVPYTGSNVLGSALSMDKIRTKQVWLSLGLSTPRYARLXXXXXXXXXXXXXIGLPVIVKPANE
DDL_AZOSE       QGLLELLKIPYTGSGVMASALAMDKWRTKMVWAACGLPTPRYAILAG--DTDWEAVAELGLPIFVKPVHE
DDL_ANADE       QGLLESMAIPYTGSGVLASAMGMDKTVSKAIFRSLGLAVADYRVFPGVDDLPF------GLPCVVKPAGE
DDL_ANASK       QGLLESMAIPYTGSGVLASAMGMDKTVSKAIFRSLGLAVADYRVFASAGSIGVGDLP-FGLPCVVKPAGE
DDL_ANAD2       QGLLESMAIPYTGSGVLASAMGMDKTVSKAIFRSLGLAVADYRVFASAGSIGVGDLP-FGLPCVVKPAGE
DDL_BORPA       QGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAFEVLGGSTELRLVP-DRLGLPLILKPPHE
DDL_COREF       QGMFALSDIPVVGPGVLSSAAGMDKEFTKKLMAAEGLPIGREVILRDRAELTDAEKKLLGLPVFVKPARG
DDL_VEREI       QGALELLGIAYTGSGVMASSMALDKTMSKRIWRSEGLPTPDWRLVTSGAEAG-QALQTLGAPMIVKPARE
DDL_BORPE       QGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAFEVLGGSTELRLVP-DRLGLPLILKPPHE
DDL_BORBR       QGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAFEVLGGSTELRLVP-DRLGLPLILKPPHE
DDL_RHOP5       QGVLETLAIPYSHSGVLASALAMQKDLAKTVMKTAGVPVAE-GLTLSRDEIARGHV--MEPPYVIKPVAD
DDL_PSEMY       QGLLECAGIPYTGSGILASALAMDKLRTKQVWHSLGLPTPRHAVLTSQADCEAAAAE-LGFPLIVKPAHE
DDL_METPB       QGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRV---VNRHDAAKSHPLTPPYVVKPIAE
DDL_LEPBP       QGFLDTLGIPHTGSGVLASSLAMDKYRANILFEAMGIPVAPFLELEKGKTDPRKTLLNLSYPVFIKPTLG
DDL_LEPBA       QGFLDTLGIPHTGSGVLASSLAMDKYRANILFEAMGIPVAPFLELEKGKTDPRKTLLNLSYPVFIKPTLG
DDL_SOLUE       QGLLELADLPYVGAGVLGSAVSMDKEMMKRVCKERMLPIVDYVTVTRQTPSIVDACRRLPFPMFVKPANL
DDL_METEP       QGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRV---VNRHDAAKSHPLTPPYVVKPIAE
DDL_COLP3       QGALEYLDIPYTGSNVLGSSLSMDKVRSKQIFKACGIPTAPFTVVNKAETLSLENIADLGGRVMVKPANE
DDL_BURPP       QGALDFYGIKYTGSGVLGSALGLDKFRTKLVWQQLGIPTPPFEAVLRGDDYEKEIVAKLGLPLFVKPASE
DDL_AZOSB       QGALELMGIPYTGSGVMASALAMDKWRTKMVWLSCGLPTPRYAILDA--DSDFDAIRDLGLPIFVKPVHE
DDL_NITOC       QGVLETLNLPYTGSGVLGSALTMDKLRSKRLWRGMDLPTADFSVLTR-DTNPALIAADLGLPLIVKPARE
DDL_BACSK       QGMFRLANLPFVGSNVLGSAVSMDKDIAKRLLQGAGLHVASGLTFAAKETIDFESIDQLGLPLFIKPANQ
DDL_METC4       QGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRV---VNRHDAAKSHPLTPPYVVKPIAE
DDL_HALHL       QGLLDLLGIPYTGSGVLGSALGMDKWRCKRLWQGSGLPTPAGQLLTGDRPV---LDEGVGYPVIVKPARE
DDLB_PSEAE      QGLLECAGIPYTGSGVLASALAMDKLRTKRVWLSLGLPTPDYAVLASEDDCR-EAAQRLGFPLIVKPAHE
DDL_LACPL       QGLFKLLKKPYVGSGVLASAASFDKDITKQILTHHHIQNTKYVVVTNRDQMTYAYLQHVGDHLFIKPANQ
DDL_LACF3       QGLFRLLKKPYIGSGIASSAMSFDKDLTKRILNQAGIRNTKYLLVTNKDQYSWSRIEELGDLVFVKPAKQ
DDL_PROMH       QGLLHMIDMPYVGPNIMSSAACMDKDITKRLLDDAGLAVAPFLMAHQLNDISYEVVEQLGLPLFIKPANL
