[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81143.1

[Show Plain Result]


## Summary of Sequence Search
    1::400
    1::400       0.0 100%  400 aa  HEM1_CLOPE RecName: Full=Glutamyl-tRNA reductase;       
    1::400       0.0  99%  400 aa  HEM1_CLOPS RecName: Full=Glutamyl-tRNA reductase;       
    1::400       0.0  98%  400 aa  HEM1_CLOP1 RecName: Full=Glutamyl-tRNA reductase;       
    1::399     e-110  49%  401 aa  HEM1_CLOB8 RecName: Full=Glutamyl-tRNA reductase;       
    1::398     e-106  46%  401 aa  HEM1_CLOBA RecName: Full=Glutamyl-tRNA reductase;       
    1::399     e-103  44%  401 aa  HEM1_CLOBB RecName: Full=Glutamyl-tRNA reductase;       
    1::395     3e-88  42%  399 aa  HEM1_CLOTE RecName: Full=Glutamyl-tRNA reductase;       
    1::397     1e-81  40%  399 aa  HEM1_CLOK5 RecName: Full=Glutamyl-tRNA reductase;       
    1::397     1e-81  40%  399 aa  HEM1_CLOK1 RecName: Full=Glutamyl-tRNA reductase;       
    1::394     5e-77  38%  396 aa  HEM1_CLOAB RecName: Full=Glutamyl-tRNA reductase;       
    1::393     7e-59  32%  394 aa  HEM1_ANATD RecName: Full=Glutamyl-tRNA reductase;       
    1::393     3e-58  31%  394 aa  HEM1_CALS8 RecName: Full=Glutamyl-tRNA reductase;       
    3::396     4e-48  31%  411 aa  HEM1_CLONN RecName: Full=Glutamyl-tRNA reductase;       
    5::416     7e-35  29%  449 aa  HEM1_CARHZ RecName: Full=Glutamyl-tRNA reductase;       
   11::411     1e-34  29%  427 aa  HEM1_CAMC1 RecName: Full=Glutamyl-tRNA reductase;       
    2::417     4e-34  30%  464 aa  HEM1_DESRM RecName: Full=Glutamyl-tRNA reductase;       
   11::389     7e-33  28%  420 aa  HEM1_PROMH RecName: Full=Glutamyl-tRNA reductase;       
    5::391     9e-33  31%  435 aa  HEM1_ACTSZ RecName: Full=Glutamyl-tRNA reductase;       
    5::373     2e-32  29%  429 aa  HEM1_THEYD RecName: Full=Glutamyl-tRNA reductase;       
   11::395     2e-32  30%  432 aa  HEM1_NITSB RecName: Full=Glutamyl-tRNA reductase;       
    2::393     2e-32  25%  458 aa  HEM1_NATTJ RecName: Full=Glutamyl-tRNA reductase;       
    5::390     2e-32  28%  433 aa  HEM1_HAES1 RecName: Full=Glutamyl-tRNA reductase;       
    5::398     2e-32  32%  450 aa  HEM1_DESDG RecName: Full=Glutamyl-tRNA reductase;       
   11::358     3e-32  28%  418 aa  HEM1_ECOLC RecName: Full=Glutamyl-tRNA reductase;       
   11::358     3e-32  28%  418 aa  HEM1_ECOHS RecName: Full=Glutamyl-tRNA reductase;       
    6::415     4e-32  26%  419 aa  HEM1_VIBCM RecName: Full=Glutamyl-tRNA reductase;       
    6::415     4e-32  26%  419 aa  HEM1_VIBCH RecName: Full=Glutamyl-tRNA reductase;       
    6::415     4e-32  26%  419 aa  HEM1_VIBC3 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     4e-32  28%  418 aa  HEM1_ESCF3 RecName: Full=Glutamyl-tRNA reductase;       
    6::415     6e-32  26%  419 aa  HEM1_VIBSL RecName: Full=Glutamyl-tRNA reductase;       
   11::358     6e-32  28%  418 aa  HEM1_SHISS RecName: Full=Glutamyl-tRNA reductase;       
   11::358     6e-32  28%  418 aa  HEM1_SHIDS RecName: Full=Glutamyl-tRNA reductase;       
   11::358     6e-32  28%  418 aa  HEM1_SHIBS RecName: Full=Glutamyl-tRNA reductase;       
   11::358     6e-32  28%  418 aa  HEM1_SHIB3 RecName: Full=Glutamyl-tRNA reductase;       
    5::390     6e-32  28%  433 aa  HEM1_HAES2 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     6e-32  28%  418 aa  HEM1_ECOSE RecName: Full=Glutamyl-tRNA reductase;       
   11::358     6e-32  28%  418 aa  HEM1_ECO8A RecName: Full=Glutamyl-tRNA reductase;       
   11::358     6e-32  28%  418 aa  HEM1_ECO55 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     6e-32  28%  418 aa  HEM1_ECO24 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     8e-32  28%  418 aa  HEM1_SHIFL RecName: Full=Glutamyl-tRNA reductase;       
   11::358     8e-32  28%  418 aa  HEM1_SHIF8 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     8e-32  28%  418 aa  HEM1_ECOLU RecName: Full=Glutamyl-tRNA reductase;       
   11::358     8e-32  28%  418 aa  HEM1_ECOLI RecName: Full=Glutamyl-tRNA reductase;       
   11::358     8e-32  28%  418 aa  HEM1_ECODH RecName: Full=Glutamyl-tRNA reductase;       
   11::358     8e-32  28%  418 aa  HEM1_ECOBW RecName: Full=Glutamyl-tRNA reductase;       
   11::358     8e-32  28%  418 aa  HEM1_ECO5E RecName: Full=Glutamyl-tRNA reductase;       
   11::358     8e-32  28%  418 aa  HEM1_ECO57 RecName: Full=Glutamyl-tRNA reductase;       
    3::368     1e-31  30%  368 aa  HEM1_THEM4 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     1e-31  26%  441 aa  HEM1_SULSY RecName: Full=Glutamyl-tRNA reductase;       
    3::291     1e-31  34%  443 aa  HEM1_HELMO RecName: Full=Glutamyl-tRNA reductase;       
   11::411     1e-31  29%  428 aa  HEM1_CAMC5 RecName: Full=Glutamyl-tRNA reductase;       
    5::417     1e-31  27%  455 aa  HEM1_BACSU RecName: Full=Glutamyl-tRNA reductase;       
    2::417     1e-31  28%  444 aa  HEM1_PELTS RecName: Full=Glutamyl-tRNA reductase;       
    5::372     1e-31  28%  444 aa  HEM1_MANSM RecName: Full=Glutamyl-tRNA reductase;       
   11::358     1e-31  28%  418 aa  HEM1_ECOL5 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     1e-31  27%  443 aa  HEM1_DESHY RecName: Full=Glutamyl-tRNA reductase;       
   11::417     1e-31  27%  443 aa  HEM1_DESHD RecName: Full=Glutamyl-tRNA reductase;       
    2::417     1e-31  31%  446 aa  HEM1_DESAP RecName: Full=Glutamyl-tRNA reductase;       
   11::358     2e-31  28%  418 aa  HEM1_ECOUT RecName: Full=Glutamyl-tRNA reductase;       
   11::358     2e-31  28%  418 aa  HEM1_ECOL6 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     2e-31  28%  418 aa  HEM1_ECOK1 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     2e-31  28%  418 aa  HEM1_ECO81 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     2e-31  28%  418 aa  HEM1_ECO45 RecName: Full=Glutamyl-tRNA reductase;       
    6::416     2e-31  26%  423 aa  HEM1_CHLL2 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     3e-31  28%  418 aa  HEM1_ECO27 RecName: Full=Glutamyl-tRNA reductase;       
   11::358     4e-31  28%  418 aa  HEM1_ECOSM RecName: Full=Glutamyl-tRNA reductase;       
   11::358     4e-31  28%  418 aa  HEM1_ECO7I RecName: Full=Glutamyl-tRNA reductase;       
    6::397     5e-31  30%  426 aa  HEM1_PROA2 RecName: Full=Glutamyl-tRNA reductase;       
    6::397     5e-31  27%  426 aa  HEM1_CHLTE RecName: Full=Glutamyl-tRNA reductase;       
    5::410     5e-31  28%  418 aa  HEM1_ALISL RecName: Full=Glutamyl-tRNA reductase;       
   11::355     6e-31  27%  418 aa  HEM1_KLEP7 RecName: Full=Glutamyl-tRNA reductase;       
    9::325     6e-31  32%  329 aa  HEM1_FUSNN RecName: Full=Glutamyl-tRNA reductase;       
    5::410     8e-31  27%  418 aa  HEM1_VIBF1 RecName: Full=Glutamyl-tRNA reductase;       
