[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81104.1

[Show Plain Result]


## Summary of Sequence Search
    1::235
    1::235     e-133 100%  235 aa  DEOD_CLOPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::235     e-132 100%  235 aa  DEOD_CLOP1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     e-101  74%  232 aa  DEOD_THETN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     e-100  73%  233 aa  DEOD_THEPX RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     e-100  73%  233 aa  DEOD_THEP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     1e-99  74%  233 aa  DEOD_ALKMQ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     9e-99  73%  237 aa  DEOD_CLOB8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     2e-97  72%  236 aa  DEOD_GEOKA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::231     1e-96  73%  236 aa  DEOD_GEOTN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     4e-95  70%  235 aa  DEOD_BACC4 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     5e-95  72%  237 aa  DEOD_EXISA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     5e-95  70%  235 aa  DEOD_BACCZ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::235     8e-95  71%  235 aa  DEOD_EXIS2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACWK RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACHK RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACCR RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACCQ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACCE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACC7 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACC3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACC2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACC1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACC0 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACAN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACAH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACAC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-94  70%  235 aa  DEOD_BACAA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     2e-94  70%  235 aa  DEOD_GEOSW RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     5e-94  70%  235 aa  DEOD_BACCN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::235     1e-91  70%  235 aa  DEOD_CLOTE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     1e-91  69%  234 aa  DEOD_ANOFW RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     2e-91  68%  234 aa  DEOD_BACST RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     7e-91  69%  232 aa  DEOD_BACLD RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     9e-91  67%  235 aa  DEOD_BREBN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::228     1e-90  70%  233 aa  DEOD_BACSU RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     5e-90  67%  235 aa  DEOD_OCEIH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     5e-89  69%  233 aa  DEOD_LISW6 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     5e-89  69%  233 aa  DEOD_LISIN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     7e-89  68%  233 aa  DEOD_LISMO RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     7e-89  68%  233 aa  DEOD_LISMH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     7e-89  68%  233 aa  DEOD_LISMF RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     7e-89  68%  233 aa  DEOD_LISMC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     7e-86  63%  233 aa  DEOD_CLONN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::228     3e-85  65%  232 aa  DEOD_BACA2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     2e-79  61%  233 aa  DEOD_TREPA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     2e-76  58%  236 aa  DEOD2_SHEON RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::236     5e-76  58%  236 aa  DEOD_SHESR RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     5e-76  58%  236 aa  DEOD_SHESM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     2e-75  58%  236 aa  DEOD_SHEAM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     2e-75  57%  236 aa  DEOD_SHEB8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     2e-75  57%  236 aa  DEOD_SHEB5 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     3e-75  57%  236 aa  DEOD_SHEB2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     3e-75  55%  234 aa  DEOD_JANSC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     3e-74  57%  236 aa  DEOD_SHEFN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     4e-74  56%  236 aa  DEOD_SHELP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     4e-74  61%  235 aa  DEOD_LACBA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     6e-74  58%  236 aa  DEOD_SHEDO RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     6e-74  56%  239 aa  DEOD1_VIBPA RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::234     4e-72  54%  236 aa  DEOD_TOLAT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     6e-72  54%  236 aa  DEOD_PSYIN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-71  55%  234 aa  DEOD_COLP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-71  53%  241 aa  DEOD1_PHOPR RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::234     8e-71  59%  237 aa  DEOD_STRPG RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-70  52%  241 aa  DEOD_YERE8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-70  53%  239 aa  DEOD_YERPY RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-70  53%  239 aa  DEOD_YERPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-70  53%  239 aa  DEOD_YERPB RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-70  53%  239 aa  DEOD_YERP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::235     2e-70  60%  237 aa  DEOD_STRSY RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::235     2e-70  60%  237 aa  DEOD_STRS2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     3e-70  52%  239 aa  DEOD_PECCP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     3e-70  52%  239 aa  DEOD_ERWCT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     3e-70  53%  236 aa  DEOD2_VIBCH RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::234     3e-70  53%  239 aa  DEOD1_VIBVY RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::234     3e-70  53%  239 aa  DEOD1_VIBVU RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::236     4e-70  55%  236 aa  DEOD_CHRVO RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-70  52%  238 aa  DEOD_XENNE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-70  53%  238 aa  DEOD_PHOLL RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::235     7e-70  59%  238 aa  DEOD_LACCB RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::235     7e-70  59%  238 aa  DEOD_LACC3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     9e-70  52%  240 aa  DEOD_ACTPJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     1e-69  53%  238 aa  DEOD_PROMH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-69  52%  239 aa  DEOD_ERWT9 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-69  52%  240 aa  DEOD_ACTPL RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-69  52%  240 aa  DEOD_ACTP7 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-69  52%  240 aa  DEOD_ACTP2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-69  53%  241 aa  DEOD1_VIBCH RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::234     2e-69  52%  239 aa  DEOD_YERPP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-69  52%  239 aa  DEOD_YERPN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-69  52%  239 aa  DEOD_YERPG RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-69  52%  239 aa  DEOD_YERPE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-69  52%  239 aa  DEOD_YERPA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-69  52%  238 aa  DEOD_MANSM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-69  53%  239 aa  DEOD_KLEP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     3e-69  52%  238 aa  DEOD_HAES1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     5e-69  53%  239 aa  DEOD_SALTY RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     5e-69  53%  239 aa  DEOD_SALHS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     8e-69  52%  239 aa  DEOD_ENTS8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-68  52%  239 aa  DEOD_HAEPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-68  52%  239 aa  DEOD_CITK8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALTI RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALSV RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALPK RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALPB RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALPA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALNS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALEP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALDC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALCH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-68  52%  239 aa  DEOD_SALA4 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::232     2e-68  52%  233 aa  DEOD_PSEHT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-68  52%  238 aa  DEOD_HAES2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     2e-68  53%  236 aa  DEOD2_VIBPA RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::236     4e-68  53%  236 aa  DEOD2_VIBF1 RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::234     5e-68  52%  239 aa  DEOD_SALAR RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_SHISS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_SHIFL RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_SHIF8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_SHIDS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_SHIBS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_SHIB3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ESCF3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOSM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOSE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOLU RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOLI RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOLC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOL6 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOL5 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOHS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECODH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECOBW RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO8A RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO81 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO7I RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO5E RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO57 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO55 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO45 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO27 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-68  52%  239 aa  DEOD_ECO24 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     9e-68  51%  236 aa  DEOD2_PHOPR RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::233     1e-67  50%  238 aa  DEOD_HAEDU RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     2e-67  57%  237 aa  DEOD_STRGC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     2e-67  53%  236 aa  DEOD_ALISL RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::233     2e-67  57%  234 aa  DEOD_LACLA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     3e-67  57%  236 aa  DEOD_STRZJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::232     3e-67  57%  234 aa  DEOD_LACLS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::232     3e-67  57%  234 aa  DEOD_LACLM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     3e-67  51%  238 aa  DEOD1_VIBF1 RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::233     4e-67  54%  236 aa  DEOD_LACRJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     4e-67  54%  236 aa  DEOD_LACRD RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::235     4e-67  52%  240 aa  DEOD_ENT38 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     6e-67  57%  237 aa  DEOD_STRU0 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     6e-67  57%  237 aa  DEOD_STRPC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     6e-67  57%  237 aa  DEOD_STRPB RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     7e-67  51%  239 aa  DEOD_SALG2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     7e-67  51%  238 aa  DEOD_PASMU RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     7e-67  52%  236 aa  DEOD2_VIBVY RecName: Full=Purine nucleoside phosphorylase deoD-type
    5::236     7e-67  52%  236 aa  DEOD2_VIBVU RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::234     9e-67  57%  236 aa  DEOD_STRZP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     9e-67  57%  236 aa  DEOD_STRPJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     9e-67  57%  237 aa  DEOD_STRPF RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     9e-67  57%  236 aa  DEOD_STRP7 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     9e-67  57%  236 aa  DEOD_STRP4 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     9e-67  57%  236 aa  DEOD_STRP2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     2e-66  56%  236 aa  DEOD_STRTD RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     3e-66  56%  236 aa  DEOD_STRPI RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     3e-66  51%  237 aa  DEOD_EDWI9 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     8e-66  56%  236 aa  DEOD_STRZT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     8e-66  56%  236 aa  DEOD_STRPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     1e-65  50%  236 aa  DEOD_HAHCH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-65  49%  238 aa  DEOD_ACTSZ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     4e-65  50%  234 aa  DEOD_ROSDO RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     4e-65  50%  234 aa  DEOD_DINSH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-62  48%  234 aa  DEOD3_SHEON RecName: Full=Purine nucleoside phosphorylase