DDL_PSEPF       QGLLEVAGIPYTGSGILASALAMDKLRTKQVWHTLGIPTPRHAVLRSEADCISAATE-LGFPLIVKPAHE
DDL_FUSNN       QAVLDILGKKYTGSGVLASAITMDKDKTKQIAQSVGIKTPK----------SYRPVEEIRFPVIIKPVDE
DDLB_CLOTE      QGLCKLVGLPCVGPGVLSSALCMDKIYTKYVLENFKFKQANYXXXXXXXXXXXXXXXXLQYDVFIKPANS
DDL_LEGPL       QGLLELAGVAYVGCDVLSSAIGMDKDMARRLACINGLKSARYKLLSERQQFCHEVASEFGWPLFVKPCSL
DDL_LEGPH       QGLLELAGVAYVGCDVLSSAIGMDKDMARRLACINGLKSARYKLLSERQQFCHEVASEFGWPLFVKPCSL
DDL_LEGPC       QGLLELAGVAYVGCDVLSSAIGMDKDMARRLACINGLKSARYKLLSERQQFCHEVASEFGWPLFVKPCSL
DDL_LEGPA       QGLLELAGVAYVGCDVLSSAIGMDKDMARRLACINGLKSARYKLLSERQQFCHEVASEFGWPLFVKPCSL
DDL_PARD8       QGYFDMIGMPYSSCGMLVSALTFNKYVCNHYLKFGVKIAASIHLFKGETITDEEVVTRLGLPIFVKPNDG
DDL_HERA2       QGVFEFANLPYVGCGVLAASVGMDKGLMKSAFAAAGLPQVPWQLVLRRDEAVYERLETLHYPMFVKPANL
DDL_WOLPP       QGLLEILGIKYTHSEVMASAVAMNKVMSKHIFHSLNIDTPRGYVISREDVL--KNNIKVDYPYVLKPINE
DDL_MARAV       QAILGQAGIPYTGSEVLASALAMDKLRTKYVFEGCGLPTPAFRAMTSVGEAE-GIVAALGTPLSVKPAHE
DDL_NEIG2       QGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVL--YDDTDFDAVEKLGLPMFVKPAAX
DDL_NEIG1       QGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVL--YDDTDFDAVEKLGLPMFVKPAAX
DDL_BUCBP       QSVLKYLNIPFTGSKTLPSAISINKFKTKLLWQSFNLPVVPYEXXXXXXXXXXXXISLLGLPIIVKPNQE
VANA_ENTFC      QGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR---PVAATFTYPVFVKPARS
DDL_BEII9       QGVLEMLAIPYTHSGVLASALAMRKDRARDVLAAAGVPIAKG---VTVDRLEAAQRHILPPPYVIKPLGE
DDL_NEIMA       QGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVLH--DDTDFDAVEKLGLPMFVKPAAE
DDLB_RHILO      QGILEYLGIPYTHSGVLASALAMNKEQAKKIVKTVGVPVAESKV---ANRFAIQNKHPMKPPYVIKPVNE
DDLA_SALTY      QGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRFSFAEVESLGLPLFVKPANQ
DDLA_SALTI      QGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRFSFAEVESLGLPLFVKPANQ
DDL_PSEPG       QGLLECLGIPYTGSGILASALAMDKLRTKQVWQSLGIPTPRHAVLASESDCLQASTE-LGFPLIVKPAHE
DDL_PSEE4       QGLLECLGIPYTGSGILASALAMDKLRTKQVWQSLGIPTPRHAVLASEQDCVAASAE-LGFPLIVKPAHE
DDL_WOLTR       QGLLEILGIKYTHSGVMASAIAMNKAMSKHIFRSLGIDTPKGYIISRGDIL--KNNIKIDYPYVLKPINE
DDL_CLONN       QGLCKLLTIPCVGPGVMSSAVCMDKVYTKYVLENFGVKQADYVVVNAHDKMDISTIENLGYDVFIKPSNS
DDL_NEIMF       QGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVLH--DDTDFDAVEKLGLPMFVKPAAE
DDL_ALCBS       QGVLEHLEIPYTGSGVMASAIGMDKVRTKQLWKGAGLPTPAF-YVAGREEAE------LGFPVIVKPAHE
DDLB_PSEPK      QGLLECLGIPYTGSGILASALAMDKLRTKQVWQSLGIPTPRHAVLASESDCLQASTE-LGFPLIVKPAHE