    5::410     1e-30  27%  418 aa  HEM1_VIBFM RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALTY RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALTI RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALSV RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALPK RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALPB RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALPA RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALNS RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALHS RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALG2 RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALEP RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALDC RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALCH RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALAR RecName: Full=Glutamyl-tRNA reductase;       
   11::405     1e-30  26%  418 aa  HEM1_SALA4 RecName: Full=Glutamyl-tRNA reductase;       
    5::369     2e-30  29%  434 aa  HEM1_PASMU RecName: Full=Glutamyl-tRNA reductase;       
   11::405     2e-30  26%  418 aa  HEM1_CITK8 RecName: Full=Glutamyl-tRNA reductase;       
    6::397     2e-30  26%  426 aa  HEM1_CHLP8 RecName: Full=Glutamyl-tRNA reductase;       
   25::376     3e-30  29%  382 aa  HEM1_METM6 RecName: Full=Glutamyl-tRNA reductase;       
   11::405     4e-30  26%  418 aa  HEM1_ENTS8 RecName: Full=Glutamyl-tRNA reductase;       
    6::415     5e-30  27%  418 aa  HEM1_VIBPA RecName: Full=Glutamyl-tRNA reductase;       
   11::417     5e-30  26%  454 aa  HEM1_BACSK RecName: Full=Glutamyl-tRNA reductase;       
    6::416     7e-30  25%  425 aa  HEM1_PELLD RecName: Full=Glutamyl-tRNA reductase;       
   11::355     7e-30  27%  418 aa  HEM1_KLEP3 RecName: Full=Glutamyl-tRNA reductase;       
   11::365     2e-29  30%  436 aa  HEM1_ACTPJ RecName: Full=Glutamyl-tRNA reductase;       
   11::365     2e-29  30%  436 aa  HEM1_ACTP7 RecName: Full=Glutamyl-tRNA reductase;       
   11::385     3e-29  28%  418 aa  HEM1_PSEHT RecName: Full=Glutamyl-tRNA reductase;       
   11::412     3e-29  27%  435 aa  HEM1_SULNB RecName: Full=Glutamyl-tRNA reductase;       
    5::414     3e-29  24%  424 aa  HEM1_ALKMQ RecName: Full=Glutamyl-tRNA reductase;       
    6::416     5e-29  25%  425 aa  HEM1_PROVI RecName: Full=Glutamyl-tRNA reductase;       
   11::365     5e-29  30%  436 aa  HEM1_ACTP2 RecName: Full=Glutamyl-tRNA reductase;       
    6::415     6e-29  26%  418 aa  HEM1_VIBHB RecName: Full=Glutamyl-tRNA reductase;       
   11::401     6e-29  28%  435 aa  HEM1_CAMLR RecName: Full=Glutamyl-tRNA reductase;       
    5::366     6e-29  29%  455 aa  HEM1_BACP2 RecName: Full=Glutamyl-tRNA reductase;       
    5::417     6e-29  26%  455 aa  HEM1_BACA2 RecName: Full=Glutamyl-tRNA reductase;       
   11::393     6e-29  28%  427 aa  HEM1_ACIBC RecName: Full=Glutamyl-tRNA reductase;       
   25::368     8e-29  28%  382 aa  HEM1_METM7 RecName: Full=Glutamyl-tRNA reductase;       
   11::355     8e-29  27%  418 aa  HEM1_ENT38 RecName: Full=Glutamyl-tRNA reductase;       
    5::295     8e-29  35%  453 aa  HEM1_BACLD RecName: Full=Glutamyl-tRNA reductase;       
   25::376     1e-28  28%  382 aa  HEM1_METM5 RecName: Full=Glutamyl-tRNA reductase;       
   11::371     1e-28  30%  435 aa  HEM1_HAEPS RecName: Full=Glutamyl-tRNA reductase;       
    6::397     1e-28  26%  426 aa  HEM1_CHLPB RecName: Full=Glutamyl-tRNA reductase;       
   11::393     1e-28  28%  427 aa  HEM1_ACIBY RecName: Full=Glutamyl-tRNA reductase;       
   11::393     1e-28  28%  427 aa  HEM1_ACIBT RecName: Full=Glutamyl-tRNA reductase;       
   11::393     1e-28  28%  427 aa  HEM1_ACIBS RecName: Full=Glutamyl-tRNA reductase;       
   11::393     1e-28  28%  427 aa  HEM1_ACIB5 RecName: Full=Glutamyl-tRNA reductase;       
   11::393     1e-28  28%  427 aa  HEM1_ACIB3 RecName: Full=Glutamyl-tRNA reductase;       
    6::397     1e-28  25%  425 aa  HEM1_CHLPD RecName: Full=Glutamyl-tRNA reductase;       
    5::355     2e-28  31%  436 aa  HEM1_PELPD RecName: Full=Glutamyl-tRNA reductase;       
   29::318     2e-28  31%  392 aa  HEM1_METJA RecName: Full=Glutamyl-tRNA reductase;       
   18::426     2e-28  27%  449 aa  HEM1_HELPY RecName: Full=Glutamyl-tRNA reductase;       
   18::426     2e-28  26%  449 aa  HEM1_HELPS RecName: Full=Glutamyl-tRNA reductase;       
    3::404     2e-28  30%  422 aa  HEM1_COLP3 RecName: Full=Glutamyl-tRNA reductase;       
   11::363     2e-28  29%  432 aa  HEM1_ARCB4 RecName: Full=Glutamyl-tRNA reductase;       
    4::346     2e-28  30%  406 aa  HEM1_AQUAE RecName: Full=Glutamyl-tRNA reductase;       
    4::391     3e-28  28%  416 aa  HEM1_VESOH RecName: Full=Glutamyl-tRNA reductase;       
    6::397     4e-28  25%  425 aa  HEM1_PELPB RecName: Full=Glutamyl-tRNA reductase;       
   18::426     4e-28  26%  449 aa  HEM1_HELP2 RecName: Full=Glutamyl-tRNA reductase;       
   25::376     5e-28  28%  382 aa  HEM1_METMP RecName: Full=Glutamyl-tRNA reductase;       
   18::426     5e-28  26%  449 aa  HEM1_HELPH RecName: Full=Glutamyl-tRNA reductase;       
   15::406     7e-28  25%  420 aa  HEM1_METCA RecName: Full=Glutamyl-tRNA reductase;       
    5::366     7e-28  28%  444 aa  HEM1_BACCN RecName: Full=Glutamyl-tRNA reductase;       
   25::263     9e-28  34%  379 aa  HEM1_METVS RecName: Full=Glutamyl-tRNA reductase;       
   16::424     9e-28  27%  447 aa  HEM1_HELAH RecName: Full=Glutamyl-tRNA reductase;       
    5::396     9e-28  30%  439 aa  HEM1_DESAD RecName: Full=Glutamyl-tRNA reductase;       
    1::393     1e-27  27%  416 aa  HEM1_DECAR RecName: Full=Glutamyl-tRNA reductase;       
    5::414     1e-27  28%  436 aa  HEM12_ACIBL RecName: Full=Glutamyl-tRNA reductase 2;       
   11::358     1e-27  25%  418 aa  HEM1_PECCP RecName: Full=Glutamyl-tRNA reductase;       
    3::390     1e-27  28%  430 aa  HEM1_GLOVI RecName: Full=Glutamyl-tRNA reductase;       
    6::397     1e-27  28%  426 aa  HEM1_CHLCH RecName: Full=Glutamyl-tRNA reductase;       
    5::401     2e-27  30%  434 aa  HEM1_GEOSF RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-27  26%  446 aa  HEM1_BACME RecName: Full=Glutamyl-tRNA reductase;       
    6::407     3e-27  25%  416 aa  HEM1_SHELP RecName: Full=Glutamyl-tRNA reductase;       
   11::389     4e-27  25%  420 aa  HEM1_YERE8 RecName: Full=Glutamyl-tRNA reductase;       
   11::401     4e-27  25%  432 aa  HEM1_SULDN RecName: Full=Glutamyl-tRNA reductase;       
    5::390     4e-27  29%  434 aa  HEM1_GEOUR RecName: Full=Glutamyl-tRNA reductase;       
   11::382     4e-27  30%  422 aa  HEM1_CAMFF RecName: Full=Glutamyl-tRNA reductase;       
    3::284     4e-27  32%  413 aa  HEM12_CLOPH RecName: Full=Glutamyl-tRNA reductase 2;       
   14::413     6e-27  26%  426 aa  HEM1_DESPS RecName: Full=Glutamyl-tRNA reductase;       
    6::404     6e-27  28%  437 aa  HEM1_CHLT3 RecName: Full=Glutamyl-tRNA reductase;       
   11::389     7e-27  28%  420 aa  HEM1_YERPS RecName: Full=Glutamyl-tRNA reductase;       
   11::389     7e-27  28%  420 aa  HEM1_YERPP RecName: Full=Glutamyl-tRNA reductase;       
   11::389     7e-27  28%  420 aa  HEM1_YERPN RecName: Full=Glutamyl-tRNA reductase;       
   11::389     7e-27  28%  420 aa  HEM1_YERPG RecName: Full=Glutamyl-tRNA reductase;       
   11::389     7e-27  28%  420 aa  HEM1_YERPE RecName: Full=Glutamyl-tRNA reductase;       