    5::234     2e-62  50%  239 aa  DEOD_KLEPN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-61  48%  238 aa  DEOD_HAEIN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-61  48%  238 aa  DEOD_HAEI8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-61  53%  234 aa  DEOD_LACSS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::235     2e-61  49%  237 aa  DEOD_DICNV RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::233     8e-61  49%  239 aa  DEOD_MYXXD RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     8e-61  47%  239 aa  DEOD3_VIBF1 RecName: Full=Purine nucleoside phosphorylase
    3::236     5e-60  44%  236 aa  DEOD_BUCAP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     9e-60  47%  238 aa  DEOD_HAEIG RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-59  46%  238 aa  DEOD_HAEIE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::236     3e-59  47%  236 aa  DEOD1_SHEON RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::214     3e-57  55%  216 aa  DEOD_STRTR RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-55  42%  234 aa  DEOD_BUCAT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     2e-55  42%  234 aa  DEOD_BUCAI RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     3e-55  42%  234 aa  DEOD_BUCA5 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     2e-51  44%  233 aa  DEOD_HELPH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     4e-51  43%  233 aa  DEOD_HELPG RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     6e-51  43%  234 aa  DEOD_HELPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     7e-51  43%  233 aa  DEOD_HELPY RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     7e-51  43%  233 aa  DEOD_HELPJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     2e-50  43%  233 aa  DEOD_HELP2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     1e-49  42%  233 aa  DEOD_HELAH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    5::234     8e-47  37%  238 aa  DEOD_BUCBP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::237     1e-44  43%  238 aa  DEOD_MYCPN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     4e-35  37%  238 aa  DEOD_MYCGE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::218     3e-31  38%  236 aa  MTAP_SULSO RecName: Full=S-methyl-5'-thioadenosine phosphorylase;  
   12::218     5e-23  36%  258 aa  UDP_TREPA RecName: Full=Uridine phosphorylase;       
    6::250     2e-22  32%  252 aa  UDP_HAEIN RecName: Full=Uridine phosphorylase;       
    8::249     2e-20  30%  253 aa  UDP_SALTY RecName: Full=Uridine phosphorylase;       
    8::249     2e-20  30%  253 aa  UDP_SALTI RecName: Full=Uridine phosphorylase;       
    8::249     4e-20  31%  253 aa  UDP_ECOLI RecName: Full=Uridine phosphorylase;       
    8::249     1e-19  29%  253 aa  UDP_KLEAE RecName: Full=Uridine phosphorylase;       
    8::275     2e-11  32%  279 aa  UDP_KLEPN RecName: Full=Uridine phosphorylase;       
   34::215     3e-11  33%  230 aa  MTNN_AERS4 RecName:
   20::215     3e-11  32%  230 aa  MTNN_AERHH RecName:
   35::198     1e-10  28%  231 aa  MTNN_BACHD RecName:
   33::214     2e-10  27%  231 aa  MTNN_HELPY RecName: Full=MTA/SAH nucleosidase;       
   34::227     3e-10  26%  232 aa  MTNN_ENTS8 RecName:
   28::199     4e-10  30%  236 aa  MTNN_SHEB5 RecName:
   28::199     5e-10  30%  231 aa  MTNN_SHEPC RecName:
   28::199     5e-10  30%  236 aa  MTNN_SHEB9 RecName:
   28::199     5e-10  30%  236 aa  MTNN_SHEB8 RecName:
   28::199     5e-10  30%  236 aa  MTNN_SHEB2 RecName:
   28::199     6e-10  29%  236 aa  MTNN_SHESA RecName:
   28::199     6e-10  27%  230 aa  MTNN_SHEDO RecName:
   28::199     8e-10  30%  231 aa  MTNN_SHESW RecName:
   32::199     8e-10  27%  230 aa  MTNN_HELPJ RecName: Full=MTA/SAH nucleosidase;       
   10::199     1e-09  31%  230 aa  MTNN_SHEAM RecName:
   28::199     1e-09  30%  230 aa  MTNN_SHEWM RecName:
   28::199     1e-09  29%  236 aa  MTNN_SHESM RecName:
    6::199     1e-09  28%  230 aa  MTNN_SHEFN RecName:
   36::199     2e-09  30%  236 aa  MTNN_SHEON RecName:
   34::197     2e-09  28%  229 aa  MTNN_HAEIG RecName:
   34::197     2e-09  29%  230 aa  MTNN_HAEI8 RecName:
   20::199     2e-09  27%  230 aa  MTNN_SHESH RecName:
   28::199     3e-09  29%  236 aa  MTNN_SHESR RecName:
   34::215     4e-09  28%  233 aa  MTNN_EXISA RecName:
   34::197     5e-09  29%  230 aa  MTNN_ACTSZ RecName:
   34::197     7e-09  28%  229 aa  MTNN_HAEIN RecName:
   34::215     7e-09  28%  234 aa  MTNN_EXIS2 RecName:
   33::196     1e-08  24%  228 aa  MTNN_STAHJ RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAAW RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAAT RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAAS RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAAN RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAAM RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAAE RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAAC RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAAB RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAA9 RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAA8 RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAA3 RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAA2 RecName:
   33::196     1e-08  25%  228 aa  MTNN_STAA1 RecName:
   28::199     1e-08  27%  230 aa  MTNN_SHELP RecName:
   28::197     1e-08  25%  229 aa  MTNN_HAES2 RecName:
   28::197     1e-08  25%  229 aa  MTNN_HAES1 RecName:
   34::197     1e-08  28%  229 aa  MTNN_HAEIE RecName:
   33::196     2e-08  25%  228 aa  MTNN_STAAR RecName:
   27::214     2e-08  27%  229 aa  MTNN_OCEIH RecName:
   34::197     3e-08  27%  232 aa  MTNN_ESCF3 RecName:
   34::197     3e-08  26%  229 aa  MTNN_BAUCH RecName:
   27::178     4e-08  29%  229 aa  MTNN_MANSM RecName:
   34::198     4e-08  27%  232 aa  MTNN_ANOFW RecName:
   34::213     6e-08  28%  234 aa  MTNN_DESPS RecName:
   20::199     1e-07  27%  230 aa  MTNN_SHEHH RecName:
   35::169     1e-07  29%  231 aa  MTNN_BACSU RecName:
   35::155     1e-07  30%  231 aa  MTNN_BACP2 RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALTY RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALTI RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALSV RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALPK RecName:
   34::197     1e-07  26%  232 aa  MTNN_SALPC RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALPB RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALNS RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALHS RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALG2 RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALEP RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALDC RecName:
   34::197     1e-07  26%  232 aa  MTNN_SALCH RecName:
   34::197     1e-07  27%  232 aa  MTNN_SALA4 RecName:
   34::227     2e-07  24%  233 aa  MTNN_YERPY RecName:
   34::227     2e-07  24%  233 aa  MTNN_YERPS RecName:
   34::227     2e-07  24%  233 aa  MTNN_YERPB RecName:
   34::227     2e-07  24%  233 aa  MTNN_YERP3 RecName:
   20::215     2e-07  27%  235 aa  MTNN_PSEHT RecName:
   34::197     2e-07  28%  229 aa  MTNN_PASMU RecName:
   35::169     2e-07  29%  231 aa  MTNN_BACA2 RecName:
   34::227     2e-07  24%  233 aa  MTNN_YERPA RecName:
   34::197     2e-07  28%  232 aa  MTNN_ENT38 RecName:
   34::227     3e-07  24%  233 aa  MTNN_YERPP RecName:
   34::227     3e-07  24%  233 aa  MTNN_YERPN RecName:
   34::227     3e-07  24%  233 aa  MTNN_YERPG RecName:
   34::227     3e-07  24%  233 aa  MTNN_YERPE RecName:
   33::196     3e-07  25%  228 aa  MTNN_STAES RecName:
   33::196     3e-07  25%  228 aa  MTNN_STAEQ RecName:
   28::199     3e-07  26%  230 aa  MTNN_SHEPA RecName:
   34::197     3e-07  25%  232 aa  MTNN_BUCAT RecName:
   34::197     3e-07  25%  232 aa  MTNN_BUCA5 RecName:
   34::226     4e-07  27%  232 aa  MTNN_ERWCT RecName:
   34::197     4e-07  24%  232 aa  MTNN_BUCAI RecName:
   35::155     4e-07  30%  231 aa  MTNN_BACLD RecName:
   30::219     4e-07  25%  231 aa  MTNN_ALISL RecName:
    1::40      4e-07  58%   42 aa  DEOD_MYCPI RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::227     5e-07  23%  233 aa  MTNN_YERE8 RecName:
   34::226     5e-07  27%  232 aa  MTNN_PECCP RecName:
   30::220     5e-07  29%  243 aa  MTNN_COLP3 RecName:
   34::197     6e-07  27%  232 aa  MTNN_SALAR RecName:
   34::209     8e-07  28%  233 aa  MTNN_SODGM RecName:
   34::219     1e-06  28%  232 aa  MTNN_KLEP3 RecName:
   34::197     1e-06  28%  232 aa  MTNN_CITK8 RecName:
   34::197     2e-06  27%  232 aa  MTNN_ERWT9 RecName:
   30::198     3e-06  24%  231 aa  MTNN_VIBFM RecName:
   30::198     3e-06  24%  231 aa  MTNN_VIBFI RecName:
   30::198     3e-06  24%  231 aa  MTNN_VIBF1 RecName:
   34::214     3e-06  25%  233 aa  MTNN_PHOLL RecName:
   35::155     3e-06  26%  230 aa  MTNN_LYSSC RecName:
   34::219     3e-06  27%  232 aa  MTNN_KLEP7 RecName:
   30::198     4e-06  26%  231 aa  MTNN_VIBVY RecName:
   30::198     4e-06  26%  231 aa  MTNN_VIBVU RecName:
   28::210     4e-06  30%  233 aa  MTNN_LISW6 RecName:
   27::197     4e-06  24%  230 aa  MTNN_HAEPS RecName:
   34::197     5e-06  26%  232 aa  MTNN_SALPA RecName:
   35::156     5e-06  29%  231 aa  MTNN_MARMS RecName:
   30::198     1e-05  25%  231 aa  MTNN_VIBCM RecName:
   30::198     1e-05  25%  231 aa  MTNN_VIBCH RecName:
   30::198     1e-05  25%  231 aa  MTNN_VIBC3 RecName:
   28::210     2e-05  28%  233 aa  MTNN_LISMH RecName:
   28::210     2e-05  28%  233 aa  MTNN_LISMF RecName:
   28::210     2e-05  28%  233 aa  MTNN_LISMC RecName:
   48::218     3e-05  32%  269 aa  MTNN_TREPA RecName: Full=MTA/SAH nucleosidase;       
   34::197     3e-05  25%  232 aa  MTNN_SHISS RecName:
   34::197     3e-05  25%  232 aa  MTNN_SHIFL RecName:
   34::197     3e-05  25%  232 aa  MTNN_SHIF8 RecName:
   34::197     3e-05  25%  232 aa  MTNN_SHIDS RecName:
   34::197     3e-05  25%  232 aa  MTNN_SHIB3 RecName:
   34::214     3e-05  24%  235 aa  MTNN_PROMH RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOUT RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOSM RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOSE RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOLU RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOLI RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOLC RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOL6 RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOL5 RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOK1 RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOHS RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECODH RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECOBW RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO8A RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO81 RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO7I RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO5E RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO57 RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO55 RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO45 RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO27 RecName:
   34::197     3e-05  25%  232 aa  MTNN_ECO24 RecName:
   34::197     4e-05  25%  232 aa  MTNN_SHIBS RecName:
   28::92      5e-05  29%  230 aa  MTNN_SHEPW RecName:
   28::210     5e-05  27%  233 aa  MTNN_LISIN RecName:
   33::196     1e-04  20%  228 aa  MTNN_STACT RecName:
   35::215     1e-04  24%  236 aa  MTNN_GEOTN RecName:
   28::210     2e-04  28%  233 aa  MTNN_LISMO RecName:
   36::215     2e-04  26%  235 aa  MTNN_GEOKA RecName:
   34::198     2e-04  26%  231 aa  MTNN_DESAD RecName:
   30::198     4e-04  22%  231 aa  MTNN_VIBSL RecName:
   30::198     4e-04  22%  231 aa  MTNN_VIBHB RecName:
   30::198     7e-04  23%  231 aa  MTNN_VIBPA RecName:
   29::155     9e-04  26%  232 aa  MTNN_HAEDU RecName:
    1::235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGVPSIS
DEOD_CLOPS      MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGVPSIS
DEOD_CLOP1      MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKKISVQGTGMGVPSIS
DEOD_THETN      MSIHIGAKEGDIAETVLLPGDPLRAKYIAENLLEDAKCYNEVRGMYGFTGYYKGKRVSVQGTGMGVPSIS
DEOD_THEPX      MSIHIGAKENEIAQTVLLPGDPLRAKYIAENFLEDAKCYNEVRGMYGFTGYYKGKRVSVQGTGMGVPSLS
DEOD_THEP3      MSIHIGAKENEIAQTVLLPGDPLRAKYIAENFLEDAKCYNEVRGMYGFTGYYKGKRVSVQGTGMGVPSLS
DEOD_ALKMQ      MSIHIGAKKGEIAETILLPGDPLRAKFIAENFLENIECYNEVRGMYGFTGSYKGKRISVQGTGMGMPSIS
DEOD_CLOB8      MSVHINAPEGAIAESVLLPGDPLRAKFIAENFLEDVVCYNEVRGMYGFTGTYKGKKISVQGTGMGIPSIS
DEOD_GEOKA      MSVHIGAKTGEIAERILLPGDPLRAKYIAETFLEGAVCYNEVRGMLGFTGTYKGERISVQGTGMGVPSIS
DEOD_GEOTN      MSVHIGAKPGEIAEHILLPGDPLRAKYIAETFLEGAVCYNEVRGMLGFTGTYKGHRISVQGTGMGVPSIS
DEOD_BACC4      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_EXISA      MSVHIGAQEGQIAETVLLPGDPLRAKYIAETFLEDVELYNEVRGMYGFTGTYKGKRISVQGTGMGVPSMS
DEOD_BACCZ      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_EXIS2      MSVHINAAEGQIAETVLLPGDPLRAKYIADTFLEDVVLYNEVRGMYGFTGTYKGKKVSVQGTGMGVPSMS