DDL_PELUB       QAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYXXXXXXXXXXXXXXXXXXFPVVVKPINE
DDL_NEIMB       QGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVLH--DDTDFDAVEKLGLPMFVKPAAE
DDL_CLOTH       QGLFELAGIPYVGCGVLASAVGMDKIYAKIIFEKAGIPQARKEIYGDVEGVVDKIEEKFSYPVFVKPSNA
DDL_BURP8       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQLGIPTPPFEAVLRGD--DYAAVAKLGLPLFVKPASE
DDL_ERYLH       QGMLDLMGVPYTHSGLATSVIAIDKELTKQQLVPRGIPMPGGRIVQSEDL--YQQ-DPLARPYVLKPVNE
DDL_BURTA       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGD--DYDIVAKLGMPLFVKPASE
DDLA_SHIFL      QGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANNISFAEVESLGLPLFVKPANQ
DDLA_RHILO      QGYAEVADVAYVGCGILASAAAMDKDVAKRLLREAGLAVARSVTVLKGDVGSFQEIAGLGLPFFAKPARQ
DDLA_ECOLI      QGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANNISFAEVESLGLPLFVKPANQ
DDLA_ECOL6      QGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANNISFAEVESLGLPLFVKPANQ
DDLA_ECO57      QGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANNISFAEVESLGLPLFVKPANQ
DDL_GEOKA       QGLLEILNIPYVGNGVLASAVGMDKVMMKNLFAQAGLRQAKYIAVTKYDETVYDRIEELGYPCFVKPANA
DDL_BURPS       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAQDIVAKLGVPLFVKPASE
DDL_BURP1       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAQDIVAKLGVPLFVKPASE
DDL_BURP0       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAQDIVAKLGVPLFVKPASE
DDL_BURMS       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAQDIVAKLGVPLFVKPASE
DDL_BURMA       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAQDIVAKLGVPLFVKPASE
DDL_BURM9       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAQDIVAKLGVPLFVKPASE
DDL_BURM7       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAQDIVAKLGVPLFVKPASE
DDL_XANP2       QGILEILRIPYSHSGVLASALAMDKAQARIMLAAAGVPVAKGGLVSRAEA---AKAHIMPTPYVLKPNAG
DDL_RHOSR       QGLLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGLPIGQVVLRPGTATLTDEQKSRLHLPVFVKPARG
DDL_METSB       QGVLEMLAIPYTHSGVLASALAMQKDRAKDVLRAAGVPVAEG---VTIGRFEAAKAHVMTPPYVVKPLGE
DDL_LACS1       QGLFRLLNKPWIGSGVASSGVSFXXXXXXXXXXXNGIRNTKYVLVTPENKADYKVAEELGETLFVKPARQ
DDL_LACRD       QGLFKLLNKPYVGSNIAASAMSFDKDLTKKIISQAGIRNTPYVVVTPENQADYSRIEKLGNLTFVKPAKQ
DDL_FLAPJ       QSYWELIDIPYTGCNFYQSALTFNKRDTLSVLTKFNIPKAKSIYLRKGDVIDGNEIKKLGLPFFVKPNQS
DDL_AZOC5       QGILEILRIPYSHSGVLASALAMDKARAKVVMAAAGIPVPGGHLVTRAEA---AKGHVLPPPYVLKPNTG
DDLB_PSESM      QGLLECLEIPYTGSGVLASALAMDKLRTKQVWQSLGPATPLHAVLENENDCICAATE-LGFPLIVKPAHE
DDLB_BACCR      QGLLELMNIPYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYSFIRSAWEKNYSKVEDLGYPCFVKPANL