   11::389     7e-27  28%  420 aa  HEM1_YERPA RecName: Full=Glutamyl-tRNA reductase;       
   11::389     7e-27  28%  420 aa  HEM1_YERP3 RecName: Full=Glutamyl-tRNA reductase;       
   11::355     7e-27  25%  420 aa  HEM1_SERP5 RecName: Full=Glutamyl-tRNA reductase;       
    3::296     7e-27  31%  432 aa  HEM1_CYAP4 RecName: Full=Glutamyl-tRNA reductase;       
   46::430     7e-27  27%  453 aa  HEM1_CHLAD RecName: Full=Glutamyl-tRNA reductase;       
    5::387     1e-26  29%  430 aa  HEM1_LAWIP RecName: Full=Glutamyl-tRNA reductase;       
   15::349     1e-26  29%  449 aa  HEM1_HALHL RecName: Full=Glutamyl-tRNA reductase;       
    5::398     1e-26  30%  440 aa  HEM1_DESVV RecName: Full=Glutamyl-tRNA reductase;       
    5::398     1e-26  30%  440 aa  HEM1_DESVH RecName: Full=Glutamyl-tRNA reductase;       
    6::401     1e-26  28%  418 aa  HEM1_AERS4 RecName: Full=Glutamyl-tRNA reductase;       
   43::403     1e-26  27%  419 aa  HEM1_PSYIN RecName: Full=Glutamyl-tRNA reductase;       
    3::417     1e-26  26%  437 aa  HEM1_PAEMA RecName: Full=Glutamyl-tRNA reductase;       
   38::408     1e-26  27%  414 aa  HEM1_FRATN RecName: Full=Glutamyl-tRNA reductase;       
   11::346     1e-26  26%  418 aa  HEM1_ERWT9 RecName: Full=Glutamyl-tRNA reductase;       
   11::295     1e-26  30%  459 aa  HEM1_BACHD RecName: Full=Glutamyl-tRNA reductase;       
   17::420     2e-26  26%  440 aa  HEM1_HELHP RecName: Full=Glutamyl-tRNA reductase;       
    3::421     2e-26  25%  466 aa  HEM1_COREF RecName: Full=Glutamyl-tRNA reductase;       
   11::371     2e-26  27%  431 aa  HEM1_ACIAD RecName: Full=Glutamyl-tRNA reductase;       
    3::412     2e-26  26%  423 aa  HEM1_IDILO RecName: Full=Glutamyl-tRNA reductase;       
   18::426     2e-26  26%  449 aa  HEM1_HELPJ RecName: Full=Glutamyl-tRNA reductase;       
   18::426     2e-26  25%  449 aa  HEM1_HELPG RecName: Full=Glutamyl-tRNA reductase;       
    6::416     2e-26  27%  419 aa  HEM1_AERHH RecName: Full=Glutamyl-tRNA reductase;       
    3::296     2e-26  29%  433 aa  HEM1_ACAM1 RecName: Full=Glutamyl-tRNA reductase;       
   15::416     3e-26  29%  437 aa  HEM1_LISW6 RecName: Full=Glutamyl-tRNA reductase;       
   13::414     4e-26  24%  425 aa  HEM1_CYTH3 RecName: Full=Glutamyl-tRNA reductase;       
    5::415     4e-26  24%  438 aa  HEM1_CORDI RecName: Full=Glutamyl-tRNA reductase;       
   21::379     4e-26  28%  403 aa  HEM11_CLOPH RecName: Full=Glutamyl-tRNA reductase 1;       
    6::407     5e-26  25%  416 aa  HEM1_SHEWM RecName: Full=Glutamyl-tRNA reductase;       
   11::407     5e-26  25%  429 aa  HEM1_MARAV RecName: Full=Glutamyl-tRNA reductase;       
   10::388     5e-26  27%  432 aa  HEM1_CAMJ8 RecName: Full=Glutamyl-tRNA reductase;       
    3::392     6e-26  28%  431 aa  HEM1_TRIEI RecName: Full=Glutamyl-tRNA reductase;       
    6::391     6e-26  27%  416 aa  HEM1_SHEHH RecName: Full=Glutamyl-tRNA reductase;       
    2::413     6e-26  25%  429 aa  HEM1_RUBXD RecName: Full=Glutamyl-tRNA reductase;       
   13::367     6e-26  29%  430 aa  HEM1_DESDA RecName: Full=Glutamyl-tRNA reductase;       
   38::408     8e-26  26%  414 aa  HEM1_FRATW RecName: Full=Glutamyl-tRNA reductase;       
   40::410     8e-26  26%  416 aa  HEM1_FRATT RecName: Full=Glutamyl-tRNA reductase;       
   38::408     8e-26  26%  414 aa  HEM1_FRATM RecName: Full=Glutamyl-tRNA reductase;       
   40::410     8e-26  26%  416 aa  HEM1_FRAT1 RecName: Full=Glutamyl-tRNA reductase;       
    5::423     8e-26  23%  463 aa  HEM1_CORGB RecName: Full=Glutamyl-tRNA reductase;       
   11::294     8e-26  29%  340 aa  HEM1_AKKM8 RecName: Full=Glutamyl-tRNA reductase;       
    6::391     1e-25  27%  416 aa  HEM1_SHEPA RecName: Full=Glutamyl-tRNA reductase;       
   11::359     1e-25  25%  420 aa  HEM1_NITOC RecName: Full=Glutamyl-tRNA reductase;       
   11::388     1e-25  25%  422 aa  HEM1_MARMS RecName: Full=Glutamyl-tRNA reductase;       
   11::358     1e-25  24%  418 aa  HEM1_ERWCT RecName: Full=Glutamyl-tRNA reductase;       
    5::423     1e-25  23%  463 aa  HEM1_CORGL RecName: Full=Glutamyl-tRNA reductase;       
    6::391     1e-25  26%  416 aa  HEM1_SHEPW RecName: Full=Glutamyl-tRNA reductase;       
    5::385     1e-25  27%  416 aa  HEM1_SHEFN RecName: Full=Glutamyl-tRNA reductase;       
   96::466     1e-25  31%  542 aa  HEM12_CUCSA RecName: Full=Glutamyl-tRNA reductase 2, chloroplastic;
    6::387     2e-25  25%  419 aa  HEM1_VIBVU RecName: Full=Glutamyl-tRNA reductase;       
   38::408     2e-25  26%  414 aa  HEM1_FRATH RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-25  26%  444 aa  HEM1_BACCR RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-25  26%  444 aa  HEM1_BACC4 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-25  26%  444 aa  HEM1_BACC2 RecName: Full=Glutamyl-tRNA reductase;       
   11::346     2e-25  24%  420 aa  HEM1_EDWI9 RecName: Full=Glutamyl-tRNA reductase;       
    5::373     2e-25  29%  442 aa  HEM1_DESVM RecName: Full=Glutamyl-tRNA reductase;       
   40::410     3e-25  26%  416 aa  HEM1_FRATO RecName: Full=Glutamyl-tRNA reductase;       
   38::408     3e-25  25%  414 aa  HEM1_FRATF RecName: Full=Glutamyl-tRNA reductase;       
    5::296     3e-25  28%  432 aa  HEM1_CYAPA RecName: Full=Glutamyl-tRNA reductase;       
   11::417     3e-25  27%  444 aa  HEM1_BACHK RecName: Full=Glutamyl-tRNA reductase;       
   11::417     3e-25  27%  444 aa  HEM1_BACCZ RecName: Full=Glutamyl-tRNA reductase;       
   11::417     3e-25  27%  444 aa  HEM1_BACC3 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     3e-25  27%  444 aa  HEM1_BACC0 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     3e-25  27%  444 aa  HEM1_BACAN RecName: Full=Glutamyl-tRNA reductase;       
   11::417     3e-25  27%  444 aa  HEM1_BACAH RecName: Full=Glutamyl-tRNA reductase;       
   11::417     3e-25  27%  444 aa  HEM1_BACAC RecName: Full=Glutamyl-tRNA reductase;       
   11::417     3e-25  27%  444 aa  HEM1_BACAA RecName: Full=Glutamyl-tRNA reductase;       
   11::358     4e-25  24%  420 aa  HEM1_PHOLL RecName: Full=Glutamyl-tRNA reductase;       
   10::388     4e-25  27%  432 aa  HEM1_CAMJJ RecName: Full=Glutamyl-tRNA reductase;       
   10::388     4e-25  28%  432 aa  HEM1_CAMJE RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-25  26%  444 aa  HEM1_BACCQ RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-25  26%  444 aa  HEM1_BACC7 RecName: Full=Glutamyl-tRNA reductase;       
    6::289     5e-25  30%  419 aa  HEM1_VIBVY RecName: Full=Glutamyl-tRNA reductase;       
    3::358     5e-25  28%  425 aa  HEM1_ROSS1 RecName: Full=Glutamyl-tRNA reductase;       
    3::268     5e-25  34%  395 aa  HEM1_METST RecName: Full=Glutamyl-tRNA reductase;       
    6::385     7e-25  29%  416 aa  HEM1_SHEDO RecName: Full=Glutamyl-tRNA reductase;       
   15::416     7e-25  28%  435 aa  HEM1_LISIN RecName: Full=Glutamyl-tRNA reductase;       
   11::411     9e-25  28%  436 aa  HEM1_WOLSU RecName: Full=Glutamyl-tRNA reductase;       