DEOD_BACWK      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACHK      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACCR      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACCQ      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACCE      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACC7      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACC3      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACC2      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACC1      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACC0      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACAN      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACAH      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACAC      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACAA      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_GEOSW      MSIHIEAKQGEIADKILLPGDPLRAQYIAETFLEGATCYNRVRGMLGFTGTYKGHRISVQGTGMGVPSIS
DEOD_BACCN      MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_CLOTE      MSIHINAPEGAIAESILLPGDPLRAKFIADTFLEDVVCYNEVRGMYGFTGTYKGKRVSVQGTGMGIPSMS
DEOD_ANOFW      MSVHIGAKEHEIADKILLPGDPLRAKYIAETFLEGATCYNQVRGMLGFTGTYKGHRISVQGTGMGVPSIS
DEOD_BACST      MSVHIGAKEHEIADKILLPGDPLRAKYIAETFLEGATCYNQVRGMLGFTGTYKGHRISVQGTGMGVPSIS
DEOD_BACLD      MSVHIGAEKGQIAETVLLPGDPLRAKYIADTYLENVECYNEVRGMYGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BREBN      MSIHIGAQQGQIAETILLPGDPLRAKYIAETFLEGAECYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
DEOD_BACSU      MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSIS
DEOD_OCEIH      MSVHIGAKQGEIADKILLPGDPLRAKYIAETFLEEPKLYNEVRGMYGYTGTYKGERVSVQGTGMGVPSIS
DEOD_LISW6      MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSIS
DEOD_LISIN      MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSIS
DEOD_LISMO      MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSIS
DEOD_LISMH      MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSIS
DEOD_LISMF      MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSIS
DEOD_LISMC      MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSIS
DEOD_CLONN      MSTHIGAKQNEIASTVLLPGDPLRAKFIAENFLEDVICYNDVRGMXXXXXXXXXXRVSVQGTGMGIPSIS
DEOD_BACA2      MSVHINAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYNGKKVSVQGTGMGVPSIS
DEOD_TREPA      MSIHLGAKGEDIAPRVLLPGDPLRARFVAERFFHNAYCYNEVRGMLGFTGTYKGVRVSVQGTGMGLPSHS
DEOD2_SHEON     ---HINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCS
DEOD_SHESR      ---HINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCS
DEOD_SHESM      ---HINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCS
DEOD_SHEAM      ---HINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCS
DEOD_SHEB8      ---HINAVEGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCS
DEOD_SHEB5      ---HINAVEGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCS
DEOD_SHEB2      ---HINAVEGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCS
DEOD_JANSC      MTVHIGAAPGDIAETVLMPGDPLRAKWAAERFLENPVCVNEVRGMLGFTGMWRGNRVTIHGSGMGMPSLS
DEOD_SHEFN      ---HINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSCS
DEOD_SHELP      ---HINAVDGAFADTVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGVRISVMGSGMGIPSCS
DEOD_LACBA      MSNHLEAKMGDIADTVLLPGDPLRAKYIAETFLENPVCYNTVRNAFGYTGTYKGKRISVQGTGMGIPSIS
DEOD_SHEDO      ---HINAVPGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGIPSAS
DEOD1_VIBPA     ---HINAEMGAFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMFGYTGTYKGRKISVMGHGMGIPSCS
DEOD_TOLAT      ---HINAKDGAFAETVLMPGDPLRAKYIAETYLENAELVTDVRNMFGYTGFYKGQRVSVMGHGMGIPSCS
DEOD_PSYIN      ---HINAVDGAFAETVLMPGDPLRAKYIAENFLKDAVQVTDVRNMLGFTGTYKGKRVSVMGSGMGIPSCS
DEOD_COLP3      ---HIEAQDGEFAETVLMPGDPLRAKFIADNFLDDAKCITQVRNMLGYTGTYKGKRVSVMGSGMGVPSIS
DEOD1_PHOPR     ---HINAEMGDFADVVLMPGDPLRAKYIAETFLQDVKEVCNVRSMFGYTGTYKGRKISVMGHGMGIPSCS
DEOD_STRPG      MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_YERE8      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLKDVKQVNDVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_YERPY      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_YERPS      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_YERPB      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_YERP3      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_STRSY      MSIHISAKPGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGIPSIS
DEOD_STRS2      MSIHISAKPGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGIPSIS
DEOD_PECCP      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLENAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ERWCT      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLDDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD2_VIBCH     ---HINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRSMFGFTGTYKGKKVSVMGHGMGIPSCS
DEOD1_VIBVY     ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMYGFTGTYKGRKVSVMGHGMGIPSCS
DEOD1_VIBVU     ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMYGFTGTYKGRKVSVMGHGMGIPSCS
DEOD_CHRVO      ---HINAKDGAFAETVLMPGDPLRAQLIAETFLEGAELVTNVRNVFGYTGTYKGKRLSVMAHGMGIPSAS
DEOD_XENNE      ---HINAEMGDFADVVLMPGDPLRAQYIAETFLEDARQVNNVRGMLGFTGTYKGRRISVMGHGMGIPSCS
DEOD_PHOLL      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLENVRQVNDVRGMLGFTGTYKGRPISVMGHGMGIPSCS
DEOD_LACCB      MSTHIDAPKGAIADVVLLPGDPLRAQYIAENFLDNAQRYNTVRNAFGFTGTFEGRRVSVQATGMGIPSIS
DEOD_LACC3      MSTHIDAPKGAIADVVLLPGDPLRAQYIAENFLDNAQRYNTVRNAFGFTGTFEGRRVSVQATGMGIPSIS
DEOD_ACTPJ      ---HINAPEGAFADVVLMPGDPLRAKYIAETFLEDTVQVTDVRNMFGYTGTYKGRRISVMGHGMGIPSCS
DEOD_PROMH      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLQDVRQVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ERWT9      ---HINAEMGDFADVVLMPGDPLRAKHIADTFLQDAVEVNNVRGMLGYTGTYKGRKISVMGHGMGIPSCS
DEOD_ACTPL      ---HINAPEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGRRISVMGHGMGIPSCS
DEOD_ACTP7      ---HINAPEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGRRISVMGHGMGIPSCS
DEOD_ACTP2      ---HINAPEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGRRISVMGHGMGIPSCS
DEOD1_VIBCH     ---HINAQMGDFADVVLMPGDPLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGRKISVMGHGMGIPSCS
DEOD_YERPP      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_YERPN      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_YERPG      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_YERPE      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_YERPA      ---HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_MANSM      MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLENAKEVTNVRNMLGYTGTYKGRPVSVMGHGMGIPSCS
DEOD_KLEP3      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_HAES1      MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNIRNMLGYTGTYKGRKISVMGHGMGIPSCS
DEOD_SALTY      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLENVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALHS      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLENVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ENTS8      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_HAEPS      MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAEQVTNVRNMFGYTGTYKGRRISVMGHGMGIPSCS
DEOD_CITK8      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALTI      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALSV      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALPK      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALPB      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALPA      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALNS      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALEP      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALDC      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALCH      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SALA4      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_PSEHT      ---HINANVGDFAETVLMPGDPLRAKYIAENFLDDAKQVTSVRNMLGFTGTYKGKPVSIMGSGMGIPSMS
DEOD_HAES2      MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNVRNMLGYTGTYKGRKISVMGHGMGIPSCS
DEOD2_VIBPA     ---HINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSCC
DEOD2_VIBF1     ---HINAQAGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRNMFGYTGTYKGKKVSVMGHGMGIPSCC
DEOD_SALAR      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SHISS      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SHIFL      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SHIF8      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SHIDS      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SHIBS      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_SHIB3      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ESCF3      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOSM      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOSE      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOLU      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOLI      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOLC      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOL6      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOL5      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOHS      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECODH      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECOBW      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO8A      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO81      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO7I      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO5E      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO57      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO55      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO45      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO27      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_ECO24      ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD2_PHOPR     ---HINAELGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRSMLGFTGTYKGKRVSVMGHGMGIPSCS
DEOD_HAEDU      MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAEQVTNVRNMFGYTGTYKGRRISIMGHGMGIPSCS
DEOD_STRGC      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_ALISL      ---HINAQVGDFAETVLMPGDPLRAKFIAENFLEDVTQVCDVRNMFGYTGTYKGKKVSVMGHGMGIPSCC
DEOD_LACLA      ---HIEAQKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGIPSIS
DEOD_STRZJ      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_LACLS      ---HIEAQKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGIPSIS
DEOD_LACLM      ---HIEAQKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGIPSIS
DEOD1_VIBF1     ---HINAEMGDFADVVLMPGDPIRAKYIAETFLDDVVQVCDVRNMYGFTGTYKGRKISVMGHGMGIPSCS
DEOD_LACRJ      MSTHINAKMGDYADTVLLPGDPLRAKYIAENFLENVKQVNSVRNAFGYTGEYKGHRISVQGSGMGIPSMS
DEOD_LACRD      MSTHINAKMGDYADTVLLPGDPLRAKYIAENFLENVKQVNSVRNAFGYTGEYKGHRISVQGSGMGIPSMS
DEOD_ENT38      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_STRU0      MSIHISARVGDIADKILLPGDPLRAKFIAENFLEDAVCFNEIRGMLGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_STRPC      MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_STRPB      MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_SALG2      ---HINAEMGDFADVVLMPGDPLRAKHIAETSLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_PASMU      MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLQDVKEITNVRNMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD2_VIBVY     ---HINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSAC
DEOD2_VIBVU     ---HINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGIPSAC
DEOD_STRZP      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_STRPJ      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_STRPF      MSIHISAKKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_STRP7      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_STRP4      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_STRP2      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSIS
DEOD_STRTD      MSIHISAKQGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERVSVMGTGMGMPSIS
DEOD_STRPI      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGMPSIS
DEOD_EDWI9      ---HINAEMGDFADVVLMPGDPLRAKHIAETFLQDVRQVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
DEOD_STRZT      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGMPSIS
DEOD_STRPS      MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGMPSIS
DEOD_HAHCH      ---HIAANPGDFADTVLMPGDPLRAKHIAETYLANPVLVNDVRGMLGYTGEYRGRMLSVMGSGMGVPSIS
DEOD_ACTSZ      MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLDQPELVTDVRNMLGYTGSYKGRRISVMGHGMGIPSCS
DEOD_ROSDO      MTIHIGARPDQIAETVLMPGDPYRARWAAQTFLDGAELVNEVRGMLGFTGTYKGNRVTIQGSGMGMPSLS
DEOD_DINSH      MTIHIGAAPGDIAETVLMPGDPLRAKWAAETFLDDPVCVNEVRGMLGFTGTWCGHRVTIHGSGMGMPSLS
DEOD3_SHEON     MTAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMV
DEOD_KLEPN      ---HINAEMGDFADVVLMPGDPLRANSIAETFLEDAREVNNVRGMLGFTGTYKGRRISVMGHGMGIPSCS
DEOD_HAEIN      MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCS
DEOD_HAEI8      MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCS
DEOD_LACSS      MSTHIEAQQGDIAETVLLPGDPLRAKYIAETFLTDVHRYNTIRNAFGYTGYYKGQAISVQASGMGIPSIS
DEOD_DICNV      MTPHINAPAGAFAETVLFCGDPLRAQFIAHHFLKNAQEITNVRAMLGFTGEYQQHKLSVMGHGMGIPSCS
DEOD_MYXXD      ---HISAAPGDFADVVLMPGDPLRARYISDRFLEGAREVTSVRNMLGFTGTFRGRRVSVMGHGMGVPSIS
DEOD3_VIBF1     ---HINAPLDAFADTILMPGDPLRAKLIAETYLENVVQVTDVRGMLGFTGEFKGRKISVMGHGMGAPSAS
DEOD_BUCAP      -TLHIKSEKNAFSNIVLMPGDPVRAKYIAENYLANPVQINDTRLMLAYTGYYKNKKISVMSHGMGIPSAS
DEOD_HAEIG      MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCS
DEOD_HAEIE      MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCS
DEOD1_SHEON     ---HINANPGDFAKTIIMSGDPLRAKLIAETYLEDVKEVTNVRGILGFTGKYKSKDISIMGHGMGAPSAS
DEOD_STRTR      --------------------DPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERISVMGTGMGMPSIS
DEOD_BUCAT      ---HINSKKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNDTRLMLAYTGFYKNRKISIMSHGIGIPSAS
DEOD_BUCAI      ---HINSKKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNDTRLMLAYTGFYKNRKISIMSHGIGIPSAS
DEOD_BUCA5      ---HINSKKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNNTRLMLAYTGFYKNRKISIMSHGIGIPSAS
DEOD_HELPH      MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCT
DEOD_HELPG      MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCT
DEOD_HELPS      MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCT
DEOD_HELPY      MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGRGISLMGHGMGIASCT
DEOD_HELPJ      MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCT
DEOD_HELP2      MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCT
DEOD_HELAH      MTPHINAKIGDFHPQCILCGDPLRVSYIAKNFLQDAREITNVRNMLGFSGKYKGKEISLMGHGMGIASCT
DEOD_BUCBP      ---HINAKKGDFSDCVLMPGDPLRARYIAKNYLKNAIEVTNIRSMLGYTGRYKGHRISVMSHGIGIPSSL
DEOD_MYCPN      MTPHINAKKDDIAKVVLMPGDPLRAKWIAEQFMEKPRLVNEVRGMLAFTGQYKGKTITIMGHGMGIPSIG
DEOD_MYCGE      MTPHISAKKDDISKVVLMPGDPLRAKWIAEQFLDQAKLVNEVRGMFAYTGQYKSKTVTVMGHGMGIPSIG
MTAP_SULSO      --VHILAKKGEVAERVLVVGDPGRARLLS-TLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIA
UDP_TREPA       ---HIGLKASDIGHYVILPGDPARSEKIAQHF-SHPHKVGHNREYVTYTGTLCETPVSVMSTGIGGPSTA
UDP_HAEIN       ---HLNLTKAQLATLAIVPGDPARSERIAKQ-LDNPEFLTSTREFTSWLGYINGQPIVVCSTGIGGPSTS
UDP_SALTY       ---HLGLTKNDLAQLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
UDP_SALTI       ---HLGLTKNDLAQLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
UDP_ECOLI       ---HLGLTKNDLATLAIVPGDPDRVEKIA-ALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTS
UDP_KLEAE       ---HLGLTKNDLATLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKPVIVCSTGIGGPSTS
UDP_KLEPN       ---HLGLTKNDLATLAIVPGDPERVEKIA-ALMDKPVKLASHREFTSWRAELDGKSLIVCSTGIGGPSTS
MTNN_AERS4      -----------------------------------------------YQGKLAGKEVILTRSGIGKVAAS
MTNN_AERHH      --------------------------------MSNPTTL-QLGGCEFYQGTLAGKEVILTRSGIGKVAAS
MTNN_BACHD      -----------------------------------------------YTGTIEGKEIVLLKSGIGKVNAA
MTNN_HELPY      -------------------------------------------GNVFHKGVYHNKEIIVAYSKIGKVHST
MTNN_ENTS8      -----------------------------------------------YTGTLNGVDVALLKSGIGKVSAA
MTNN_SHEB5      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_SHEPC      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_SHEB9      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_SHEB8      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_SHEB2      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_SHESA      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_SHEDO      -----------------------------------------IAGIEFISGQIAGKDVVITRSGIGKVAAS
MTNN_SHESW      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_HELPJ      -------------------------------------------GNVFHKGVYHNKEIIVAYSKIGKVHST
MTNN_SHEAM      --------------------EPEVAHLIAS--LENPVV-SQIAGIEFTQGELNGKQVIVTRSGIGKVAAA
MTNN_SHEWM      -----------------------------------------IAGIEFVAGTLDGKEVIVTRSGIGKVAAS
MTNN_SHESM      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_SHEFN      ----IGAMEPEVVHLVQAIVDPV---------------HTTIAGIEFISGSIAGKDVVVTRSGIGKVAAS
MTNN_SHEON      -------------------------------------------------GTLAGKDVVVTRSGIGKVAAS
MTNN_HAEIG      -----------------------------------------------FEGKINGKDVALLQSGIGKVAAA
MTNN_HAEI8      -----------------------------------------------FEGKINGKDIALLQSGIGKVAAA
MTNN_SHESH      --------------------------------MENPSS-TTIAGIEFVAGQLAGKDVVVTRSGIGKVTAS
MTNN_SHESR      -----------------------------------------IAGIEFIAGTLAGKDVVVTRSGIGKVAAS
MTNN_EXISA      -----------------------------------------------YEGYLGNMQVVILKSGIGKVNAA
MTNN_ACTSZ      -----------------------------------------------FEGEVNGKSVVLLQSGIGKVAAA
MTNN_HAEIN      -----------------------------------------------FEGKINGKDVALLQSGIGKVAAA
MTNN_EXIS2      -----------------------------------------------YEGLLNSVPVVILKSGIGKVNAA
MTNN_STAHJ      -----------------------------------------------YRGKLNSKEVVLTQSGIGKVNAA
MTNN_STAAW      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAAT      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAAS      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAAN      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAAM      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAAE      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAAC      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAAB      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAA9      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAA8      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAA3      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAA2      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_STAA1      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_SHELP      -----------------------------------------IAGIEFVAGQLEGKEVIVTRSGIGKVTAS
MTNN_HAES2      -----------------------------------------IAGCTIYQGNIQDKEVALLQSGIGKVAAA
MTNN_HAES1      -----------------------------------------IAGCTIYQGNIQDKEVALLQSGIGKVAAA
MTNN_HAEIE      -----------------------------------------------FEGKINGKDVVLLQSGIGKVAAA
MTNN_STAAR      -----------------------------------------------YTGILKDREVVITQSGIGKVNAA
MTNN_OCEIH      ----------------------------------------EVAGCYFYTGHLHDKSVVLLLSGIGKVNAA
MTNN_ESCF3      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_BAUCH      -----------------------------------------------YSGWLHGKKVVLVQSGIGKVSAA
MTNN_MANSM      ----------------------------------------QVAGCTIYEGLINGKQVALLQSGIGKVAAA
MTNN_ANOFW      -----------------------------------------------YSGTLDGANVVLLKSGIGKVNAA
MTNN_DESPS      -----------------------------------------------YTGQINGVEVGLMRCGIGKVNAA
MTNN_SHEHH      --------------------------------MENPSS-TTIAGIEFVAGQLAGKDVIVTRSGIGKVTAS
MTNN_BACSU      ------------------------------------------------TGEYEGTEVILLKSGIGKVNAA
MTNN_BACP2      ------------------------------------------------TGVYEDKEVILLKSGIGKVNAA
MTNN_SALTY      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALTI      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALSV      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALPK      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALPC      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALPB      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALNS      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALHS      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALG2      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALEP      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALDC      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALCH      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SALA4      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_YERPY      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_YERPS      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_YERPB      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_YERP3      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_PSEHT      --------------------------------MQNPQTLTKA-GFTFYTGELAGNTVTLVQSGIGKVAST
MTNN_PASMU      -----------------------------------------------YEGMIHGKAVALLQSGIGKVAAA
MTNN_BACA2      ------------------------------------------------TGSYEGVEVILLKSGIGKVNAA
MTNN_YERPA      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_ENT38      -----------------------------------------------YTGQLNGTDVALLKSGIGKVAAA
MTNN_YERPP      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_YERPN      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_YERPG      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_YERPE      -----------------------------------------------YTGQLNGIDVALLKSGIGKVAAA
MTNN_STAES      -----------------------------------------------YVGKLNHKEVVLTQSGIGKVNAS
MTNN_STAEQ      -----------------------------------------------YVGKLNHKEVVLTQSGIGKVNAS
MTNN_SHEPA      -----------------------------------------IAGIEFVAGQLAGKEVIVTRSGIGKVTAS
MTNN_BUCAT      -----------------------------------------------YIGKFKSHDVFLIKSGIGKVSAS
MTNN_BUCA5      -----------------------------------------------YIGKFKSHDVFLIKSGIGKVSAS
MTNN_ERWCT      -----------------------------------------------YTGQINGVEVALLKSGIGKVSAA
MTNN_BUCAI      -----------------------------------------------YIGKFKSHDVFLIKSGIGKVSAS
MTNN_BACLD      ------------------------------------------------SGFYEGKEVVLLKSGIGKVNAA
MTNN_ALISL      -------------------------------------------GCTFHTGTLNGAEVVLLQSGIGKVAAA
DEOD_MYCPI      ----------------------------------------------------------------------
MTNN_YERE8      -----------------------------------------------YTGQLNGIDVALLKSGIGKVSAA
MTNN_PECCP      -----------------------------------------------YTGQINGVDVALLKSGIGKVSAA
MTNN_COLP3      ----------------------------------------------GYTGQLDGSDVVIVQSGIGKVAAA
MTNN_SALAR      -----------------------------------------------YTGQLNGTDVALLKSGIGKVAAA
MTNN_SODGM      -----------------------------------------------YMGQLHGVEVALVKSGIGKVSAA
MTNN_KLEP3      -----------------------------------------------YTGQLHGVDVALLKSGIGKVAAA
MTNN_CITK8      -----------------------------------------------YTGQLNGTEIALLKSGIGKVAAA
MTNN_ERWT9      -----------------------------------------------YTGTLNGVDVALLKSGIGKVSAA
MTNN_VIBFM      -------------------------------------------GCTFYTGTLNGADVVLLQSGIGKVAAA
MTNN_VIBFI      -------------------------------------------GCTFYTGTLNGADVVLLQSGIGKVAAA
MTNN_VIBF1      -------------------------------------------GCTFYTGTLNGADVVLLQSGIGKVAAA
MTNN_PHOLL      -----------------------------------------------YTGKLNGVEIALLKSGIGKVSAA
MTNN_LYSSC      ------------------------------------------------TGTYEGKEVVLLKSGIGKVNAA
MTNN_KLEP7      -----------------------------------------------YTGQLHGVDVALLKSGIGKVAAA
MTNN_VIBVY      -------------------------------------------GCTFYSGQINGVEVVLLQSGIGKVAAA
MTNN_VIBVU      -------------------------------------------GCTFYSGQINGVEVVLLQSGIGKVAAA
MTNN_LISW6      -----------------------------------------IGGAKFYVGEIAGKEVVLLESGIGKVNAA
MTNN_HAEPS      ----------------------------------------EIAGCKIYEGKINNTDIALLQSGIGKTAAA
MTNN_SALPA      -----------------------------------------------YTGQLNGTEVALLKSGIGKVXXX
MTNN_MARMS      -----------------------------------------------FVGRFEGKDVVLLKSGIGKVNAA
MTNN_VIBCM      -------------------------------------------GCTFYSGQIQGVDVVLLQSGIGKVSAA
MTNN_VIBCH      -------------------------------------------GCTFYSGQIQGVDVVLLQSGIGKVSAA
MTNN_VIBC3      -------------------------------------------GCTFYSGQIQGVDVVLLQSGIGKVSAA
MTNN_LISMH      -----------------------------------------IGGAKFYVGEVAGKEVVLLESGIGKVNAA
MTNN_LISMF      -----------------------------------------IGGAKFYVGEIAGKEVVLLESGIGKVNAA
MTNN_LISMC      -----------------------------------------IGGAKFYVGEIAGKEVVLLESGIGKVNAA
MTNN_TREPA      --------------------------------------------------------------GVGKVNAA
MTNN_SHISS      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SHIFL      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SHIF8      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SHIDS      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SHIB3      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_PROMH      -----------------------------------------------YTGKINGVDVALLKSGIGKVAAA
MTNN_ECOUT      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOSM      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOSE      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOLU      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOLI      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOLC      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOL6      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOL5      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOK1      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOHS      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECODH      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECOBW      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO8A      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO81      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO7I      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO5E      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO57      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO55      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO45      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO27      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_ECO24      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SHIBS      -----------------------------------------------YTGQLNGTEVALLKSGIGKVAAA
MTNN_SHEPW      -----------------------------------------IAGIEFVAGQLAGQEVIVTRSGIGKVTAS
MTNN_LISIN      -----------------------------------------IGGAKFYIGEIAGKEVVLLESGIGKVNAA
MTNN_STACT      -----------------------------------------------YKGYIDNQEVVLTLSGIGKVNAA
MTNN_GEOTN      ------------------------------------------------TGRLDGVEAVLLKSGIGKVNAA
MTNN_LISMO      -----------------------------------------IGGAKFYIGEIASKEVVLLESGIGKVNAA