DDL_POLSQ       QGLLELLELPYTGSGVLASALAIDKIATKQIWISNGLSTPEYEELTAKSDWN-AVVKHLGLPLIVKPAHE
DDL_XYLFT       QGLMQAFGVPYTGSDVLGSALSMDKVRTKQVWLALGLPTPRYASLSCATAVEVRKVEMLGFPVIIKPAKE
DDL_PROVI       QGFLDTVAIPYTGCGVTASALTMDKALSKLCVSEAGIAVADWE--KSPEQILSSIPETLIYPVFVKPAHL
DDL_METCA       QGALACLRVPCTGSGVLASALSMDKLRTKLCWTGAGLPTPPWLRLDSPDDLERCR-QALGFPVIVKPAEE
DDL_BURP6       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAQDIAAKLGVPLFVKPASE
DDL_RHOOB       QGLLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGLPIGQVVLRPGTATLTDEQRSRLHLPVFVKPARG
DDL_METRJ       QGLLEILKIPYTHSGVLASALAMNKERAKTVMRAAGVDVPEGRI---VNRREAARTHPLPPPYVVKPIAE
DDL_IDILO       QGALQILEMPYTGSDVLGCALGMDKVRCKQIWHSVGLPTANWRVVTQIEQVNVEALQELGGRVIVKPARE
DDL_GEOTN       QGLLEMLNLPYVGNGVLASAVGMDKVVMKNLFAQAGLRQAKYVSVTKYEEAVYDRIEELGYPCFVKPANA
DDLA_CHRVO      QGLLRMANIPFVGAGVLGSAVCMDKDVAKRLLRDAGLKVAPFVSLSKAAGADLSAIEQLGLPLFVKPANQ
DDL_CHLPD       QGLLDTFGIPYTGCGVLASAVAMDKALTKLCVTEAGIATAPGITILSSEYFADPKSEQFTWPVFVKPASL
DDL_CHLCH       QGFLETCGIPYTGCGVLASALTMDKALTKLCVADAGIAVAQGTNILSADAVEASVEAQVSYPLFVKPASL
DDL_XYLFA       QGLMQAFGVPYTGSDVLGSALSMDKVRTKQVLALGTPRYASLSVCATAVEV-RQAVEMLGFPVIIKPAKE
DDL_GLUOX       QGVLEWLGLPYTHSGIRASAVAMDKGATRILLAAAGLPVAQGRVV-TVEEL--AEADPLPAPYVIKPVAE
DDL_CLOCE       QGLFELAGIPYVGCGVLGSAVGMDKAYTKIIFEKEGLPQGRKQVYNRIEDVVAQIEGRLTYPCFVKPSNA
DDL_BACFR       QGYFDMMRIPYSCCGVLAAAITYDKFVCNQYLKAFGVRISESLLLRQGQAVDEDVVEKIGLPCFIKPNLG
DDL_BACFN       QGYFDMIRIPYSCCGVLAAAITYDKFVCNQYLKAFGVRISESLLLRQGQAVDEDVVEKIGLPCFIKPNLG
DDL_STRAW       QGLLELSGVPYVGAGVLASAVGQDKEYMKRVFSFGVIRPREWERDESAARVDF--AGEHGWPLFVKPARA
DDL_RHOE4       QGLLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGLPVVQVVLRPGIATLTEEQKAELGLPVFVKPARG
DDL_LACCB       QAVFDINGVKYTGSGPLASGITMNKVFSKEVMLYHGIQTSGFKEFKR-DQGPKQTVP-FDFPVVVKPTSG
DDL_LACC3       QAVFDINGVKYTGSGPLASGITMNKVFSKEVMLYHGIQTSGFKEFKR-DQGPKQTVP-FDFPVVVKPTSG
DDL_STRGG       QGLLELSGVPYVGAGVLASAVGQDKEYMKRVLSFGVVRPREWDNPAAARERIVDFAGEHGWPLFIKPARG
DDL_NOVAD       QGLMDIMGLTYTHSGLVTSVIAIDKELTKQALVPHGIPMPGGRMVKTA---DLYKADPLPRPYVLKPVNE
DDL_BACV8       QGYFDLLGIPYSSCNVLVSAMTFNKFTCNQYLKGFGIRVAESLILRKGFEIDEEVINKIGLPCFIKPNAG
DDL_SACD2       QAVLDWLAIPYTGSDHAASALAMDKLKTKQV--WQSVGLVTPEYASLVENSDWQAVDSLGGQGFVKPAHE
DDL_MAGSA       QGVLNLLGVPYTHSGLLASAAAMDKAFARALFASAGIPVAEGRVITRTDR---NGPDPLPRPFVVKPLNE
DDL_DEIRA       QGLLTLAGIPFVGSGVLGSAVSMDKVMTKQVLDSAGIPQVAWRLAQQTPDAVRARAAELGYPLFVKPANL