    6::385     9e-25  27%  416 aa  HEM1_SHESM RecName: Full=Glutamyl-tRNA reductase;       
    3::296     9e-25  31%  428 aa  HEM1_MICAN RecName: Full=Glutamyl-tRNA reductase;       
   10::388     9e-25  27%  432 aa  HEM1_CAMJR RecName: Full=Glutamyl-tRNA reductase;       
   50::411     9e-25  26%  434 aa  HEM12_FLAJ1 RecName: Full=Glutamyl-tRNA reductase 2;       
    6::385     1e-24  27%  416 aa  HEM1_SHEON RecName: Full=Glutamyl-tRNA reductase;       
    3::296     1e-24  28%  428 aa  HEM1_NOSP7 RecName: Full=Glutamyl-tRNA reductase;       
   11::388     1e-24  29%  446 aa  HEM1_MACCJ RecName: Full=Glutamyl-tRNA reductase;       
   11::348     1e-24  29%  424 aa  HEM1_HAHCH RecName: Full=Glutamyl-tRNA reductase;       
   10::388     1e-24  27%  432 aa  HEM1_CAMJD RecName: Full=Glutamyl-tRNA reductase;       
   78::488     1e-24  28%  527 aa  HEM11_HORVU RecName: Full=Glutamyl-tRNA reductase 1, chloroplastic;
   11::349     2e-24  24%  420 aa  HEM1_SODGM RecName: Full=Glutamyl-tRNA reductase;       
    3::288     2e-24  30%  425 aa  HEM1_ROSCS RecName: Full=Glutamyl-tRNA reductase;       
    6::358     2e-24  27%  420 aa  HEM1_PHOPR RecName: Full=Glutamyl-tRNA reductase;       
   88::498     2e-24  28%  537 aa  HEM1_ORYSI RecName: Full=Glutamyl-tRNA reductase, chloroplastic;   
   11::417     2e-24  25%  443 aa  HEM1_BACWK RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-24  26%  444 aa  HEM1_BACC1 RecName: Full=Glutamyl-tRNA reductase;       
   37::381     3e-24  26%  432 aa  HEM1_XANCP RecName: Full=Glutamyl-tRNA reductase;       
   37::381     3e-24  26%  432 aa  HEM1_XANC8 RecName: Full=Glutamyl-tRNA reductase;       
    6::385     3e-24  27%  416 aa  HEM1_SHESR RecName: Full=Glutamyl-tRNA reductase;       
    6::385     3e-24  27%  416 aa  HEM1_SHESA RecName: Full=Glutamyl-tRNA reductase;       
   43::420     3e-24  24%  426 aa  HEM1_RHOBA RecName: Full=Glutamyl-tRNA reductase;       
   88::498     3e-24  28%  537 aa  HEM1_ORYSJ RecName: Full=Glutamyl-tRNA reductase, chloroplastic;   
   11::417     3e-24  28%  457 aa  HEM1_OCEIH RecName: Full=Glutamyl-tRNA reductase;       
   11::344     3e-24  30%  424 aa  HEM1_CHRSD RecName: Full=Glutamyl-tRNA reductase;       
   15::345     3e-24  25%  418 aa  HEM1_AZOSE RecName: Full=Glutamyl-tRNA reductase;       
   16::426     3e-24  28%  465 aa  HEM12_HORVU RecName: Full=Glutamyl-tRNA reductase 2;       
   38::381     4e-24  26%  432 aa  HEM1_XANCB RecName: Full=Glutamyl-tRNA reductase;       
    5::281     4e-24  31%  427 aa  HEM1_STRMK RecName: Full=Glutamyl-tRNA reductase;       
   42::281     4e-24  34%  422 aa  HEM1_METBU RecName: Full=Glutamyl-tRNA reductase;       
    6::384     4e-24  25%  418 aa  HEM1_ALCBS RecName: Full=Glutamyl-tRNA reductase;       
    5::282     6e-24  29%  427 aa  HEM1_STRM5 RecName: Full=Glutamyl-tRNA reductase;       
    6::362     6e-24  27%  416 aa  HEM1_SHESW RecName: Full=Glutamyl-tRNA reductase;       
    6::362     6e-24  27%  416 aa  HEM1_SHEPC RecName: Full=Glutamyl-tRNA reductase;       
   11::289     6e-24  27%  426 aa  HEM1_PSEMY RecName: Full=Glutamyl-tRNA reductase;       
   11::292     6e-24  29%  456 aa  HEM1_MYCVP RecName: Full=Glutamyl-tRNA reductase;       
   42::331     8e-24  29%  390 aa  HEM1_THET2 RecName: Full=Glutamyl-tRNA reductase;       
   11::373     8e-24  29%  425 aa  HEM1_PSEP1 RecName: Full=Glutamyl-tRNA reductase;       
   13::346     8e-24  30%  453 aa  HEM1_DESMR RecName: Full=Glutamyl-tRNA reductase;       
   11::336     8e-24  29%  349 aa  HEM1_DEIGD RecName: Full=Glutamyl-tRNA reductase;       
   11::418     1e-23  27%  441 aa  HEM1_MOOTA RecName: Full=Glutamyl-tRNA reductase;       
    3::419     1e-23  23%  428 aa  HEM1_ANAVT RecName: Full=Glutamyl-tRNA reductase;       
   42::331     1e-23  29%  390 aa  HEM1_THET8 RecName: Full=Glutamyl-tRNA reductase;       
   11::373     1e-23  29%  425 aa  HEM1_PSEPK RecName: Full=Glutamyl-tRNA reductase;       
    3::419     1e-23  23%  428 aa  HEM1_ANASP RecName: Full=Glutamyl-tRNA reductase;       
    5::353     2e-23  27%  418 aa  HEM1_DICNV RecName: Full=Glutamyl-tRNA reductase;       
    5::397     2e-23  24%  458 aa  HEM1_CORA7 RecName: Full=Glutamyl-tRNA reductase;       
   40::417     2e-23  26%  454 aa  HEM1_BREBN RecName: Full=Glutamyl-tRNA reductase;       
   11::349     2e-23  29%  446 aa  HEM1_ALHEH RecName: Full=Glutamyl-tRNA reductase;       
   84::480     2e-23  26%  535 aa  HEM13_HORVU RecName: Full=Glutamyl-tRNA reductase 3, chloroplastic;
    5::417     2e-23  26%  455 aa  HEM1_GEOTN RecName: Full=Glutamyl-tRNA reductase;       
    5::390     2e-23  25%  434 aa  HEM1_GEOLS RecName: Full=Glutamyl-tRNA reductase;       
    6::353     2e-23  25%  429 aa  HEM1_BURP8 RecName: Full=Glutamyl-tRNA reductase;       
   38::281     3e-23  31%  432 aa  HEM1_XYLFT RecName: Full=Glutamyl-tRNA reductase;       
   38::281     3e-23  31%  432 aa  HEM1_XYLF2 RecName: Full=Glutamyl-tRNA reductase;       
    5::284     3e-23  31%  434 aa  HEM1_THICR RecName: Full=Glutamyl-tRNA reductase;       
    3::392     3e-23  25%  426 aa  HEM1_THEEB RecName: Full=Glutamyl-tRNA reductase;       
    4::391     3e-23  24%  416 aa  HEM1_RUTMC RecName: Full=Glutamyl-tRNA reductase;       
   30::386     3e-23  29%  404 aa  HEM1_METKA RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-23  24%  445 aa  HEM1_STACT RecName: Full=Glutamyl-tRNA reductase;       
    3::427     4e-23  25%  435 aa  HEM1_PROM5 RecName: Full=Glutamyl-tRNA reductase;       
   15::416     4e-23  28%  435 aa  HEM1_LISMO RecName: Full=Glutamyl-tRNA reductase;       
    3::401     4e-23  28%  448 aa  HEM1_EXISA RecName: Full=Glutamyl-tRNA reductase;       
    3::296     4e-23  28%  428 aa  HEM1_CYAP8 RecName: Full=Glutamyl-tRNA reductase;       
    3::296     4e-23  30%  428 aa  HEM1_CYAP7 RecName: Full=Glutamyl-tRNA reductase;       
  104::523     4e-23  27%  552 aa  HEM11_CUCSA RecName: Full=Glutamyl-tRNA reductase 1, chloroplastic;
   13::327     5e-23  29%  406 aa  HEM1_THERP RecName: Full=Glutamyl-tRNA reductase;       
   15::360     5e-23  27%  434 aa  HEM1_RALEJ RecName: Full=Glutamyl-tRNA reductase;       
   15::416     5e-23  28%  435 aa  HEM1_LISMH RecName: Full=Glutamyl-tRNA reductase;       
   38::381     6e-23  25%  432 aa  HEM1_XANOM RecName: Full=Glutamyl-tRNA reductase;       
   38::381     6e-23  25%  426 aa  HEM1_XANAC RecName: Full=Glutamyl-tRNA reductase;       
   11::373     6e-23  29%  425 aa  HEM1_PSEPG RecName: Full=Glutamyl-tRNA reductase;       
   15::416     6e-23  28%  435 aa  HEM1_LISMF RecName: Full=Glutamyl-tRNA reductase;       
   15::416     6e-23  28%  435 aa  HEM1_LISMC RecName: Full=Glutamyl-tRNA reductase;       
    3::296     6e-23  26%  430 aa  HEM1_CYAA5 RecName: Full=Glutamyl-tRNA reductase;       
   38::281     8e-23  31%  432 aa  HEM1_XYLFA RecName: Full=Glutamyl-tRNA reductase;       
   38::381     8e-23  25%  432 aa  HEM1_XANOR RecName: Full=Glutamyl-tRNA reductase;       