MTNN_GEOKA      -------------------------------------------------GRLDGVEAVLLKSGIGKVNAA
MTNN_DESAD      -----------------------------------------------HTGRINGVEVALFLCGIGKVNAA
MTNN_VIBSL      -------------------------------------------GCTFFSGQLNGVDVVLLQSGIGKVAAA
MTNN_VIBHB      -------------------------------------------GCTFFSGQINGVDVVLLQSGIGKVAAA
MTNN_VIBPA      -------------------------------------------GCTFFSGQINDVDVVLLQSGIGKVAAA
MTNN_HAEDU      ----------------------------------------EIAGCKIYEGKINNTCVSLLQSGIGKVSAA


                         .         .         *         .         .         .         .:140
query           IYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDT
DEOD_CLOPS      IYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDT
DEOD_CLOP1      IYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDT
DEOD_THETN      IYVNELITSYGVKNLIRIGTCGSLQPDIKIRDIVIAMSASTDSAINKIRFNGMDYAPTASFKLLKKAYDK
DEOD_THEPX      IYVNELINSYNVKNLIRIGTCGSLQPDIKLRDIVIAMSSSTDSAINKIRFNGMDYAPTASFKLLKKAYDK
DEOD_THEP3      IYVNELINSYNVKNLIRIGTCGSLQPDIKLRDIVIAMSSSTDSAINKIRFNGMDYAPTASFKLLKKAYDK
DEOD_ALKMQ      IYVNELISDYGVKNLIRVGTCGAMQEEIQLRDVILAMSASTDSNMNKLRFGGMDYAPTASFRLLKKAYDV
DEOD_CLOB8      IYANELIQSYGVKNLIRVGTCGGYSEKVKVRDLIIAMSASTDSNLNLVRFQGRTFAPTASFELLKPAYDI
DEOD_GEOKA      IYVNELIQSYGVKTLIRVGTCGAIQPDVRVRDVILAMSASTDSNMNRLIFRGRDYAPTADFHLLRTAYEV
DEOD_GEOTN      IYVNELIQSYGVKTLIRVGTCGAIQPDVRVRDVILAMSASTDSNMNRLIFRGRDYAPTADFHLLRTAYDV
DEOD_BACC4      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPTANFDLLKKAYDA
DEOD_EXISA      IYVNELIMSYGAKNLIRVGTAGGIQEDVKVRDVVIAMSASSEMGQNRVRFNGMDYAPTATFDLLHRAYMN
DEOD_BACCZ      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_EXIS2      IYANELVQSYGAKNLIRVGTAGGITPDVKVRDVVIAMSASHDMAQNRVRFNGLDYAPTASFDLLHKAYMT
DEOD_BACWK      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACHK      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACCR      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACCQ      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACCE      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACC7      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACC3      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACC2      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACC1      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACC0      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACAN      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACAH      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACAC      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_BACAA      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
DEOD_GEOSW      IYVNELIQSYGVQTLIRVGTCGAIQKDVNVRDVILAMSASTDSNMNRLTFRGRDYAPTAHFDLLRTAYEV
DEOD_BACCN      IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNINRLTFPGFDFAPAANFDLLKKAYDA
DEOD_CLOTE      IYATELIESYGVKNLIRVGTCGSYVEKVKVRDLIIAMSACTNSNINLVPFKGRTFAPTASFDLLKPAYDI
DEOD_ANOFW      IYVTELMQSYNVQTLIRVGTCGAIQKDVKVRDVILAMTSSTDSQMNRMTFGGIDYAPTANFDLLKTAYEI
DEOD_BACST      IYITELMQSYNVQTLIRVGTCGAIQKDVKVRDVILAMTSSTDSQMNRMTFGGIDYAPTANFDLLKTAYEI
DEOD_BACLD      IYVNELIRSYDVKNLIRVGSCGAIRKDVNVRDVILAMTSSTDSQINRVAFGSIDFAPCADFGLLKAAYDA
DEOD_BREBN      IYANELMQSYGVQNLIRVGTCGAIQEDIKVRDVIIAMSASSESQTNRLLFDQIDFAPTANFELLHKAYQV
DEOD_BACSU      IYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDA
DEOD_OCEIH      IYVNELIQSYDVKKLIRVGTCGAIQKDVNVRDVILAQGATTDSQMNRLIFNGIDYAPIADFELLKNAYDA
DEOD_LISW6      IYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDA
DEOD_LISIN      IYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDA
DEOD_LISMO      IYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDA
DEOD_LISMH      IYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDA
DEOD_LISMF      IYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDA
DEOD_LISMC      IYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDA
DEOD_CLONN      IYANELIESYGVKNLIRVGTCGSINKDIKVRDIILAMGACTNSGTNRMRFNGMDFAPIASFDLLKKAYDI
DEOD_BACA2      IYVNELIQSYDVQNLIRVGSCGAIRNDVKVRDVILAMTSSTDSQMNRVAFGSVDYAPCADFELLNKAYQE
DEOD_TREPA      IYVTELFQDYGVQKAIRVGTAGGLQEEVALKSVVCALGAATDSAINARRFSGMHFAPTASWSLLRTAVSV
DEOD2_SHEON     IYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAIANYELMNAVIES
DEOD_SHESR      IYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAIANYELMNAVIES
DEOD_SHESM      IYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAIANYELMNAVIES
DEOD_SHEAM      IYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAIADYSLLSAVVES
DEOD_SHEB8      IYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNRLRFKGQDFAAIANYELMNAVIES
DEOD_SHEB5      IYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNRLRFKGQDFAAIANYELMNAVIES
DEOD_SHEB2      IYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNRLRFKGQDFAAIANYELMNAVIES
DEOD_JANSC      IYANELLRDYGAKTLIRIGSCGAMQADVKLRDVILAMTASTLSTPSSGIFRELNYAPCADYGLLQAAYKA
DEOD_SHEFN      IYAHELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSRVNRLRFKDNDFAAIADYSLLSAVVDS
DEOD_SHELP      IYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAICDYSLLSAVVKA
DEOD_LACBA      IYTNELISEYGVKTLFRVGTSGGMSPDVHVRDVVLAQAASTDSSIIHNTFGGIYYAAISDFGLLDTAYHV
DEOD_SHEDO      IYAYELIKEYGVKNLIRVGTCGAISTDVKVRDVIIAMGACTDSKVNRLRFKDHDFAAIADYSLLSAVVDS
DEOD1_VIBPA     IYATELIKDFGVKKIIRVGSCGAVNEDIKVRDVVIGMGACTDSKVNRIRFKGHDFAAIADYKMVRAAEDA
DEOD_TOLAT      IYTKELITEYGVKNIIRIGSCGAVRPDVKVRDVIIGMGACTDSKVNRMRFKDHDFAAIADFGLLRKAVTA
DEOD_PSYIN      IYATELFREYGVQNIIRVGSCGAVSRDIKLRDVIIGMGASTDSKANRIRFKGHDFAAIASYELLEKAVNA
DEOD_COLP3      IYATELYKDYGVEKIIRIGSCGAXXXXXXXXXXXXGMAASTDSNVNRQRFHNVDFAACADFSLLKSVVDT
DEOD1_PHOPR     IYATELIKDFGVKKIIRVGSCGAVRDDVKLRDVVIGMGASTDSKVNRIRFGGHDFAAIADFGMVQNAVDA
DEOD_STRPG      IYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDKAYHI
DEOD_YERE8      IYAKELITDFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRLRFKDHDYAAIADFDMTRNAVDA
DEOD_YERPY      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_YERPS      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_YERPB      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_YERP3      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_STRSY      IYAHELINEYGVKKLIRVGTAGSLNEDVHVRELVLAQAAATNSRMINIDWPEYDLPQIADFDLLDKAYHI
DEOD_STRS2      IYAHELINEYGVKKLIRVGTAGSLNEDVHVRELVLAQAAATNSRMINIDWPEYDLPQIADFDLLDKAYHI
DEOD_PECCP      IYAKELITEFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFDMVRNAVDA
DEOD_ERWCT      IYAKELITEFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFDMVRNAVDA
DEOD2_VIBCH     IYVHELIAEYGVKNIIRIGSCGAVRDDVKLMDVVIGMGASTDSKVNRIRFSGHDFAAIADYDLLETAVNQ
DEOD1_VIBVY     IYATELIKDYGVKKIIRVGSCGAVSTDIKVRDVVIGMGACTDSKVNRIRFKGHDFAAIADYKMVXXXXXX
DEOD1_VIBVU     IYATELIKDYGVKKIIRVGSCGAVSTDIKVRDVVIGMGACTDSKVNRIRFKGHDFAAIADYKMVXXXXXX
DEOD_CHRVO      IYTTELIKDYGVKNIIRIGSCGAVTPDIKLRELFVAMGASTDSKVNRMRFNDHDYAAIADYTLLRTVVDT
DEOD_XENNE      IYAKELITEFGVKKIIRIGSCGAVSEDVKIRDVVIGMGACTDSKVNRMRFKDHDFAAIADFDLVRHAVDA
DEOD_PHOLL      IYAKELITDFGAKVLIRVGSCGSVRHDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDLVRNAVDA
DEOD_LACCB      IYVNELIQDYGVKTLIRVGTAGGMGENVKVRDVVLAQGSSTDSSIILNTFGGLYFAPLADFNLLREAANL
DEOD_LACC3      IYVNELIQDYGVKTLIRVGTAGGMGENVKVRDVVLAQGSSTDSSIILNTFGGLYFAPLADFNLLREAANL
DEOD_ACTPJ      IYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRIRFRNNDFAAISDFDMTLAAVQA
DEOD_PROMH      IYAKELITDFGVKVIIRVGSCGAVLPDVELRDVVIGMGACTDSKVNRLRFKDQDFAAIADFELVQNAVSA
DEOD_ERWT9      IYAKELITEFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDFAAIADFDMVRNAVDA
DEOD_ACTPL      IYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRIRFRDNDFAAISDFDMTLAAVQA
DEOD_ACTP7      IYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRIRFRDNDFAAISDFDMTLAAVQA
DEOD_ACTP2      IYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRIRFRDNDFAAISDFDMTLAAVQA
DEOD1_VIBCH     IYVTELIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRIRFKDHDFAAIADYKMVXXXXXX
DEOD_YERPP      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_YERPN      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_YERPG      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_YERPE      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_YERPA      IYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDA
DEOD_MANSM      IYTKELITEYGVKKIIRVGSCGAVRNDVKVRDVIIGLGACTDSKVNRIRFKDNDFAAIADFDMTQAAVQA
DEOD_KLEP3      IYTKELITDFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRLRFKDHDFAAIADFGMVRNAVDA
DEOD_HAES1      IYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVIIGLGACTDSKVNRIRFKDNDFAAIADFGMAQAAVQA
DEOD_SALTY      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALHS      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ENTS8      IYTKELITDFGVKKIIRVGSCGAVRADVKLRDVVIGMGACTDSKVNRLRFKDHDFAAIADFDMVRNAVDA
DEOD_HAEPS      IYAKELITEYGVKKIIRVGSCGAVRQDVKLREVIIGVGACTDSKVNRIRFKDNDFAAIADFDLTLAAVQA
DEOD_CITK8      IYTKELITDFGVKKIIRVGSCGAVRNDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALTI      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALSV      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALPK      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALPB      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALPA      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALNS      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALEP      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALDC      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALCH      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SALA4      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_PSEHT      LYARELIVTFGVKNLIRIGTCGGIGSDVKIRDVIFAQGACTDSNVNRARVRGTDFAAIADFDLLLNGVNA
DEOD_HAES2      IYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVIIGLGACTDSKVNRIRFKDNDFAAIADFGMARAAVQA
DEOD2_VIBPA     IYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNNHDFAAIADFSLLEEAVKQ
DEOD2_VIBF1     IYVHELIAEYGVKNVIRVGSCGAVHDDVKLMDVVIGMGASTDSKVNRIRFNNHDFAAIADFGLLETAVGQ
DEOD_SALAR      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SHISS      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SHIFL      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SHIF8      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SHIDS      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SHIBS      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_SHIB3      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ESCF3      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOSM      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOSE      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOLU      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOLI      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOLC      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOL6      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOL5      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOHS      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECODH      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECOBW      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO8A      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO81      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO7I      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO5E      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO57      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO55      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO45      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO27      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_ECO24      IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD2_PHOPR     IYVHELIKDFGVKNIIRVGSCGAVHDDVKLMDIIIGMGASTDSKVNRIRFNDHDFAAIADFHLLETSVQQ
DEOD_HAEDU      IYAKELITEYGVKKIIRVGSCGAVRADVKLRDIVIGSGACTDSKVNRIRFRDNDFAAIADFEMTLAAYQV
DEOD_STRGC      IYARELIVDYGVKKLIRVGTAGSLNEDVHVRELVLAQAAATNSNIIRNDWPQYDFPQIASFDLLDKAYHI
DEOD_ALISL      IYVHELIAEFGVKNIIRVGSCGAVHDDVKLMDVVIGMGASTDSKVNRIRFNNHDFAAIADFGLLETAVAQ
DEOD_LACLA      IYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIIRNDFPDFDFPQIADFDLLDKAYHI
DEOD_STRZJ      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_LACLS      IYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIVRHDFPDFDFPQIADFDLLDKAYHI
DEOD_LACLM      IYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIVRHDFPDFDFPQIADFDLLDKAYHI
DEOD1_VIBF1     IYMTELIKDFGVKKVIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRIRFKDHDFAAIADYEMVRNAELA
DEOD_LACRJ      IYINELVREFGVKTIIRVGSCGGIAPDVHVRDVLLAQGSSTDSAVTVNTFGGFHYAPLADFKLLDTAYHV
DEOD_LACRD      IYINELVREFGVKTIIRVGSCGGIAPDVHVRDVLLAQGSSTDSAVTVNTFGGFHYAPLADFKLLDTAYHV
DEOD_ENT38      IYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRMRFKDHDFAAIADFGMVRNAVDA
DEOD_STRU0      IYARELIVDYGVKTLIRVGTAGSIDPNVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDIAYHI
DEOD_STRPC      IYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDKAYHI
DEOD_STRPB      IYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDKAYHI
DEOD_SALG2      IYTKELITDFGVKKIIRVGSCGAVRMDVKLSDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
DEOD_PASMU      IYTKELITEYGVKKIIRVGSCGAVRMDVKLRDVVIGFGACTDSKVNRIRFKNHDFAAIADFDMTMAAVQA
DEOD2_VIBVY     IYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNDHDFAALADYGLLEEAVKQ
DEOD2_VIBVU     IYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNDHDFAALADYGLLEEAVKQ
DEOD_STRZP      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_STRPJ      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_STRPF      IYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDKAYHI
DEOD_STRP7      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_STRP4      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_STRP2      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_STRTD      IYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAAATNSNIIRNDWPQYDFPQIANFNLLDKAYHI
DEOD_STRPI      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_EDWI9      IYAKELITDFGVKKIIRVGSCGAVSMDVKLRDVVIGMGACTDSKVNRLRFKDNDFAAIADFDMVRNXXXX
DEOD_STRZT      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_STRPS      IYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHI
DEOD_HAHCH      IYAHELFTQFNVKNIVRIGSCGSIRDEVKVRDIVIGMGAGTDSLVNRVRLNHYDFAAIADYDLLEPVVNA
DEOD_ACTSZ      IYSKELITEYGVKKIIRVGSCGAVRQDVHVRDVIIGLGACTDSKVNRIRFRDNDFAAIADFGMXXXXXXX
DEOD_ROSDO      IYANELISSYNAQTLIRIGSCGGMQPHVAVRDVIIAMSATTITSPSSGIFREVNFAPTAHYDLLXXXXXX
DEOD_DINSH      IYANELITEYGAQTLIRIGSTGAMQNHVALRDVILAMTCSSISTPSSGIFCELNFAPCADWXXXXXXXXX
DEOD3_SHEON     LYGHELINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSSGYHMATSATFSLLHKAYTK
DEOD_KLEPN      IYTKELITDFGVKKIIRVGSCGAVREDVKLREVVIGHGACTDSKVNRLRFKDHDFPAIADFGMVRNAVD-
DEOD_HAEIN      IYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRIRXXXXXXXXXXXXXXXXXXXXX
DEOD_HAEI8      IYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRIRXXXXXXXXXXXXXXXXXXXXX
DEOD_LACSS      IYANELIQFYGVKRLIRVGTCGGLGTDVHVRDVMIAQSASTDSAIIQNTFGGLYYAPTADFKLLMKXXXX
DEOD_DICNV      IYAKELITEYGVKNLIRVGSCGAVLDEIKLHDVIIALSAATDSNVNRLRFRHYDFAATADYSIFSALIAA
DEOD_MYXXD      IYATELIKTYGVRVIIRVGSCGALSTDVKVREVIVATGAGTDSNVNRMRLMGHDFAAVADFTLXXXXXXX
DEOD3_VIBF1     IYFHELMTTYKVKNFIRIGSCGAIHDDVKLKDLIVAIGASTDSKMNRIRFKDNDFAATANYNMLSECVNT
DEOD_BUCAP      LYVRELILEYNVKKIIRVGTCGTIQNNIKLRDIVISMGASTDSKINRIRFNNHDYAAIADFEMIFHAFST
DEOD_HAEIG      IYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRIRXXXXXXXXXXXXXXXXXXXXX
DEOD_HAEIE      IYAKELITEYGVKKIIRVGSCGSVRMDVKVRDVIIGLGACTDSKVNRIRXXXXXXXXXXXXXXXXXXXXX
DEOD1_SHEON     IYFHELMATYGVKNFIRVGSCGAISDNIHLKDLIVAMGASTDSKINRIRFLDHDLAAIANYDLLQACIEV
DEOD_STRTR      IYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAAATNSNIIRNDWPQYDFPQIASFNLLDKAYHI
DEOD_BUCAT      LYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDIVISMGASTDSKVNRIRFNDHDFAAIADFDMIYNXXXX
DEOD_BUCAI      LYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDIVISMGASTDSKVNRIRFNDHDFAAIADFDMIYNXXXX
DEOD_BUCA5      LYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDIVISMGASTDSKVNRIRFNDHDFAAIADFDMIYNXXXX
DEOD_HELPH      IYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMAMGASTDSKTNRVRFLNHDLSATPDFELSLRAYQT
DEOD_HELPG      IYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMAIGASTDSKTNRVRFLNHDLSATPDFELSLRAYQT
DEOD_HELPS      IYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMAMGASTDSKTNRVRFLNHDLSATPDFELSLRAYQT
DEOD_HELPY      IYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQT
DEOD_HELPJ      IYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQT
DEOD_HELP2      IYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQT
DEOD_HELAH      IYVTELVKTYQVKELLRIGTCGAISPKVGLRDIIMVTGASTDSKTNRIRFLNHDLSATPDFELSLRAYQT
DEOD_BUCBP      IYVKELVSEYNVKKIIRIGTCGTVXXXXXXXXXXXCLGASTDSKVNRLRFHDNDFSSVADFYLILDLFXX
DEOD_MYCPN      IYSYELMKFYEVNTIIRIGSCGALQGSLNLQDLIIAAKAWSESIANDMGVEPADKILMASPQLVELAKKT
DEOD_MYCGE      IYSYELMNFYEVETIIRIGSCGALAPQLKLKDLVIASKAWSESIYAKDMGVEIDKILFATSSLVELAKET
MTAP_SULSO      IVLEELAM-LGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGYQYLRDNAC-VASTPDFELTNKLVTS
UDP_TREPA       IGVEELIH-LGAHTFIRVGTSGGMQPDILAGTVVIATGAIRFEGTSK-EYAPVEFPAVPDFTVTAALKHA
UDP_HAEIN       ICVEELAQ-LGVRTFLRIGTTGAIQPHINVGDVLITTAARLDGASH--HFVPLEYPAVANFECTTALYNA
UDP_SALTY       IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDLVTTASVRLDGA--SLHFAPMEFPAVADFACTTALVEA
UDP_SALTI       IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDLVTTASVRLDGA--SLHFAPMEFPAVADFACTTALVEA
UDP_ECOLI       IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDLVTTASVRLDGA--SLHFAPLEFPAVADFECTTALVEA
UDP_KLEAE       IAVEELAH-VGVRTFLRIGTTGAIQPHINVGDVLVTTGSRLDGA--SLHFAPMEFPAVADFACTTALVEA
UDP_KLEPN       IRVEELASTLGVDSRTRIGTTGAIQPHINVGDVLVTTAS--------VRLDGLHFAP-MEFPAVETS--T
MTNN_AERS4      VATSLLLEKFAPDCVINTGSAGGFAQDLHIGDMVIA---------DEMRFHDVDVTQPAAFKLIAVAQDC
MTNN_AERHH      VATSLLLEKFAPDCVINTGSAGGFAQDLHIGDVVIA---------SEMRFHDVDVTQPAAFTLIAVAQDC
MTNN_BACHD      IGTTLLIQLFQPTAIINTGSAGGLDSSLHVGDLAISTENDVDATVFGYEFGQVPQMPAPDDMLIDIAIEA
MTNN_HELPY      LTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESSESLNALAKEV
MTNN_ENTS8      MGATLLLEHCKPDVIINTGSAGGLAPSLKVGDIVVSDERYHDADVTAFGYEGCPAAFKADEKLIAAAQET
MTNN_SHEB5      IATTLLIEKYAPDAMINTGSAGGFVDTLAIGDIVISSERHHDYEIGQMAQQPAAFIPAA--HLVEAANKA
MTNN_SHEPC      IATTLLIEKYAPDAVINTGSAGGFVDTLAIGDIVISSERHHDYEIGQMAQQPAAFIPAA--HLVEAANKA
MTNN_SHEB9      IATTLLIEKYAPDAVINTGSAGGFVDTLAIGDIVISSERHHDYEIGQMAQQPAAFIPAA--HLVEAANKA
MTNN_SHEB8      IATTLLIEKYAPDAVINTGSAGGFVDTLAIGDIVISSERHHDYEIGQMAQQPAAFVPAA--HLVEAANKA
MTNN_SHEB2      IATTLLIEKYAPDAVINTGSAGGFVDTLAIGDIVISSERHHDYEIGQMAQQPAAFIPAA--HLVEAANKA
MTNN_SHESA      IATTLLIEKYAPDAVINTGSAGGFADSLSIGDIVISSERHHDVDVTAFGYEGQMAQQPAAFYLVEAANKA
MTNN_SHEDO      IATTLLIEKFAVTQVVNTGSAGGFVDSLKIGDIVISSERHHDVDVTAFGYEIGQMAQQPAAFIPDAALVE
MTNN_SHESW      IATTLLIEKYTPDAVINTGSAGGFVDTLAIGDIVISSERHHDYEIGQMAQQPAAFIPAA--HLVEAANKA
MTNN_HELPJ      LTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESSGSLNALAKKI
MTNN_SHEAM      LATTLLIDKFAPDYVINTGSAGGFVDSLTIGDVVIG---------SEVRYHDVDVAFVCDAHLVEAAKNA
MTNN_SHEWM      IATTLLIEKYTPDAVINTGSAGGFVDTLAIGDIVISSERHHDVDVTAFGYEGQMAQQPAAFEKLKAAANK
MTNN_SHESM      IATTLLIEKYAPDAVINTGSAGGFVDSLSIGDIVISSERHHDVDVTAFGYEGQMAQQPAAFYLVEAANKA
MTNN_SHEFN      IATTLLIEKFAATHVINTGSAGGFVDSLAIGDIVISSERHHDVDVTAFGYEGQMAQQPAAFTLVNAAKSA
MTNN_SHEON      IATTLLIEKYAPDAVINTGSAGGFVDSLSIGDIVISSERHHDVDVTAFGYEGQMAQQPAAFYLVEAANKA
MTNN_HAEIG      IGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISETRYHDADVTAFGYKGQLPANPAAFKLADLAQEI
MTNN_HAEI8      IGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISETRYHDADVTAFGYKGQLPANPAAFKLADLAQEM
MTNN_SHESH      IATTLLIEKYAPDAIINTGSAGGFADELAIGDIVISSERHHDVDVTAFGYEIGQMAQQPAAFIPDTALVT
MTNN_SHESR      IATTLLIEKYAPDAVINTGSAGGFVDSLSIGDIVISSERHHDVDVTAFGYEGQMAQQPAAFYLVEAANKA
MTNN_EXISA      IGTTLLIDKFKPDVVINTGSAGGFKKGMKVGDVVVSTERHHDVDVTAFGYEGMPPAYEADAKLVSVCKDV
MTNN_ACTSZ      IGTTVLLQGFKPDVVINTGSAGGVAQGLKVGDIVISTTAYHDADVTAFGYKGQLPACPATFKLTALAEKI
MTNN_HAEIN      IGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISETRYHDADVTAFGYKGQLPANPAAFKLADLAQEI
MTNN_EXIS2      IGTTLLLDHFKPSSVINTGSAGGFRAGLKVGDVVVSTERHHDVDVTAFGYEGMPAAYTADPKLIATA-EA
MTNN_STAHJ      ISTTLIIEKFNPKLIINTGSAGALDESLSVGDMLISVYHDVDATAFGYKLGQIPQMPKSDQELLKSVETV
MTNN_STAAW      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAAT      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAAS      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAAN      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAAM      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAAE      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAAC      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAAB      ISTTLLINKFKPDIIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAA9      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAA8      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAA3      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAA2      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_STAA1      ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQIPQMPVASKPLIEKVSQV
MTNN_SHELP      VATTLLIEKYAPDYVINTGSAGGFVDSLAIGDIVISSERHHDVDVTAFGYEGQMAQQPAAFTLVEAAKKA
MTNN_HAES2      MGTTLLLQMFKPDIVINTGSAGGVSSGLKVGDVVVSTQTYHDADVTAFGYGQLPACPPAFIKLTALVENV
MTNN_HAES1      MGTTLLLQMFKPDIVINTGSAGGVSSGLKVGDVVVSTQTYHDADVTAFGYGQLPACPPAFIKLTALVANV
MTNN_HAEIE      IGTTALLQLAKPDLVINTGSAGGVAKGLKVGDIVISETRYHDADVTAFGYKGQLPANPAAFKLADLAQEI
MTNN_STAAR      ISTTLLINKFKPDIIINTGSAGALDESLNVGDVLISVKYHADATAFGYEYGQVPQMPVASKPLIEKVSQV
MTNN_OCEIH      MATTILHERFSPSMIINTGSAGGFASDLQVGDVVISEELHHDTAFDYVQVPGMPATYKADQRLVELSSEV
MTNN_ESCF3      MGATLLIDHFKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAEAC
MTNN_BAUCH      LGCTLLLTNFEATLVINIGSAGGLSPALAVGDIIVSEEVQYHD-VNVTAF-GYDKGQMAQYPLLFPASPS
MTNN_MANSM      IGTTALLQLAKPDVVLNTGSAGGVADGLKVGDIVISTTAYHDADVTAFGYKGQLPACPATFKLTALAKQV
MTNN_ANOFW      MSTTILLERFAPDVVINTGSAGGFAPSLNVGDIVISTEVHHDVDVTAFGYPGMPARYAADERLIQAAETS
MTNN_DESPS      IGTTLMIDKLKPKCLINTGVAGGFINEMNVGDIVISSSRHHDADATAFGYEGQIPDMPSEFQADRRLVEM
MTNN_SHEHH      IATTLLIEKYAPDVIINTGSAGGFADELAIGDIVISSERHHDYEIGQMAQQPAAFIPDXXXXXXXXXXXX
MTNN_BACSU      ISTTLLLDRYKPDYVINTGSAGGFHHTLNVGDVVISTDRHHDVDVTAFDYEGLPAAYAADEKLISITEEA
MTNN_BACP2      VSTTLLLDRFQPDYVINTGSAGGFHHTLNVGDIVISTDRHHDVDVTIFNYEGLPAAFVADEKLVKLAEES
MTNN_SALTY      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALTI      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALSV      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALPK      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALPC      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALPB      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALNS      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALHS      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALG2      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALEP      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALDC      LGATLLLEHSKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALCH      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_SALA4      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_YERPY      MGTTLLLEHCQPDLVINTGSAGGLASSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_YERPS      MGTTLLLEHCQPDLVINTGSAGGLASSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_YERPB      MGTTLLLEHCQPDLVINTGSAGGLASSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_YERP3      MGTTLLLEHCQPDLVINTGSAGGLASSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_PSEHT      IATTLLIDNFAPDCVINTGSAGGFDPSLNVGDVVISSERHHDVDVTAFGYEQMPAGFAAHPKLVAAAEQT
MTNN_PASMU      IGATLLLEMCKPDLVINTGSAGGVATGLNVGDIVISDETYHDADVTAFGYKGQLPACPARFKLVQLAEKI
MTNN_BACA2      ISTTLLLDRFKPDYVINTGSAGGFHHTLNVGDVVISTDRHHDVDVTAFDYEGLPAAYKADEKLISITEEA
MTNN_YERPA      MGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_ENT38      LGATLLLERCKPDVIINTGSAGGLAPSLKVGDIVVARYHDADVTAFGYEYGQLPGCP-AGFKLIAAAESC
MTNN_YERPP      MGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_YERPN      MGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_YERPG      MGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_YERPE      MGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNERYHDADVTAFGYEGCPAAFVADEDLIALAENC
MTNN_STAES      ISTTLLIEKFNPEVVINTGSAGALDQTLSIGDIL--VSNHVLYHDANATAFGYEYGQTTDPTLLKKTMHV
MTNN_STAEQ      ISTTLLIEKFNPEVVINTGSAGALDQTLSIGDIL--VSNHVLYHDANATAFGYEYGQTTDPTLLKKTMHV
MTNN_SHEPA      IATTLLIEKYAPDAIINTGSAGGFADDLAIGDIVISSERHHDYEIGQMAQQPAAFIPDXXXXXXXXXXXX
MTNN_BUCAT      IATMILIDLYKPDTIINSGSAGSLQSFLKIGDIIIPKKTLTNFGYTRGQIPGYPKEFTVNEKICNFFKKN
MTNN_BUCA5      IATMILIDLYKPDTIINSGSAGSLQSFLKIGDIIIPKKTLTNFGYTRGQIPGYPKEFTVNEKICNFFKKN
MTNN_ERWCT      LGTTLLLEHSKPDVVINTGSAGGLASTLNVGDIVISDERYHDADVTAFGYEGCPAAFPADEKFIALAQDA
MTNN_BUCAI      VATMILIDLYKPDTIINSGSAGSLQSFLKIGDIIIPKKTLTNFGYTRGQIPGYPKEFTVNEKICNFFKKN
MTNN_BACLD      MSTTILLDRFKPDVVINTGSAGGFHHSLNVGDIVISTERHHDVDVTAFDYENLPAAYKADNALIQAAEDE
MTNN_ALISL      VGTTLLISDHNVDVVLNTGSAGGFDSSLNLGDVVISTERHHDADVTAFGYEGQMAQQPAAFKALMAVAET
DEOD_MYCPI      ----------------------------------------------------------------------
MTNN_YERE8      MGTTLLLEHCQPDIVINTGSAGGLASSLKVGDIVVSTERYHDADVTAFGYEGCPAAFIADLKLIELAESC
MTNN_PECCP      LGTTLLLEHSKPDVVINTGSAGGLAPSLNVGDIVVSDERYHDADVTAFGYEGCPAAFAADEKLIALAQEA
MTNN_COLP3      LATAILIDRFQVDYVVNTGSAGGFDASLKVGDIVVSSEVRYHDVIGQLPANPAAFMPAAAKKGIEQLSQT
MTNN_SALAR      LGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAEYC
MTNN_SODGM      LGTTLLLDHFKPELVINTGSAGGLAPSLKVGDIVVS---------HEVRYHDVDVTAPASFSLVALAEES
MTNN_KLEP3      TGATLLLERCQPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLVAAAEDC
MTNN_CITK8      LGATLLLERCKPDVIINTGSAGGLAPTLTVGDIVVARYHDADVTAFGYEFGQLPGCP-AGFKLIAAAESC
MTNN_ERWT9      LGTTLLLELCKPDVVINTGSAGGLAATLKVGDIVVSDERYHDADVTAFGYEGCPAAFKADEKLITAVEQC
MTNN_VIBFM      VGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTERHHDADVTAFGYEMGQMAQIADEKLITTAEQA
MTNN_VIBFI      VGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTERHHDADVTAFGYEMGQMAQIADEKLITTAEQA
MTNN_VIBF1      VGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTERHHDADVTAFGYEMGQMAQIADEKLITTAEQA
MTNN_PHOLL      IGTTLLLEHCQPDVIINTGSAGGLDPKLQIGDIVVSRERYHDTDVTAFGYEPGQMAQVADDQLIDLAEKC
MTNN_LYSSC      MSTTILLHEFKPDVVINTGSAGGYDEALEVGAVVISDERHHDVDVTIFGYEGMPAAYKSDERLMKVAEEA
MTNN_KLEP7      MGATLLLERCQPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADEKLVAAAESC
MTNN_VIBVY      IGTTILLDEYQPDMVLNTGSAGGFDSSLNLGDVVISTERHHDADVTAFGYEGQPAAFLADEKLMNLA-EK
MTNN_VIBVU      IGTTILLDEYQPDMVLNTGSAGGFDSSLNLGDVVISTERHHDADVTAFGYEGQPAAFLADEKLMNLA-EK
MTNN_LISW6      IGTTLLADRFKPEIIINTGSAGGMAEGLAVGDVIISRLAYGDVDVTEFGYTYGQVPRMPAFVLLKKA-ET
MTNN_HAEPS      MGTALLLQLTKPEMVINTGSAGGLDANLNVGDIVISTERHHDIDVEKGQLPANPAAFMANEQLAQIAIKE
MTNN_SALPA      XXXXXXXXHCKPDVIINTGSAGGLASTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLIAAAESC
MTNN_MARMS      VSTTLLLSQFEPEYVINIGSAGGFDPELQVGDVVI-----SDQVVHDVDVTGFGYATYAADETLVAEAKA
MTNN_VIBCM      LGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSERHHDADVTAFGYEGQPAAFKADEKLMTVAEQA
MTNN_VIBCH      LGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSERHHDADVTAFGYEGQPAAFKADEKLMTVAEQA
MTNN_VIBC3      LGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSERHHDADVTAFGYEGQPAAFKADEKLMTVAEQA
MTNN_LISMH      LGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISRLAYGDVDVTEFGYTYGQVPRMPAFYLLKKA-ET