DDL_BURM1       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRDD--DYEIVAKLGLPLFVKPASE
DDL_PROM1       QGLFKSTGKPFVGSGVLGSALGMDKIAMKSVFKSYNLPQVPYVSLNKADKSIYEQINKINYPCFIKPANL
DDL_PROA2       QGLLDMFSVPYTGCGVHASAMTMDKETTKHIAPYTTIRKLRYQ--QDPQQVVSVILEEFTLPFFVKPASQ
DDL_CORJK       QGVLDLAGVRYVGNGVLASAAGMDKDFTKRLAREAGIPVGEELILFQPRELTAEEKERLGLPVFVKPARG
DDL_BACTN       QGYFDMMHIPYSCCGVLAAAITYDKFTCNQYLKAFGVRIAESLLLRQGQSVDEDVMEKIGLPCFIKPSLG
DDL_AZOPC       QGYLDILNIPYSCCGVLSASITFNKYFCNNYLRGFGVETAKSILLKQREQIISPEIDKLGLPLIVKPNDG
DDL_RHISN       QGILEYLEIPYTHSGVLASALAMDKAQAKHVAKAAGIPVAD---ALIMDRREFGNAHPMKPPYVVKPVRE
DDL_NOCFA       QGMLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGLPVGTQVVLPGTATLTEEQRERLGLPVFVKPARA
DDL_GRAFK       QAYLELIGIPQTSCDYYQSALTFNKRDLISVLRPYGIKAATNYFLNKDQEINTKEIDKVGLPCFVKANRA
DDL_BURCM       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGD--DYDIVAKLGLPLFVKPASE
DDL_MYCSM       QGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEGLPIGDQVVLPGVETLDLEQRERLGLPVFVKPARG
DDL_MYCS2       QGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEGLPIGDQVVLPGVETLDLEQRERLGLPVFVKPARG
DDL_BURCJ       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDLATDIVAKLGLPLFVKPASE
DDL_PROMT       QGLFKSTGKPFVGSGVLGSALGMDKIAMKSVFKSYNLPQVPYISLNKPDKSIYEQINKISYPCFIKPANL
DDL_GRABC       QGVLDWLNIPYTHSGVRASAIAMDKXXXXXXXXXXGLPVAEGRLVT-VEELAEQ--DPLPRPFVIKPANE
DDL_COPPD       QGLLSILHIPYVGSDVRASVITMDKYLTKLVALQSGIPTPSFIYVYDPHLVDYWDVERLGSPFIVKPCDV
DDL_BURCH       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDLATDIVAKLGLPLFVKPASE
DDL_BURCC       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDLATDIVAKLGLPLFVKPASE
DDL_BURCA       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDLATDIVAKLGLPLFVKPASE
DDL_BURA4       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGD--DYDIVAKLGLPLFVKPASE
DDL_AGRT5       QGILEYLAIPYTHSGVLASALXXXXXXXXXXXXXXGIPVAGERV---MNRFDFTSEHPLQPPYVVKPVRE
DDL_SPHAL       QGMLDLMGFRYTHSGLVTSVIAIDKELTKQALVPHGIPMPTGTM---VDSESLFSVDPLPRPYVLKPVNE
DDL_PSEU5       QGLLECAGIPYTGSGILASALAMDKLRTKQVWQSLGLPTPRHAVLAS--EVDCQAAQMLGFPLIVKPAHE
DDL_ALHEH       QGALEALGVPYTGSGVLGCAIGMDKWRTKLLWRGAELPVPPGALLRP-ETNRQALIGSVGLPLMIKPAHE
DDLA_BRUSU      QGLAQVARVPLAGCGIPGSANALDKDIAKRLVNEAGLSTAKSVTITREEVPAFSALEQLGLPIFIKPARQ
DDL_TREDE       QGLFEMADLPYVGGDVMSTSISMDKEKTKMIWDYSGLPIVPYIAIKRQDWDDPEKEKDLEYPLFIKPCRA
VANL_STRCO      QGLLELSGIPYVGCDVQSSALCMDKSLAYVVARSAGIATPDFWTVTGDETIDPGR---LTYPVFVKPARS
DDL_VESOH       QKQLENRGICYTGSDSNASHNSMDKARTKIIWEQHSLTLAP-SIIANIDQ----PINPINFPLAVKPTLE