   38::381     8e-23  25%  432 aa  HEM1_XANOP RecName: Full=Glutamyl-tRNA reductase;       
   38::381     8e-23  25%  432 aa  HEM1_XANC5 RecName: Full=Glutamyl-tRNA reductase;       
    3::290     8e-23  29%  425 aa  HEM1_SYNP2 RecName: Full=Glutamyl-tRNA reductase;       
   45::390     8e-23  28%  420 aa  HEM1_NITMU RecName: Full=Glutamyl-tRNA reductase;       
   11::283     8e-23  27%  429 aa  HEM1_CAMHC RecName: Full=Glutamyl-tRNA reductase;       
   38::281     1e-22  31%  432 aa  HEM1_XYLFM RecName: Full=Glutamyl-tRNA reductase;       
   11::417     1e-22  23%  421 aa  HEM1_SOLUE RecName: Full=Glutamyl-tRNA reductase;       
   15::388     1e-22  28%  434 aa  HEM1_RALME RecName: Full=Glutamyl-tRNA reductase;       
    6::407     1e-22  24%  416 aa  HEM1_SHESH RecName: Full=Glutamyl-tRNA reductase;       
    6::362     1e-22  26%  416 aa  HEM1_SHEB9 RecName: Full=Glutamyl-tRNA reductase;       
    6::362     1e-22  26%  416 aa  HEM1_SHEB8 RecName: Full=Glutamyl-tRNA reductase;       
    6::362     1e-22  26%  416 aa  HEM1_SHEB5 RecName: Full=Glutamyl-tRNA reductase;       
    6::362     1e-22  26%  416 aa  HEM1_SHEB2 RecName: Full=Glutamyl-tRNA reductase;       
   25::368     1e-22  25%  383 aa  HEM1_META3 RecName: Full=Glutamyl-tRNA reductase;       
   38::381     2e-22  25%  426 aa  HEM1_XANCH RecName: Full=Glutamyl-tRNA reductase;       
    3::428     2e-22  25%  437 aa  HEM1_PROMA RecName: Full=Glutamyl-tRNA reductase;       
    5::417     2e-22  25%  454 aa  HEM1_LYSSC RecName: Full=Glutamyl-tRNA reductase;       
    5::390     2e-22  28%  434 aa  HEM1_GEOSM RecName: Full=Glutamyl-tRNA reductase;       
    3::366     2e-22  26%  454 aa  HEM1_GEOKA RecName: Full=Glutamyl-tRNA reductase;       
    5::390     2e-22  28%  434 aa  HEM1_GEOBB RecName: Full=Glutamyl-tRNA reductase;       
   45::329     2e-22  26%  334 aa  HEM1_ALKOO RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-22  26%  438 aa  HEM1_PERMH RecName: Full=Glutamyl-tRNA reductase;       
   11::373     3e-22  26%  425 aa  HEM1_PSEE4 RecName: Full=Glutamyl-tRNA reductase;       
   11::289     4e-22  28%  425 aa  HEM1_PSEU2 RecName: Full=Glutamyl-tRNA reductase;       
   11::289     4e-22  27%  425 aa  HEM1_PSEPW RecName: Full=Glutamyl-tRNA reductase;       
   11::289     4e-22  28%  425 aa  HEM1_PSE14 RecName: Full=Glutamyl-tRNA reductase;       
    3::301     5e-22  28%  438 aa  HEM1_SYNP6 RecName: Full=Glutamyl-tRNA reductase;       
    3::301     5e-22  28%  438 aa  HEM1_SYNE7 RecName: Full=Glutamyl-tRNA reductase;       
   15::360     5e-22  27%  434 aa  HEM1_RALEH RecName: Full=Glutamyl-tRNA reductase;       
    3::427     5e-22  26%  433 aa  HEM1_PROMP RecName: Full=Glutamyl-tRNA reductase;       
   43::399     5e-22  24%  434 aa  HEM1_DESAA RecName: Full=Glutamyl-tRNA reductase;       
   11::325     7e-22  30%  477 aa  HEM1_THEFY RecName: Full=Glutamyl-tRNA reductase;       
    3::391     7e-22  23%  427 aa  HEM1_SYNY3 RecName: Full=Glutamyl-tRNA reductase;       
    3::400     7e-22  24%  442 aa  HEM1_SYNR3 RecName: Full=Glutamyl-tRNA reductase;       
   11::289     7e-22  28%  425 aa  HEM1_PSESM RecName: Full=Glutamyl-tRNA reductase;       
   11::347     7e-22  25%  413 aa  HEM1_COXBU RecName: Full=Glutamyl-tRNA reductase;       
   11::347     7e-22  25%  413 aa  HEM1_COXBR RecName: Full=Glutamyl-tRNA reductase;       
   11::347     7e-22  25%  413 aa  HEM1_COXBN RecName: Full=Glutamyl-tRNA reductase;       
    6::353     7e-22  26%  432 aa  HEM1_BURCM RecName: Full=Glutamyl-tRNA reductase;       
   37::282     7e-22  30%  437 aa  HEM1_ARCFU RecName: Full=Glutamyl-tRNA reductase;       
    3::427     9e-22  24%  436 aa  HEM1_PROM0 RecName: Full=Glutamyl-tRNA reductase;       
   11::346     9e-22  26%  424 aa  HEM1_LEGPL RecName: Full=Glutamyl-tRNA reductase;       
    3::295     9e-22  31%  434 aa  HEM1_GEOMG RecName: Full=Glutamyl-tRNA reductase;       
   40::405     1e-21  26%  417 aa  HEM1_STRSV RecName: Full=Glutamyl-tRNA reductase;       
    6::385     1e-21  26%  416 aa  HEM1_SHEAM RecName: Full=Glutamyl-tRNA reductase;       
   11::289     1e-21  26%  422 aa  HEM1_PSEAE RecName: Full=Glutamyl-tRNA reductase;       
   11::289     1e-21  26%  422 aa  HEM1_PSEAB RecName: Full=Glutamyl-tRNA reductase;       
   11::289     1e-21  26%  422 aa  HEM1_PSEA8 RecName: Full=Glutamyl-tRNA reductase;       
   11::289     1e-21  26%  422 aa  HEM1_PSEA7 RecName: Full=Glutamyl-tRNA reductase;       
    3::427     1e-21  23%  436 aa  HEM1_PROMM RecName: Full=Glutamyl-tRNA reductase;       
   11::386     1e-21  26%  441 aa  HEM1_MYXXD RecName: Full=Glutamyl-tRNA reductase;       
   11::346     1e-21  26%  424 aa  HEM1_LEGPH RecName: Full=Glutamyl-tRNA reductase;       
   11::346     1e-21  26%  424 aa  HEM1_LEGPC RecName: Full=Glutamyl-tRNA reductase;       
   11::346     1e-21  26%  424 aa  HEM1_LEGPA RecName: Full=Glutamyl-tRNA reductase;       
    3::427     2e-21  25%  441 aa  HEM1_PROMT RecName: Full=Glutamyl-tRNA reductase;       
   15::362     2e-21  28%  438 aa  HEM1_POLSQ RecName: Full=Glutamyl-tRNA reductase;       
   11::421     2e-21  25%  455 aa  HEM1_MYCGI RecName: Full=Glutamyl-tRNA reductase;       
   11::418     2e-21  27%  443 aa  HEM1_MYCA9 RecName: Full=Glutamyl-tRNA reductase;       
   42::285     2e-21  31%  460 aa  HEM1_METAC RecName: Full=Glutamyl-tRNA reductase;       
    6::353     2e-21  26%  432 aa  HEM1_BURA4 RecName: Full=Glutamyl-tRNA reductase;       
   11::289     2e-21  27%  424 aa  HEM1_PSEF5 RecName: Full=Glutamyl-tRNA reductase;       
   17::407     2e-21  28%  416 aa  HEM1_NITEU RecName: Full=Glutamyl-tRNA reductase;       
   17::350     2e-21  28%  424 aa  HEM1_BORA1 RecName: Full=Glutamyl-tRNA reductase;       
    3::427     3e-21  24%  436 aa  HEM1_PROM2 RecName: Full=Glutamyl-tRNA reductase;       
   32::286     3e-21  32%  449 aa  HEM1_METBF RecName: Full=Glutamyl-tRNA reductase;       
   88::495     3e-21  27%  530 aa  HEM12_ARATH RecName: Full=Glutamyl-tRNA reductase 2, chloroplastic;
    5::291     4e-21  35%  421 aa  HEM1_MAGSM RecName: Full=Glutamyl-tRNA reductase;       
   11::373     5e-21  26%  428 aa  HEM1_PSEPF RecName: Full=Glutamyl-tRNA reductase;       
    3::427     5e-21  25%  436 aa  HEM1_PROM9 RecName: Full=Glutamyl-tRNA reductase;       
   11::295     5e-21  31%  473 aa  HEM1_MYCUA RecName: Full=Glutamyl-tRNA reductase;       
   20::411     5e-21  24%  418 aa  HEM1_GRAFK RecName: Full=Glutamyl-tRNA reductase;       
   38::408     5e-21  23%  414 aa  HEM1_FRAP2 RecName: Full=Glutamyl-tRNA reductase;       
    6::410     5e-21  24%  428 aa  HEM1_BURPP RecName: Full=Glutamyl-tRNA reductase;       
   97::516     5e-21  28%  543 aa  HEM11_ARATH RecName: Full=Glutamyl-tRNA reductase 1, chloroplastic;
   45::251     6e-21  41%  420 aa  HEM1_WIGBR RecName: Full=Glutamyl-tRNA reductase;       
   15::345     6e-21  27%  416 aa  HEM1_THIDA RecName: Full=Glutamyl-tRNA reductase;       
   11::289     6e-21  27%  423 aa  HEM1_PSEA6 RecName: Full=Glutamyl-tRNA reductase;       