MTNN_LISMF      LGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISRLAYGDVDVTEFGYTYGQVPRMPAFYLLKKA-ET
MTNN_LISMC      LGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISRLAYGDVDVTEFGYTYGQVPRMPAFYLLKKA-ET
MTNN_TREPA      LCTQLLISEFGARVLINTGIAGALDERLCVFDVLVSVDAVTAFGYQKGRIPRMDSANTALRYLVREAFDL
MTNN_SHISS      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_SHIFL      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_SHIF8      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_SHIDS      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_SHIB3      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_PROMH      IGTTLLLEHFRPDVVINTGSAGGLDAKLNVGDIVVSTERYHDADVTAFGYEPGQMAQIADPKLVNIAQEC
MTNN_ECOUT      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOSM      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOSE      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOLU      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOLI      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOLC      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOL6      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOL5      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOK1      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOHS      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECODH      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECOBW      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO8A      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO81      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO7I      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO5E      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO57      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO55      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO45      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO27      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_ECO24      LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_SHIBS      LGATLLLEHGKPDVIINTGSAGGLAPTLKVGDIVVARYHDADVTAFGYEYGQLPGCPAADDKLXXXXXXX
MTNN_SHEPW      IATTLLIEKYAPDAIINTGSAGGFADDLAIGDIVIS----------------------------------
MTNN_LISIN      LGTTLLADRFKPEIIINTGSAGGIGEGLAIGDVIISRLAYGDVDVTEFGYTYGQVPRMPAFVLLKKARDY
MTNN_STACT      ISTTLLINTFSPDVILNTGSAGALDHSLNIGDVLISTATYHDADATAFGYENMPIAYAADDDLVTLAQSV
MTNN_GEOTN      MGTTLLLDRFRPDFVINTGSAGGFLPSLRVGDLVISVHHDVDVTAFGYAYGQVPGLPARXXXXXXXXXXX
MTNN_LISMO      LGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISRLAYGDVDVTEFGYTYGQVPRMPAFYLLKKA-ET
MTNN_GEOKA      MGTTLLLDHFRPDFVINTGSAGGFLPSLRVGDLVISEEVHHDVDVTAFGYAGQVPGLPARYRXXXXXXXX
MTNN_DESAD      VGATLLLDKFKPDYLINTGVAGAFPGNINIGDIVVSSERHYDADATAFDYE------MGQIPQMPAAYQX
MTNN_VIBSL      VGTSILLSEYQPDVVLNTGSAGGFDSTLNLGDVVISTERHHDADVTAFGYEGQPAAFKADDKLMAVAEQA
MTNN_VIBHB      VGTTILLDEYQPDVVINTGSAGGFDSSLNLGDVVISTERHHDTDVTAFGYEGQMAGQPAAFKADEKLMDL
MTNN_VIBPA      VGTTILLDEYQPDVVINTGSAGGFDSSLNLGDVVISTERHHDADVTAFGYEGQMAGQPAAFKADEKLMDL
MTNN_HAEDU      MGTTLLLELTKPNMVINTGSAGGLAENLNVGDIVISTERHYDYEIGQLPANPAAFLPNE--QLVNMALKE


                         +         .         .         .         .         *         .:210
query           AVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAE
DEOD_CLOPS      AVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAE
DEOD_CLOP1      AVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAE
DEOD_THETN      AVEMGIEPKVGNILTTDTFYHDDPESWRLWAKFGVLAVEMETAGLYTLAAKYGVDALTILTVSDSLVTGE
DEOD_THEPX      AMELGIQPKVGNILTTDTFYNDDPDSWKLWAKFGVLAVEMETAGLYTLAAKYNVDALTILTVSDSLVTGE
DEOD_THEP3      AMELGIQPKVGNILTTDTFYNDDPDSWKLWAKFGVLAVEMETAGLYTLAAKYNVDALTILTVSDSLVTGE
DEOD_ALKMQ      AQEKGILTRVGNVLTVDTFYNEDVNSWKKWAEFGTLAVEMETAALYTLAAKFGVDALTLLTVSDSLITGG
DEOD_CLOB8      AVEKGFDPKVGSIYSSDVFYGDDDEDWKKWAKFGCLGVEMEAAALYTIAAKFGVNALALLTVSDHFVTGE
DEOD_GEOKA      GVEKGLALKVGNVFTADMFYNDEPN-WETWARYGVLAVEMETAALYTLAAKFGCRALSVLTVSDHILTGE
DEOD_GEOTN      GMEKGLALKVGNVFTADMFYNDEPN-WETWARYGVLAVEMETAALYTLAAKFDCRALSVLTVSDHIITGE
DEOD_BACC4      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_EXISA      AEKAGIPVKVGQIFTADQFYQDDFHHFKKWADFGCLAIEMEAAGLYTLAAKHKVNALTILTISDHLLTGE
DEOD_BACCZ      GTEKGLHVRVGNVLTADVFYRESMDMVKKLADYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_EXIS2      AKEHGIDAKVGQIFTTDQFYQDDFHHFKKWADFGCLAIEMEAAGLYTLAAKHKVNALTILTISDHLLTGE
DEOD_BACWK      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACHK      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACCR      GTEKGLHVRVGNVLTADVFYRESMDIVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACCQ      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACCE      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACC7      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACC3      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACC2      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACC1      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACC0      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACAN      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACAH      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACAC      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_BACAA      GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_GEOSW      GVEKGLKLKVGNVFTADMFYNDQPD-WETWARYGVLAVEMETAALYTLAAKFGRKALSVLTVSDHILTGE
DEOD_BACCN      GTEKGLHIRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE
DEOD_CLOTE      AVEKGFEPKVGXXXXXXXXXXXXKEDWKTWAKYGCLGVEMETAALYTIAAKYGVNALTLLTVSDHFVTHE
DEOD_ANOFW      GKEKGLQLKVGSVFTADMFYNENAQ-FEKLARYGVLAVEMETTALYTLAAKFGRKALSVLTVSDHILTGE
DEOD_BACST      GKEKGLQLKVGSVFTADMFYNENAQ-FEKLARYGVLAVEMETTALYTLAAKFGRKALSVLTVSDHILTGE
DEOD_BACLD      ASERNIPVTAGNVFTADQFYNDDSQI-EKLAKHGVLAVEMETTALYTLAAKFGRKALSILTVSDHVITGE
DEOD_BREBN      ATERNLPVKVGNIFTSDSFYRESLDLYKKLASYQVLAIEMESSALYTLAAKYKRNALSILTVSDHILTGE
DEOD_BACSU      AKDKGVPVTVGSVFTADQFYNDDSQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGE
DEOD_OCEIH      GVDKGLHLRVGNVFTSDTFYRDNAQQVNELAKYQVLAIEMESTALYTLAAKYGRQALSVLTVSDHIITGE
DEOD_LISW6      GVEKGLSLKVGNVFSADRFYNDQLDK-QQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGE
DEOD_LISIN      GVEKGLSLKVGNVFSADRFYNDQLDK-QQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGE
DEOD_LISMO      GIEKGLSLKVGNVFSADRFYNDQLDK-QQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGE
DEOD_LISMH      GIEKGLSLKVGNVFSADRFYNDQLDK-QQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGE
DEOD_LISMF      GIEKGLSLKVGNVFSADRFYNDQLDK-QQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGE
DEOD_LISMC      GIEKGLSLKVGNVFSADRFYNDQLDK-QQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGE
DEOD_CLONN      GKSKGLDIKVGNILSSDLFYNDDKDAIKLWSKYGVLGIEMEASGLYTLGAKYGVNTLAILTVSDSIVTGE
DEOD_BACA2      AQKNNLPVAVGSVFTADQFYNEDSQI-EKLARYGVLGVEMETTALYTLAAKYGKKALSILTVSDHVLTGE
DEOD_TREPA      ADEMGTGVQVGNVISSDVFY-DESGSWRLWARYGVLAVEMETAELYTLAAKFRREALSILTISDHLVTGA
DEOD2_SHEON     AKVKGTKIRVGNVFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGE
DEOD_SHESR      AKVKGTKIRVGNVFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGE
DEOD_SHESM      AKVKGTKIRVGNVFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGE
DEOD_SHEAM      AKTHGIQTRVGNVFSADLFYTPDPEMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGE
DEOD_SHEB8      AKVRGTKVRVGNIFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGE
DEOD_SHEB5      AKVRGTKVRVGNIFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGE
DEOD_SHEB2      AKVRGTKIRVGNIFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGE
DEOD_JANSC      AEGKGSPIHVGGIYSSDVFYDERPDLNEQMVRHGVLAVEMEAAELYTLAARHKARALAVLTVSDHLLTEE
DEOD_SHEFN      AKAHGTKIRVGNVFSADLFYTPDPQMFDVMEKMGILGVEMEAAGLYGVAHELGAKALCVVTVSDHIRTGE
DEOD_SHELP      AEEKGTKYRVGNVFSADLFYTPDPEMFDVMEKMDVLGVEMEAAGLYGVAKEFGAKALCVVTVSDHIRTGE
DEOD_LACBA      AQDLKISVRVGNVLAEDRFYNDEMDRQK-LVDYGVIATEMESTALFMLAAKYHVRALSVLTISNHLMTGE
DEOD_SHEDO      AKEHGTQIRVGNVFSADLFYTPDPQMFDVMEKMGVLGVEMEAAGLYGVAHELGAKALCVVTVSDHIRTGE
DEOD1_VIBPA     AKARGIDVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGE
DEOD_TOLAT      AETLGIPVKVGNLFSADLFYSPDPQMFDVMEKFGILGVEMEAAGIYGVAAEYGANALAICTVSDHIKTGE
DEOD_PSYIN      ARALGIKARVGNIFSADTFYTPEPEVFDTLEKYNILGVEMEAAGLYGVAAEEGKNALCILTVSDHIRTGE
DEOD_COLP3      AEKLGKPVHVGNIFTADLFYTPQPEKFATMEKYGILAVEMEAAGLYGVAAEYGKKALTVLTVSDHIKTGE
DEOD1_PHOPR     AKAKGIPVKVGNIFSADLFYNPDFEFFKTMDKYGIVGVEMEAAGIYGVAAEFGAKALTICTVSDHILRGE
DEOD_STRPG      AREMGVTTHVGNVLSSDVFYTNMPERNMALGKLGVKAIEMEAAALYYLATQHHVKALGIMTISDNLDPTE
DEOD_YERE8      AKAKGLNVRVGNLFSADLFYTPDPQMFDVMKKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIVSGE
DEOD_YERPY      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGE
DEOD_YERPS      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGE
DEOD_YERPB      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGE
DEOD_YERP3      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGE
DEOD_STRSY      AKELNMTTHVGNVLSSDSFY--SPKLFSRNLELGQLAVEMEAAALYYLGAKFGVQTLAIMTISDSLVNPE
DEOD_STRS2      AKELNMTTHVGNVLSSDSFY--SPKLFSRNLELGQLAVEMEAAALYYLGAKFGVQTLAIMTISDSLVNPE
DEOD_PECCP      AKARDVSVRVGNIFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGA
DEOD_ERWCT      AKARDVSVRVGNIFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGA
DEOD2_VIBCH     ARAQQVPVKVGNVFSADLFYTPEPEIFEKMKKLGILGVDMEAAGIYGVAADLGARALTILTVSDHILRGE
DEOD1_VIBVY     XXXRGIDVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGE
DEOD1_VIBVU     XXXRGIDVKVGNLFSAELFYTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGE
DEOD_CHRVO      AAEQGKKVTVGNVFSADLFYGVQPNMLDVLSKLQVNVIEMELAGIYSVAAQYGARAVGILTVSDIIPTGE
DEOD_XENNE      AKAKNINTRVGNIFSVDLFYSPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGE
DEOD_PHOLL      AKAKNINVRVGNIFSVELFYTPDPQLFDIMEKYGILGVEMEAAGFYGVAAEYGAKALTICTVSDHIRTHE
DEOD_LACCB      ADTSAIRYHVGNVLGEDRFYNDEMDRQK-LIDYEVLATEMETPALYLLAAKYHVHALSILTVSNHLVTGE
DEOD_LACC3      ADTSAIRYHVGNVLGEDRFYNDEMDRQK-LIDYEVLATEMETPALYLLAAKYHVHALSILTVSNHLVTGE
DEOD_ACTPJ      AKQKGIAARVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDHIRTGE
DEOD_PROMH      AKAKDIKVRVGNIFSADLFYSPDPEMFDVMEKYGILGVEMEAAGIYGVAAEYGARALTICTVSDHIKKGT
DEOD_ERWT9      AQALGVKARVGNIFSADLFYTPDPQMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTHE
DEOD_ACTPL      AKQKGIAARVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDHIRTGE
DEOD_ACTP7      AKQKGIAARVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDHIRTGE
DEOD_ACTP2      AKQKGIAARVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDHIRTGE
DEOD1_VIBCH     XXXRGIDVKVGNLFSAELFYTPDPSMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDHIKTGE
DEOD_YERPP      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGE
DEOD_YERPN      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGE
DEOD_YERPG      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGE
DEOD_YERPE      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGE
DEOD_YERPA      AKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGE
DEOD_MANSM      AKAKGINYRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALSICTVSDHIRTGE
DEOD_KLEP3      AKALGVDARVGNIFSADLFYTPDPSMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_HAES1      AKNKGIDVKVGNLFSADLFYTPDPEMFDVMEKYGILGVEMEAAGIYGVAAEFKAKALTICTVSDHIRTHE
DEOD_SALTY      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALHS      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ENTS8      AKALGVEARVGNIFSADLFYTPDPSMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_HAEPS      AKAKGINVRVGNLYSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_CITK8      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALTI      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALSV      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALPK      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALPB      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALPA      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALNS      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALEP      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALDC      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALCH      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SALA4      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_PSEHT      AKDLGIKAKVGNVFTTDTFYQADDTFYKDLDKLGVLAVDMETAGLYGVAAEYGAKAMALFTVSDHVITGE
DEOD_HAES2      AKNKGIDVKVGNLFSADLFYTPDLEMFDVMEKYGILGVEMEAAGIYGVAAEFKAKALTICTVSDHIRTHE
DEOD2_VIBPA     ARAQEVPVKVGNVFSADLFYTPEADIFEKMEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIIRGE
DEOD2_VIBF1     ARELNVPVKVGNVFSADLFYSPEADLFDKMEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIKRGE
DEOD_SALAR      AKALGVDARVGNLFSADLFYSPDGDMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SHISS      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SHIFL      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SHIF8      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SHIDS      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SHIBS      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_SHIB3      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ESCF3      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOSM      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOSE      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOLU      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOLI      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOLC      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOL6      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOL5      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOHS      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECODH      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECOBW      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO8A      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO81      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO7I      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO5E      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO57      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO55      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO45      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO27      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_ECO24      AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD2_PHOPR     ARLQNVNVRVGNIFSADLFYSPEEGLFDKMEKLGMLGIDMEAAGIYGVAAELGAKALTILTVSDHIKRGE