DDL_THEM4       QGMCEIFGIPYSGCNHFSSAFTMDKVVTXXXXXXXXISVVDFEYTTEINEEFFKRCENLGYPMIVKPARL
DDL_RICCK       SGLLNIMRIPYTHSGVLSSALAFDKIYSRSWFLTNNINMAESIVVNKSDNI---KIEPMKRPYVIKPITQ
DDL_RHIME       QGILEYLEIPYTHSGVLASALAMDKDQAKHVAKAAGIPVAE---ALVMDRRSFGNQHPMKPPYVVKPVRE
DDL_CORU7       QGLFDLLGARYVGNGVLASAAGMDKEFTKKIAREAGIPTGPEVVLHGRTELTDHERELLGLPVFVKPARG
DDL_CHLL2       QGLLDTMGIPYTGCGVSASAIAMDKALTKLCAADAGVATAPSITLDADSYLDPEPVHELGYPLFVKPASL
DDLA_BRUME      QGLAQVARVPLAGCGIPGSANALDKDIAKRLVNEAGLSTAKSVTITREEVPAFSALEQLGLPIFIKPARQ
DDL_STAAT       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAAN       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAAM       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAAE       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAAC       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAAB       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAA9       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAA8       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAA3       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAA2       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAA1       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_BART1       QGILEYLKIPYTHSGVMASALAMDKGRAKIIAANAGVCVAPSRI---MNRFSIGKTHPMEPPYVIKPVCE
DDL_STAAW       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_STAAS       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_DEIGD       QGLLTLAGIPFVGSGVLGSAVSMDKVMTKQVLASVGMPQVAWRLAREWQERPQERAGELGYPLFVKPANL
DDL_BARHE       QGVLEYLKIPYTHSGVMASALAMDKGRAKIVVASVGVSIAPSCVMS---RFAVGKEHPMEPPYVIKPVCE
DDL_BACCN       QGLLELMNIPYVGNGVLASAAGMDKVVMKNIFAEAGLNQAKYSFVRSVWEKNYEKVEELGYPCFVKPANL
DDL_STAAR       QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
DDL_CHLT3       QGLLEMFDVAYVGSGVLASAITMDKAVAKICFEHAGLQVGRREFEENRGSVVARAEKKLRYPMFVKPANM
DDL_BURVG       QGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVLRGD--DYEIVAKLGLPLFVKPASE
DDL_STRCO       QGLLELSGVPYVGAGVLASAVGQDKEYMKAVFTYAVIRPREWEQDRSGAR---KKIVDFGWPLFVKPARA
DDL_PORGI       QGYLDMIGIPYNTGDTLVESLTFNKYVCNRFLSGFGIRIADSMRLTGRDTQPADLIARMGLPLFVKPNVG
DDL_PORG3       QGYLDMIGIPYNTGDTLVESLTFNKYVCNRFLSGFGIRIADSMRLTGRDQPDVADLTRMGLPLFVKPNVG
DDL_CHLPB       QGLLEVFAIPYTGCNVQSSSMTMDKEITKLCAVQAGIHVADYMTVLRPDYLNNRSAKRFAPPFFVKPANL
DDL_PELPB       QGFLDTCNIPYTGCGVLASALTMDKALTKLCVADAGIAVASITLLSAEYHADTEKVEKFIYPFFVKPANL
DDL_RHORT       QGILDIMALPYTHSGRLASAIAMDKPSAKLVFERFAIPVAPHVV---ADRASVLAETAMARPYVVKPLDQ