    3::427     6e-21  23%  436 aa  HEM1_PROMS RecName: Full=Glutamyl-tRNA reductase;       
    3::286     6e-21  33%  446 aa  HEM1_EXIS2 RecName: Full=Glutamyl-tRNA reductase;       
   15::373     6e-21  26%  417 aa  HEM1_AZOSB RecName: Full=Glutamyl-tRNA reductase;       
    3::400     8e-21  23%  436 aa  HEM1_PROM3 RecName: Full=Glutamyl-tRNA reductase;       
   17::278     8e-21  32%  421 aa  HEM1_LACRJ RecName: Full=Glutamyl-tRNA reductase;       
   17::278     8e-21  32%  421 aa  HEM1_LACRD RecName: Full=Glutamyl-tRNA reductase;       
    3::374     1e-20  24%  431 aa  HEM1_SYNJB RecName: Full=Glutamyl-tRNA reductase;       
    3::427     1e-20  24%  441 aa  HEM1_PROM1 RecName: Full=Glutamyl-tRNA reductase;       
   36::396     1e-20  27%  399 aa  HEM1_METS3 RecName: Full=Glutamyl-tRNA reductase;       
    5::283     1e-20  27%  414 aa  HEM1_HERA2 RecName: Full=Glutamyl-tRNA reductase;       
   24::275     2e-20  32%  448 aa  HEM1_METMA RecName: Full=Glutamyl-tRNA reductase;       
   38::286     2e-20  32%  350 aa  HEM1_DEIRA RecName: Full=Glutamyl-tRNA reductase;       
   15::344     3e-20  25%  414 aa  HEM1_METFK RecName: Full=Glutamyl-tRNA reductase;       
   30::301     3e-20  29%  515 aa  HEM1_CLOJO RecName: Full=Glutamyl-tRNA reductase;       
    6::353     3e-20  25%  428 aa  HEM1_BURXL RecName: Full=Glutamyl-tRNA reductase;       
   38::408     5e-20  24%  443 aa  HEM1_PELCD RecName: Full=Glutamyl-tRNA reductase;       
   17::345     5e-20  30%  417 aa  HEM1_NITEC RecName: Full=Glutamyl-tRNA reductase;       
   15::288     5e-20  29%  415 aa  HEM1_NEIM0 RecName: Full=Glutamyl-tRNA reductase;       
   15::326     5e-20  24%  331 aa  HEM1_CLOTH RecName: Full=Glutamyl-tRNA reductase;       
   15::360     7e-20  26%  435 aa  HEM1_RALSO RecName: Full=Glutamyl-tRNA reductase;       
   44::415     7e-20  24%  426 aa  HEM1_POLSJ RecName: Full=Glutamyl-tRNA reductase;       
   15::288     7e-20  29%  415 aa  HEM1_NEIMF RecName: Full=Glutamyl-tRNA reductase;       
   15::288     7e-20  29%  415 aa  HEM1_NEIMC RecName: Full=Glutamyl-tRNA reductase;       
   15::288     7e-20  29%  415 aa  HEM1_NEIMA RecName: Full=Glutamyl-tRNA reductase;       
   49::368     7e-20  31%  443 aa  HEM1_METPP RecName: Full=Glutamyl-tRNA reductase;       
    3::295     7e-20  29%  434 aa  HEM1_GEOSL RecName: Full=Glutamyl-tRNA reductase;       
   15::391     9e-20  26%  441 aa  HEM1_BURPS RecName: Full=Glutamyl-tRNA reductase;       
    8::384     9e-20  26%  434 aa  HEM1_BURP6 RecName: Full=Glutamyl-tRNA reductase;       
    6::382     9e-20  26%  432 aa  HEM1_BURP1 RecName: Full=Glutamyl-tRNA reductase;       
    8::384     9e-20  26%  434 aa  HEM1_BURP0 RecName: Full=Glutamyl-tRNA reductase;       
    8::384     9e-20  26%  434 aa  HEM1_BURMS RecName: Full=Glutamyl-tRNA reductase;       
    6::382     9e-20  26%  432 aa  HEM1_BURMA RecName: Full=Glutamyl-tRNA reductase;       
    8::384     9e-20  26%  434 aa  HEM1_BURM9 RecName: Full=Glutamyl-tRNA reductase;       
    8::384     9e-20  26%  434 aa  HEM1_BURM7 RecName: Full=Glutamyl-tRNA reductase;       
   17::350     9e-20  27%  424 aa  HEM1_BORPE RecName: Full=Glutamyl-tRNA reductase;       
   17::350     9e-20  27%  424 aa  HEM1_BORPA RecName: Full=Glutamyl-tRNA reductase;       
   17::350     9e-20  27%  424 aa  HEM1_BORBR RecName: Full=Glutamyl-tRNA reductase;       
   15::288     1e-19  28%  415 aa  HEM1_NEIG2 RecName: Full=Glutamyl-tRNA reductase;       
   15::288     1e-19  28%  415 aa  HEM1_NEIG1 RecName: Full=Glutamyl-tRNA reductase;       
    3::286     1e-19  29%  431 aa  HEM1_SYNJA RecName: Full=Glutamyl-tRNA reductase;       
    5::418     3e-19  26%  459 aa  HEM1_PSYA2 RecName: Full=Glutamyl-tRNA reductase;       
    6::353     3e-19  26%  432 aa  HEM1_BURVG RecName: Full=Glutamyl-tRNA reductase;       
    6::353     3e-19  25%  432 aa  HEM1_BURCA RecName: Full=Glutamyl-tRNA reductase;       
    3::427     4e-19  24%  435 aa  HEM1_PROM4 RecName: Full=Glutamyl-tRNA reductase;       
   15::336     4e-19  29%  417 aa  HEM1_CHRVO RecName: Full=Glutamyl-tRNA reductase;       
    6::353     4e-19  25%  432 aa  HEM1_BURCJ RecName: Full=Glutamyl-tRNA reductase;       
    6::353     6e-19  25%  432 aa  HEM1_BURS3 RecName: Full=Glutamyl-tRNA reductase;       
    6::353     6e-19  25%  432 aa  HEM1_BURCH RecName: Full=Glutamyl-tRNA reductase;       
    6::353     6e-19  25%  432 aa  HEM1_BURCC RecName: Full=Glutamyl-tRNA reductase;       
   39::288     1e-18  28%  415 aa  HEM1_NEIMB RecName: Full=Glutamyl-tRNA reductase;       
   42::273     1e-18  29%  402 aa  HEM1_METTH RecName: Full=Glutamyl-tRNA reductase;       
    5::423     1e-18  25%  464 aa  HEM1_PSYCK RecName: Full=Glutamyl-tRNA reductase;       
   44::415     1e-18  24%  429 aa  HEM1_POLNA RecName: Full=Glutamyl-tRNA reductase;       
    6::353     1e-18  26%  432 aa  HEM1_BURM1 RecName: Full=Glutamyl-tRNA reductase;       
    3::427     2e-18  25%  432 aa  HEM1_SYNS9 RecName: Full=Glutamyl-tRNA reductase;       
   50::358     2e-18  24%  429 aa  HEM1_HERAR RecName: Full=Glutamyl-tRNA reductase;       
   11::289     3e-18  28%  443 aa  HEM1_STAS1 RecName: Full=Glutamyl-tRNA reductase;       
   11::366     3e-18  23%  448 aa  HEM1_STAHJ RecName: Full=Glutamyl-tRNA reductase;       
   49::343     3e-18  29%  432 aa  HEM1_ACIAC RecName: Full=Glutamyl-tRNA reductase;       
   36::375     4e-18  26%  409 aa  HEM1_THEAC RecName: Full=Glutamyl-tRNA reductase;       
   11::289     4e-18  26%  429 aa  HEM1_PSEFS RecName: Full=Glutamyl-tRNA reductase;       
    7::363     4e-18  22%  431 aa  HEM11_ACIBL RecName: Full=Glutamyl-tRNA reductase 1;       
   25::270     5e-18  32%  398 aa  HEM1_METTM RecName: Full=Glutamyl-tRNA reductase;       
   20::411     6e-18  23%  413 aa  HEM1_FLAPJ RecName: Full=Glutamyl-tRNA reductase;       
   37::275     8e-18  27%  406 aa  HEM1_CALMQ RecName: Full=Glutamyl-tRNA reductase;       
   15::430     1e-17  23%  434 aa  HEM1_CHLSY RecName: Full=Glutamyl-tRNA reductase;       
   15::430     1e-17  23%  434 aa  HEM1_CHLAA RecName: Full=Glutamyl-tRNA reductase;       
    6::353     1e-17  25%  432 aa  HEM1_BURTA RecName: Full=Glutamyl-tRNA reductase;       
    3::427     2e-17  24%  438 aa  HEM1_SYNPW RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-17  23%  448 aa  HEM1_STAES RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-17  23%  448 aa  HEM1_STAEQ RecName: Full=Glutamyl-tRNA reductase;       
    3::427     2e-17  24%  437 aa  HEM1_SYNS3 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAAW RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAAT RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAAS RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAAN RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAAM RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAAE RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAAC RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAA9 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAA3 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAA2 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     4e-17  23%  448 aa  HEM1_STAA1 RecName: Full=Glutamyl-tRNA reductase;       