DEOD_HAEDU      AKQKNISVQVGNLFSADLFYTPDVAMFDVMEKYGILGVEMEAAGIYVVAAEYGVKSLAICTVSDHIRSGE
DEOD_STRGC      AKDLGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQHHVDALAIMTISDSLVNPE
DEOD_ALISL      ARKLNVPVKVGNVFSADLFYSPETDLFDKMEKLGILGVDMEAAGIYRVAADLGAKALTILTVSDHIKRGE
DEOD_LACLA      AKDLGITTHVGNILSSDLFYG-GPD-XXXXXXXXXXXXEMEAAGLYYLGAKYKVQTLGIMTISDHILTGE
DEOD_STRZJ      AKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_LACLS      AKDLGITTHVGNILSSDLFYG-GPD-XXXXXXXXXXXXEMEAAGLYYLGAKYKVQTLGIMTISDHILTGE
DEOD_LACLM      AKDLGITTHVGNILSSDLFYG-GPD-XXXXXXXXXXXXEMEAAGLYYLGAKYKVQTLGIMTISDHILTGE
DEOD1_VIBF1     AQARGIDVKVGNLFSAELFYTPDPSMFDLMDKYGIVGVEMEAAGMYGVAAEYGAKALAICTVSDHIKTGE
DEOD_LACRJ      AGKLGIETKVGDIFAADRFYNDELD-MEKLRDYGILGTEMESAGLYLLAAKLHFRALSVLTVSDLIFGDE
DEOD_LACRD      AGKLGIETKVGDIFAADRFYNDELD-MEKLRDYGILGTEMESAGLYLLAAKLHFRALSVLTVSDLIFGDE
DEOD_ENT38      AKALGVDARVGNIFSADLFYSDGGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_STRU0      AKDLGMTTHVGSVLSSDVFYSNMPERNMALGKLGVKAIEMEXXXXXXXXXQHQVKALGIMTISDNLDPSE
DEOD_STRPC      AREMGVTTHVGNVLSSDVFYTNMPERNMALGKLGVKAIEMEXXXXXXXXXQHHVKALGIMTISDNLDPTE
DEOD_STRPB      AREMGVTTHVGNVLSSDVFYTNMPERNMALGKLGVKAIEMEXXXXXXXXXQHHVKALGIMTISDNLDPTE
DEOD_SALG2      AKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_PASMU      AKAKGLNVHVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD2_VIBVY     ARAQNVPVKVGNVFSADLFYTPEADIFEKMEKLGILGVDMEAAGIYGVAADLKAKALTILTVSDHIIRGE
DEOD2_VIBVU     ARAQNVPVKVGNVFSADLFYTPEADIFEKMEKLGILGVDMEAAGIYGVAADLKAKALTILTVSDHIIRGE
DEOD_STRZP      AKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_STRPJ      AKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_STRPF      AREMGVTTHVGNVLSSDVFYTNMPERNMVLGKLGVKAIEMEXXXXXXXXXQHHVKALGIMTISDNLDPTE
DEOD_STRP7      AKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_STRP4      AKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_STRP2      AKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_STRTD      AKNFGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQHQVDALAIMTISDSLVNPE
DEOD_STRPI      AKELGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_EDWI9      XXXXXXXXRVGNLFSADLFYSPDPTMFDVMEKYGILGVEMEAAGIYGVAAEFGVKALTICTVSDHIRTHE
DEOD_STRZT      AKKLGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_STRPS      AKKLGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDSLVNPE
DEOD_HAHCH      ARRREARFHVGALFTTDLFYAADPGLTERLSAHGVKAVEMEAAGLYGVAAECGGKALALCTVSDHLLSGE
DEOD_ACTSZ      XXXXXXXXHVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALSICTVSDHIRSGE
DEOD_ROSDO      XXXXGTRTHVGGIYSSDVFYAERPDLDEQMVRHGILGVEMEAAELYTLAARHNRRALAILTVSDHLQTGE
DEOD_DINSH      XXXXXXXXHVGGIYSSDVFYDERPDLTEQMIRHGVLGVEMEAAELYTLAARHGRRALAVLTVSDHLLTHD
DEOD3_SHEON     ANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGE
DEOD_KLEPN      AKALGVEARRSNIFSADLFYTPDPSMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
DEOD_HAEIN      XXXXXXXXRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHE
DEOD_HAEI8      XXXXXXXXRVGNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHE
DEOD_LACSS      XXXXXXXVKVGNILSEDRFYNDEIDRQK-LIQYGVLGSXXXXXXXXXXXXKFNVQALAVLTISNHIITGE
DEOD_DICNV      AAQQNITARVGTVFSTDSFYHADTELMDLLKRFHILGVEMEAAGLFGVAAEYGARAGCILTVSDHILRQE
DEOD_MYXXD      XXXXNKPVRAGPVFTSDLFYHPQEQLNATLARMGVLAVEMEVAGLYGVAAESGARALGLLTVSDHIITGE
DEOD3_VIBF1     LKTTDINYLVGNVFSSDLFYRPDEEQYDMMARYGILGVEMEVNALYSAAAENHCNAVALCTVTDHIKNHE
DEOD_BUCAP      AKKMNFKVHIGNFFTTDSFYTESEDMLKILKKYNIIGIDMETAGIYAVAAELKAQALSICTVSDHIIKKD
DEOD_HAEIG      XXXXXXXXXXXNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHE
DEOD_HAEIE      XXXXXXXXXXXNLFSADLFYTPDVEMFDVMEKYGILGVEMEAAGIYGVAAEYSAKALTICTVSDHIRTHE
DEOD1_SHEON     LKTTTVNYKVGNVFSSDLFYRPNENDYTLMAKYGVLGVEMEVNALYALAAEHQCRALALCTVTDHIVQHE
DEOD_STRTR      AKNFGMTTHVGNVLSSDEKYSNYFEKNIELGKWGVKAVEMEXXXXXXXXXQHQVDALAIMTISDSLVNPE
DEOD_BUCAT      XXXXXXXXXXGNFFTTDSFYNDDKKMLNILKKYNIIGVDMETAGIYGVASELKVQALSICTVSDHITNKE
DEOD_BUCAI      XXXXXXXXXXGNFFTTDSFYNDDKKMLNILKKYNIIGVDMETAGIYGVASELKVQALSICTVSDHITNKE
DEOD_BUCA5      XXXXXXXXXXGNFFTTDSFYNDDKKMLNILKKYNIIGVDMETAGIYGVASELKVQALSICTVSDHITNKE
DEOD_HELPH      AKRLGIDLKVGNVFSSDFFYSFETHAFDLMAQYNHLAIEMEAAGLYATAMELSAKALCLCSVSDHLITKE
DEOD_HELPG      AKRLGIDLKIGNVFSSDFFYSFETHAFDLMAQYNHLAIEMEAAGLYATAMELSAKALCLCSVSDHLITKE
DEOD_HELPS      AKRLGIDLKVGNVFSSDFFYSFETHAFDLMVQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKE
DEOD_HELPY      AKRLGIDLKVGNVFSSDFFYSFETHAFDLMAKYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKE
DEOD_HELPJ      AKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKE
DEOD_HELP2      AKRLGIDLKVGNVFSSDFFYSFETHAFDLMAQYNHLAIEMEAAGLYATAMELNSKALCLCSVSDHLITKE
DEOD_HELAH      AKRLEIDLKVGNIFTSDFFYSFETHAFDLLAKYNHLGIEMEAAGLYATAMELSAKALCLCSVSDHLITKE
DEOD_BUCBP      XXXXXXXXXXXXFFTTDLFYVKNDKLLDTLQRYNILGIDMETAGIYSLASELGIQVASICTVSDHILKKD
DEOD_MYCPN      ANQLQLAFHEGLVFCEDAFHQIRKDVLKLAQEKHALAVEMEAHALYANAMLLNKQALTMLTVSDSLVTHA
DEOD_MYCGE      AIKNKLDFHEGLVFCEDAFYQTRKDVISLAKEKNSLAVEMEAHXXXXXXXXXXXXXXXXXXXXXXXXXHE
MTAP_SULSO      FSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLITKE
UDP_TREPA       AEDVQVRHALGVVQCKDNFYGQHTQKWHAWIACNTLASEMESAALFVLGSVRRVRTGAVLLV--------
UDP_HAEIN       AKAKGIEPYVGVTVSSDTFYRNYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMVAGVIVNRTQQE
UDP_SALTY       AKSIGATTHVGVTASSDTFYPGQERSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
UDP_SALTI       AKSIGATTHVGVTASSDTFYPGQERSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
UDP_ECOLI       AKSIGATTHVGVTASSDTFYPGQERSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
UDP_KLEAE       AKSIGATTHIGVTASSDTFYPGQERSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
UDP_KLEPN       ATRAGEARKIGAVTASDTFYPGQERSMEEWQAMGVMNYEMESATVLTMCASQGLRAGMVAGVIVNRTQQE
MTNN_AERS4      IAEQGHQTKVGLICTGDQFMCKPDAIAKARADFQMLAVEMEGAAIGQVCHMFKVPYLVVRAMSD------
MTNN_AERHH      IAEQGHQTKVGLICTGDQFMCKPDAIAKARADFQMLAVEMEGAAIGQVCHMFKVPYLVVRAMSD------
MTNN_BACHD      AKTVGIPSKKGLILSGDSFMSDAALVEQLKRRFNPLCSEMEAGAIAQVCHRFGVPFVIIRSLSD------
MTNN_HELPY      ANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDN-----
MTNN_ENTS8      IEKLNLHAVRGLVVSGDAFINGSVNLAKIRHNFQAIAVEMEATAIGHVCHNFGVPFVVVRAISDVADQQS
MTNN_SHEB5      IAQLGEVKAIGLICTGDSFICDPVRTQAMLKNFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_SHEPC      IAQLGEVKAIGLICTGDSFICDPVRTQAMLKNFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_SHEB9      IAQLGEVKAIGLICTGDSFICDPVRTQAMLKNFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_SHEB8      IAQLGEVKAIGLICTGDSFICDPIRTQAMLKNFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_SHEB2      IAQLGEVKAIGLICTGDSFICDPVRTQAMLKNFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_SHESA      IAQLGEVKAIGLICTGDSFICDPVRTKTMLEHFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_SHEDO      AAKKAVSALEGLICTGDSFICDPERTKVMRANFPTMAAEMEGAAIAQVCHQFKVPFVVIRSLSDN-----
MTNN_SHESW      IAQLGEVKAIGLICTGDSFICDPVRTQAMLKNFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_HELPJ      ANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDN-----
MTNN_SHEAM      VAKLGEVKTVGLICTGDSFICDPVRTAKMQADFPTMAAEMEGAAIGQVCHQFATPFVVIRSLSDN-----
MTNN_SHEWM      AVASLGEVKAGLICTGDSFICDPVRTKTMLEHFPTMAAEMEGAAIAQVCHQFAVPFVVIRSLSDN-----
MTNN_SHESM      IKQLGEVKAIGLICTGDSFICDPVRTKTMLEHFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_SHEFN      VAELGEVKAIGLICTGDSFICDPVRTKVMRENFPTMAAEMEGAAIAQVCHQFNVPFVVIRSLSDN-----
MTNN_SHEON      IAQLGEVRAIGLICTGDSFICDPVRTKTMLEHFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_HAEIG      AEKQGQSVKRGLICSGDSFINSEDKITQIQADFNVMGVEMEATAIAQVCYAFNVPFVVVRAISD------
MTNN_HAEI8      AEKQGQSVKRGLICSGDSFINSEDKIAQIQADFNVMGVEMEATAIAQVCYAFNVPFVVVRAISD------
MTNN_SHESH      AAQKAVASLEGLICTGDSFICDPVRTKTMLEHFPTMAAEMEGAAIAQVCHQFDVPFVVIRSLSDN-----
MTNN_SHESR      IKQLGEVKAIGLICTGDSFICDPVRTKTMLEHFPTMAAEMEGAAIAQVCHQFGMPFVVIRSLSDN-----
MTNN_EXISA      IENPDVNVHQGLIVTGDSFINDSKRVADILGHFGVAAVEMEAAPIAQTCYQFGVPFVVTRSISD------
MTNN_ACTSZ      AQKQGRRVKQGLICSGDSFIAGGERLAQIKADFPPVAVEMEAAAIAHVCHAFGVPFVVVRAISD------
MTNN_HAEIN      AEKQGQSVKRGLICSGDSFINSEDKIAQIKADFNVTGVEMEATAIAQVCYAFNVPFVVVRAISD------
MTNN_EXIS2      VIERMDAIRVGLIVTGDSFIHDTERSNLIKTNFDVAAVEMEAAPIAQVCHQFDVPFVVTRSISD------
MTNN_STAHJ      INKKNYNAKIGQIVSGDSFIGSVDQRLTIKRQFEAMAVEMEATAIAQTCHQFHVPFIVTRAVSD------
MTNN_STAAW      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAAT      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAAS      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAAN      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAAM      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAAE      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAAC      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAAB      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAA9      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAA8      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAA3      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAA2      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_STAA1      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_SHELP      VADLGEVKAIGLICTGDSFICDPERTKVMLNNFPTMAAEMEGAAIAQVCHQFKVPFVVIRSLSDN-----
MTNN_HAES2      AEQQGINLTSGLICSGDSFINSAEKAWIKANFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISD------
MTNN_HAES1      AKQQGINLTSGLICSGDSFINSAEKAWIKANFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISD------
MTNN_HAEIE      AEKQGQSVKRGLICSGDSFINSEDKITQIKADFNVTGVEMEATAIAQVCYAFNVPFVVVRAISD------
MTNN_STAAR      VQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFNAMAVEMEATAIAQTCYQFNVPFVVVRAVSD------
MTNN_OCEIH      MKDIEINSRIGVIATGDSFMKDQTDIVKQ--RFGMLALEMEAASIAQVCYRYNTPFVITRALSD------
MTNN_ESCF3      IAEHNLNAVRGLIVSGDAFINGSVSLAKIRHNFQAIAVEMEATAIAHVCHNFKVPFVVVRAISD------
MTNN_BAUCH      LVHTNINVVCGQIISGDIFINGGQELYKLKRRFQAIAVDMEVTAIAQICYLFAVPFVGIRVITD------
MTNN_MANSM      AQAQGHNVKRGLICSGDSFIAGGERLAQIKADFNVTAVEMEAAAI-------------------------
MTNN_ANOFW      AAHRDIQVAKGLIATGDSFMHDPARVDFVRTQFPDLAVEMEAAAIAQVCHQFNVPFVVIRALSD------
MTNN_DESPS      ATKVNLKSKAGPVFSGDSFIHTTEQVENILKNFQIMAVEMEGASIAQTSHLFNIPFVLIRSISDKV---R
MTNN_SHEHH      SLGEVKAIE-GLICTGDSFICDPVRTKTMLENFPTMAAEMEGAAIAQVCHQFGVPFVVIRSLSDN-----
MTNN_BACSU      VSEDGIQVAKGTIATGDSFMNDPKRVEEVRARFSDL----------------------------------
MTNN_BACP2      ALEIDHQVAKGTIATGDSFMND------------------------------------------------
MTNN_SALTY      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCHNFNVPFVVVRAISD------
MTNN_SALTI      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCHNFNVPFVVVRAISD------
MTNN_SALSV      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCYNFNVPFVVVRAISD------
MTNN_SALPK      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCHNFNVPFVVVRAISD------
MTNN_SALPC      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCHNFNVPFVVVRAISD------
MTNN_SALPB      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCHNFNVPFVVVRAISD------
MTNN_SALNS      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCYNFSVPFVVVRAISD------
MTNN_SALHS      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCYNFSVPFVVVRAISD------
MTNN_SALG2      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCYNFSVPFVVVRAISD------
MTNN_SALEP      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCYNFSVPFVVVRAISD------
MTNN_SALDC      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCYNFNVPFVVVRAISD------
MTNN_SALCH      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCHNFNVPFVVVRAISD------
MTNN_SALA4      IRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFDAVAVEMEATAIAHVCYNFNVPFVVVRAISD------
MTNN_YERPY      IQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_YERPS      IQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_YERPB      IQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_YERP3      IQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_PSEHT      IAQSDVKTLVGLICTGDIFMCDPIRIEKARSDFPTLAVEMEGASIAQTCHTLNTPFVVIRSMSD------
MTNN_PASMU      AVQQQQQVKRGLICSGDSFIQGGTPLAQIKADFPTMAVEMEATAIAQVCHAFNVPFVVVRAISD------
MTNN_BACA2      VSENGIQVAKGTIATGDSFMNDPKRVEDVRAKFADL----------------------------------
MTNN_YERPA      IQQLKLNAVRGLICSGDAFINGAEPLTRIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_ENT38      IAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFNAIAVEMEATAIAHVCHNFSVPFVVVRAISD------
MTNN_YERPP      IQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_YERPN      IQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_YERPG      IQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_YERPE      IQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQAS
MTNN_STAES      LEQQQLNGKVGMIVSGDSFIGSSEQRQKIKQQFEAMAVEMEATAIAQTCYQFKVPFIVTRAVSD------
MTNN_STAEQ      LEQQQLNGKVGMIVSGDSFIGSSEQRQKIKQQFEAMAVEMEATAIAQTCYQFKVPFIVTRAVSD------
MTNN_SHEPA      SLGEVKAIE-GLICTGDSFICDPVRTKTMLENFPTMAAEMEGAAIAQVCHQFDVPFVVIRSLSDN-----