DDLA_PSESM      QGLLRMLAVPFVGADVLASAACMDKDVTKRLLRDAGIAVAPFMVLNRGEXXXXXXXXXXXXPMFVKPANQ
DDL_THET2       QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----PSMVPFDPPFFVKPANT
DDL_RICBR       PGLLNIMRIPYTHSGVLASSLAFDKVHSRSWFLTNNINMAESIVISKGDNIKTDPIKR---PYVIKPFTQ
DDL_RUTMC       QKQLENRCIRYTGSDSNASHNGIDKARTKIIWKQHNLTLAP-SIVASI----HKPIEPIDFPLMVKPTLE
DDL_BARBK       QGILEYLKIPYTHSGVMASALAMDKGRAKIIAASAGVSVAP-SCVMSRFSLGAE--HPMKPPYVIKPIRE
DDL_TRIEI       QGLLKLMQVPFVGSGVLGSAMGMDKIAMKIAFDHAGLPQVKYQVVTRCDDIE----TTLEYPCFVKPANL
DDL_SINMW       QGILEYLEIPYTHSGVLASALAMDKAQAKHVAKAAGIPVAE---AVVMDRRSFGNQHPMKPPYVVKPVRE
DDL_LACH4       QGLFRLMNKPFVGDDVLAAAVTMDKEFTKILAQRVGVPVADWITIKNNDKLDYEKVEKLGRDMFVKPSNQ
DDL_STRU0       QGFLEILKMPYVGTNILSSSVAMDKITTKRVLESAGIPQVNYTVYIEGNDLETETLETLSFPIFVKPANM
DDL_STAES       QGLFEVLDIPYVGNGVLAASSSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYENLTYPVFVKPANL
DDL_STAEQ       QGLFEVLDIPYVGNGVLAASSSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYENLTYPVFVKPANL
DDL_LISW6       QGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAGVRLIDWEMVSEMEEV-------LTYPVFVKPANL
DDL_LACJO       QGLFRVLDKPFVGDDVLAAAVTMDKEMTKILAQRAGVPVAKWIAVKRFEKLDYEYVSQLGSDLFVKPSNQ
VANB_ENTFA      QGLFELSGIPYVGCDIQSSAACMDKSLAYILTKNAGIAVPEFQMIEKGDK---PEARTLTYPVFVKPARS
DDL_THEAB       QGMLEFLNVPYTGCGMYSSMYTMDKVITKLILKEKNIPVVDFLYTNTNDFLNHCK-EVLEYPMIVKPARL
DDL_SILPO       QGLLEWLRIPYTSSGVLASALAMDKERSKEAYRAAGLPVAASQL---ADRAAIEAAHVMQPPYVVKPYNE
DDL_RICB8       PGLLNIMRIPYTHSGVLASSLAFDKVHSRSWFLTNNINMAESIVISKGDNIKTDPIKR---PYVIKPFTQ
DDL_LISMO       QGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYEMEEVLTYPVFVKPANL
DDL_LISMF       QGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYEMEEVLTYPVFVKPANL
DDL_BAUCH       QGLLRMANLPFVGSTVLGSAVSMDKDIAKRLL-----RDADLEVTPSIENFSYDQITYLGSSLFVKPANQ
DDL_SPHWW       QGMMDLMGLTYTHSGLTTSVIAIDKELTKQQLVPHGIRMPEGIIVESE---SLHAGDPMPRPYVLKPVNE
DDL_PARL1       QGLLEILRVPYTHSGVLASALAMHKERAKFVFRAAGLPVAE-SVVVPREQAAHGHV--MDPPYVIKPVSE
DDL_SILST       QGLLEWLRIPYTHSGVLASALAMDKERSK-----AAYRTAGLPVVDSVAKADVMARHVIAPPYVVKPNNE
DDL_RICFE       PGLLNIMRIPYTHSGVLSSALAFDKIHSRSWFLTNNINMAESIIVNKSDNIKSDPVKR---PYVIKPLTQ
DDL_COXBU       XXXXXXXXXPYVGANVQSSAVCMEKDLTKTVLRAGGIPVVDWHTLSPRDATEYQRLDRWGSELFVKAVSL
DDL_COXBR       XXXXXXXXXPYVGANVQSSAVCMEKDLTKTVLRAGGIPVVDWHTLSPRDATEYQRLDRWGSELFVKAVSL
DDL_COXBN       XXXXXXXXXPYVGANVQSSAVCMEKDLTKTVLRAGGIPVVDWHTLSPRDATEYQRLDRWGSELFVKAVSL
DDL_COXB1       XXXXXXXXXPYVGANVQ