   11::417     7e-17  23%  448 aa  HEM1_STAAR RecName: Full=Glutamyl-tRNA reductase;       
   38::285     7e-17  29%  417 aa  HEM1_METTP RecName: Full=Glutamyl-tRNA reductase;       
   11::417     1e-16  23%  448 aa  HEM1_STAA8 RecName: Full=Glutamyl-tRNA reductase;       
    6::377     1e-16  23%  425 aa  HEM1_SACD2 RecName: Full=Glutamyl-tRNA reductase;       
   85::297     2e-16  27%  423 aa  HEM1_SYNAS RecName: Full=Glutamyl-tRNA reductase;       
   11::417     2e-16  23%  448 aa  HEM1_STAAB RecName: Full=Glutamyl-tRNA reductase;       
   11::289     2e-16  24%  422 aa  HEM1_PSEU5 RecName: Full=Glutamyl-tRNA reductase;       
   35::333     2e-16  27%  423 aa  HEM1_METMJ RecName: Full=Glutamyl-tRNA reductase;       
   20::434     2e-16  22%  494 aa  HEM1_CORU7 RecName: Full=Glutamyl-tRNA reductase;       
   46::290     2e-16  28%  429 aa  HEM1_VEREI RecName: Full=Glutamyl-tRNA reductase;       
   11::155     2e-16  35%  476 aa  HEM1_FRASN RecName: Full=Glutamyl-tRNA reductase;       
   44::294     3e-16  29%  419 aa  HEM1_RHOFD RecName: Full=Glutamyl-tRNA reductase;       
    5::377     3e-16  25%  451 aa  HEM1_PSYWF RecName: Full=Glutamyl-tRNA reductase;       
   43::155     3e-16  38%  470 aa  HEM1_FRAAA RecName: Full=Glutamyl-tRNA reductase;       
   50::349     3e-16  28%  436 aa  HEM1_ACISJ RecName: Full=Glutamyl-tRNA reductase;       
   20::262     4e-16  26%  416 aa  HEM11_FLAJ1 RecName: Full=Glutamyl-tRNA reductase 1;       
   12::419     1e-15  21%  461 aa  HEM1_SYNFM RecName: Full=Glutamyl-tRNA reductase;       
    5::356     1e-15  29%  455 aa  HEM1_SALAI RecName: Full=Glutamyl-tRNA reductase;       
   11::300     1e-15  28%  467 aa  HEM1_MYCLE RecName: Full=Glutamyl-tRNA reductase;       
   11::155     1e-15  30%  459 aa  HEM1_MYCPA RecName: Full=Glutamyl-tRNA reductase;       
   11::155     1e-15  30%  459 aa  HEM1_MYCA1 RecName: Full=Glutamyl-tRNA reductase;       
   50::358     1e-15  24%  429 aa  HEM1_JANMA RecName: Full=Glutamyl-tRNA reductase;       
    5::294     2e-15  27%  455 aa  HEM1_SALTO RecName: Full=Glutamyl-tRNA reductase;       
   45::409     2e-15  26%  436 aa  HEM1_HALSA RecName: Full=Glutamyl-tRNA reductase;       
   45::409     2e-15  26%  436 aa  HEM1_HALS3 RecName: Full=Glutamyl-tRNA reductase;       
   11::228     4e-15  26%  447 aa  HEM1_MYCSS RecName: Full=Glutamyl-tRNA reductase;       
   11::228     4e-15  26%  447 aa  HEM1_MYCSK RecName: Full=Glutamyl-tRNA reductase;       
   11::228     4e-15  26%  447 aa  HEM1_MYCSJ RecName: Full=Glutamyl-tRNA reductase;       
    3::427     6e-15  23%  432 aa  HEM1_SYNSC RecName: Full=Glutamyl-tRNA reductase;       
   32::331     6e-15  22%  479 aa  HEM1_SALRD RecName: Full=Glutamyl-tRNA reductase;       
   37::278     1e-14  31%  427 aa  HEM1_UNCMA RecName: Full=Glutamyl-tRNA reductase;       
   40::282     1e-14  34%  424 aa  HEM1_METB6 RecName: Full=Glutamyl-tRNA reductase;       
    5::289     1e-14  25%  430 aa  HEM11_NOCSJ RecName: Full=Glutamyl-tRNA reductase 1;       
    3::294     1e-14  26%  432 aa  HEM1_SYNPX RecName: Full=Glutamyl-tRNA reductase;       
    5::224     2e-14  29%  479 aa  HEM1_RHOSR RecName: Full=Glutamyl-tRNA reductase;       
    6::382     2e-14  24%  454 aa  HEM1_HALWD RecName: Full=Glutamyl-tRNA reductase;       
   15::287     2e-14  25%  446 aa  HEM12_ANADE RecName: Full=Glutamyl-tRNA reductase 2;       
    6::402     3e-14  21%  415 aa  HEM1_TERTT RecName: Full=Glutamyl-tRNA reductase;       
    5::224     4e-14  28%  478 aa  HEM1_RHOOB RecName: Full=Glutamyl-tRNA reductase;       
   14::273     4e-14  28%  335 aa  HEM1_CHLTB RecName: Full=Glutamyl-tRNA reductase;       
   14::273     4e-14  28%  335 aa  HEM1_CHLT2 RecName: Full=Glutamyl-tRNA reductase;       
   39::270     5e-14  27%  401 aa  HEM1_PICTO RecName: Full=Glutamyl-tRNA reductase;       
   25::242     7e-14  29%  414 aa  HEM1_SULAC RecName: Full=Glutamyl-tRNA reductase;       
   52::394     7e-14  24%  497 aa  HEM1_CORJK RecName: Full=Glutamyl-tRNA reductase;       
    9::306     2e-13  26%  529 aa  HEM1_SORC5 RecName: Full=Glutamyl-tRNA reductase;       
   15::273     2e-13  29%  335 aa  HEM1_CHLTA RecName: Full=Glutamyl-tRNA reductase;       
   11::155     2e-13  28%  468 aa  HEM1_MYCTU RecName: Full=Glutamyl-tRNA reductase;       
   11::155     2e-13  28%  468 aa  HEM1_MYCTA RecName: Full=Glutamyl-tRNA reductase;       
   11::155     2e-13  28%  468 aa  HEM1_MYCBT RecName: Full=Glutamyl-tRNA reductase;       
   11::155     2e-13  28%  468 aa  HEM1_MYCBP RecName: Full=Glutamyl-tRNA reductase;       
   11::155     2e-13  28%  468 aa  HEM1_MYCBO RecName: Full=Glutamyl-tRNA reductase;       
   45::379     2e-13  24%  448 aa  HEM1_HALMA RecName: Full=Glutamyl-tRNA reductase;       
   15::273     2e-13  29%  335 aa  HEM1_CHLTR RecName: Full=Glutamyl-tRNA reductase;       
    5::427     3e-13  26%  477 aa  HEM1_NOCFA RecName: Full=Glutamyl-tRNA reductase;       
   43::155     6e-13  33%  473 aa  HEM1_FRASC RecName: Full=Glutamyl-tRNA reductase;       
    5::158     6e-13  30%  473 aa  HEM1_ACIC1 RecName: Full=Glutamyl-tRNA reductase;       
    1::221     1e-12  27%  423 aa  HEM12_ANADF RecName: Full=Glutamyl-tRNA reductase 2;       
   42::261     1e-12  27%  387 aa  HEM11_PYRAR RecName: Full=Glutamyl-tRNA reductase 1;       
   11::300     2e-12  25%  451 aa  HEM1_MYCS2 RecName: Full=Glutamyl-tRNA reductase;       
    5::289     2e-12  26%  442 aa  HEM1_KINRD RecName: Full=Glutamyl-tRNA reductase;       
    3::284     7e-12  25%  340 aa  HEM1_PARUW RecName: Full=Glutamyl-tRNA reductase;       
   35::196     7e-12  32%  453 aa  HEM1_NATPD RecName: Full=Glutamyl-tRNA reductase;       
   51::162     9e-12  32%  441 aa  HEM1_IGNH4 RecName: Full=Glutamyl-tRNA reductase;       
   82::155     1e-11  42%  569 aa  HEM1_STRAW RecName: Full=Glutamyl-tRNA reductase;       
   14::386     3e-11  24%  440 aa  HEM11_ANADF RecName: Full=Glutamyl-tRNA reductase 1;       
    5::296     4e-11  25%  453 aa  HEM1_RHOE4 RecName: Full=Glutamyl-tRNA reductase;       
   43::363     6e-11  27%  424 aa  HEM1_METHJ RecName: Full=Glutamyl-tRNA reductase;       
   46::198     1e-10  32%  424 aa  HEM1_METS5 RecName: Full=Glutamyl-tRNA reductase;       
    9::414     1e-10  24%  424 aa  HEM1_METLZ RecName: Full=Glutamyl-tRNA reductase;       
   49::155     1e-10  33%  581 aa  HEM1_STRCO RecName: Full=Glutamyl-tRNA reductase;       
   15::155     1e-10  28%  468 aa  HEM1_SACEN RecName: Full=Glutamyl-tRNA reductase;       
   56::239     4e-10  27%  333 aa  HEM1_CHLMU RecName: Full=Glutamyl-tRNA reductase;       
   37::223     6e-10  30%  426 aa  HEM1_SULIY RecName: Full=Glutamyl-tRNA reductase;       
   37::223     6e-10  30%  426 aa  HEM1_SULIN RecName: Full=Glutamyl-tRNA reductase;       
   37::223     6e-10  30%  426 aa  HEM1_SULIM RecName: Full=Glutamyl-tRNA reductase;       
   37::223     6e-10  30%  426 aa  HEM1_SULIL RecName: Full=Glutamyl-tRNA reductase;       
   37::223     6e-10  30%  426 aa  HEM1_SULIK RecName: Full=Glutamyl-tRNA reductase;       
   37::223     6e-10  30%  426 aa  HEM1_SULIA RecName: Full=Glutamyl-tRNA reductase;       
    5::143     6e-10  29%  416 aa  HEM1_AERPE RecName: Full=Glutamyl-tRNA reductase;       
   42::426     8e-10  27%  447 aa  HEM1_TROWT RecName: Full=Glutamyl-tRNA reductase;       
   42::426     8e-10  27%  447 aa  HEM1_TROW8 RecName: Full=Glutamyl-tRNA reductase;       
   41::237     2e-09  26%  409 aa  HEM1_THEVO RecName: Full=Glutamyl-tRNA reductase;       
   46::151     2e-09  31%  338 aa  HEM1_CHLFF RecName: Full=Glutamyl-tRNA reductase;       
    7::144     5e-09  29%  397 aa  HEM1_PYRAE RecName: Full=Glutamyl-tRNA reductase;       
   28::285     5e-09  28%  417 aa  HEM1_CENSY RecName: Full=Glutamyl-tRNA reductase;       
    2::196     7e-09  25%  339 aa  HEM1_CHLPN RecName: Full=Glutamyl-tRNA reductase;       
    2::193     7e-09  27%  338 aa  HEM1_CHLAB RecName: Full=Glutamyl-tRNA reductase;       
   36::139     1e-08  31%  380 aa  HEM11_PYRCJ RecName: Full=Glutamyl-tRNA reductase 1;       
   43::217     2e-08  26%  411 aa  HEM1_HYPBU RecName: Full=Glutamyl-tRNA reductase;       
   46::151     2e-08  33%  338 aa  HEM1_CHLCV RecName: Full=Glutamyl-tRNA reductase;       
   43::151     2e-08  33%  440 aa  HEM1_ARTAT RecName: Full=Glutamyl-tRNA reductase;       
   34::144     2e-08  32%  403 aa  HEM12_PYRAR RecName: Full=Glutamyl-tRNA reductase 2;       
   37::223     8e-08  28%  426 aa  HEM1_SULSO RecName: Full=Glutamyl-tRNA reductase;       
   97::201     5e-07  29%  431 aa  HEM1_RHORT RecName: Full=Glutamyl-tRNA reductase;       
   40::151     6e-07  32%  446 aa  HEM1_ARTS2 RecName: Full=Glutamyl-tRNA reductase;       
   43::151     1e-06  33%  441 aa  HEM1_ARTCA RecName: Full=Glutamyl-tRNA reductase;       
   49::239     2e-06  25%  412 aa  HEM1_SULTO RecName: Full=Glutamyl-tRNA reductase;       
   42::151     2e-06  29%  393 aa  HEM1_PYRIL RecName: Full=Glutamyl-tRNA reductase;       
   85::144     4e-06  35%  391 aa  HEM12_PYRCJ RecName: Full=Glutamyl-tRNA reductase 2;       
    1::119     5e-06  30%  422 aa  HEM11_ANADE RecName: Full=Glutamyl-tRNA reductase 1;       
   42::147     7e-06  29%  437 aa  HEM1_KOCRD RecName: Full=Glutamyl-tRNA reductase;       
   85::151     2e-05  30%  393 aa  HEM1_THENV RecName: Full=Glutamyl-tRNA reductase;       
   11::297     2e-04  19%  439 aa  HEM1_CLAMS RecName: Full=Glutamyl-tRNA reductase;       
   12::151     2e-04  22%  448 aa  HEM12_NOCSJ RecName: Full=Glutamyl-tRNA reductase 2;       
   45::148     4e-04  28%  450 aa  HEM1_MICLC RecName: Full=Glutamyl-tRNA reductase;       
   11::291     4e-04  19%  439 aa  HEM1_CLAM3 RecName: Full=Glutamyl-tRNA reductase;       
   37::148     5e-04  27%  444 aa  HEM1_PROAC RecName: Full=Glutamyl-tRNA reductase;       
 1411::1482    5e-04  28% 1557 aa  DVA1_DICVI RecName: Full=DVA-1 polyprotein;AltName: Full=Antigen
  119::227     9e-04  31%  794 aa  SYFB_MYCCT RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
    1::400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
HEM1_CLOPE      MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
HEM1_CLOPS      MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
HEM1_CLOP1      MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
HEM1_CLOB8      MIGLIGIRKNTPLEIREKFIVKSKKYNEYFGELLKELNEVVILATCNRTEIYFNAS--LNEEELLKKIFD
HEM1_CLOBA      MIAVLGIKRNTPIEIREKLTIKANKHDEYLDRLLKYLDGVIILATCNRTEIYFNVS--FINEELLKKIFE
HEM1_CLOBB      MIAVLGIKRNTPIEIREKLTIKVNKHDEYLDKLLKYLEGVVILATCNRTEIYFNVSS--INEELLKKIFE
HEM1_CLOTE      MIGVLGVKTEVKLDIREKLSIIPKRYESSLMKLKEKCDEVVILSTCNRTEVYYSYKKH--NENIISHIFK
HEM1_CLOK5      MIQLIGIKSQCDIGIRQKFSITSEVLEKYINELVGS---VLILSTCNRTEIYVD--SNLEEKKLIDTVFY
HEM1_CLOK1      MIQLIGIKSQCDIGIRQKFSITSEVLEKYINELVGS---VLILSTCNRTEIYVD--SNLEEKKLIDTVFY
HEM1_CLOAB      MIQLLALKRDLKVEIREKFSIIEKRIGDKDVLLKEVCNEVVILSTCNRIEIYFN--SEKNRKQIIEEIFS
HEM1_ANATD      MLWVIGINHKVEVDIRQKFSLIKTKLQEKLISLKKLANEVIILSTCNRTEIYFFSEEYVD----IEKIFT
HEM1_CALS8      MLWVIGINHKVEVDIRQKFSLTKTKLQEKLISLKKLADEVIILSTCNRTEIYFFSEEYVD----IEKIFT
HEM1_CLONN      -LAVIGINNNTPIDIREKVSFSKQKYKACTYLIKKGISEIIIVSTCNRSEIYI-CSDEIDSNEVVN-FYK
HEM1_CARHZ      ---VVGVNRTAPVEVREKLSFSDHQLKDAFSALLSSIDGSVILSTCNRTEVYVASLDVDTGLKVVREF--
HEM1_CAMC1      --------KNTDISVREKLAFDSDEKKEQILKLINSIKESMVLNTCNRVEIIASVEDVKAATAHIIRCMS
HEM1_DESRM      LIAVIGVNRTAPLEVREKLAFTEWGMKDSLKRLMSGIDGCAIVSTCNRTEIY------IAPMELDSGMSS
HEM1_PROMH      --------KTAPVALREKVSFSPDTMGDALNNLLQAVRGGVVLSTCNRTELYLSLEDENSHEQLISWLCQ
HEM1_ACTSZ      ---VLGINKTATVALREKVAFSEEKRLSALNQILKLAQSTVILSTCNRTEVYLH-NKFIQPEQNSAWIDE
HEM1_THEYD      ---VIGLNKTAPVEIREKIAFNSKEAKEALKELIQGIGEVVIISTCNRVEIYVNVSDLKRENQVEETISN
HEM1_NITSB      --------KNTDIVTREKLALSDDNKREDVATTLLQINEAIILSTCNRIEIILSVKDPFSATEVLKKLSE
HEM1_NATTJ      ILAVIGINHETSVETREQLAFSSKQVKELVQKLIEGIKEASVLSTCNRTEVHFTVNTEAGKNHIMTYLSD
HEM1_HAES1      ---VLGINKTASVALREKVAFSDEKRLLALKQIKQTAESAVILSTCNRTEVYLHNNDEVWLDSCVQWFAD
HEM1_DESDG      -IFIIGLNRTADVEVREKFALTGTSLEPAVIPLGNGISEVIILSTCNRVEIMVAGRGDDVPDTVLSLWAN
HEM1_ECOLC      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECOHS      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_VIBCM      ----IGINHNTSVELREKVAFGPEKLSLALNQLSTSVKGGVILSTCNRTEIYCD-VRSASKNKVIEWLSQ
HEM1_VIBCH      ----IGINHNTSVELREKVAFGPEKLSLALNQLSTSVKGGVILSTCNRTEIYCD-VRSASKNKVIEWLSQ
HEM1_VIBC3      ----IGINHNTSVELREKVAFGPEKLSLALNQLSTSVKGGVILSTCNRTEIYCD-VRSASKNKVIEWLSQ
HEM1_ESCF3      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_VIBSL      ----VGINHNTSVELREKVAFGPDKLSEALKQL-NANAHVVILSTCNRTEVYCD-VKGVAKNKLIDWL-S
HEM1_SHISS      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SHIDS      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SHIBS      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SHIB3      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_HAES2      ---VLGINKTASVALREKVAFSDEKRLLALKQIKQTAECAVILSTCNRTEVYLHNNDEVWLDSCVQWFAD
HEM1_ECOSE      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECO8A      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECO55      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECO24      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SHIFL      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SHIF8      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECOLU      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECOLI      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECODH      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECOBW      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECO5E      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_ECO57      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_THEM4      -LNLVGLGRNTPIYILEK---FDFDEQEFFSSLKVKTTEVAVLKTCHRREIYY----------IGDK--E
HEM1_SULSY      --------KTAPVEIREKLAITENNYGLIL-EKLNSIEEICVISTCNRVELYGVSNDNI--EKVKEEILR
HEM1_HELMO      -IFVVGLNKSAPVEVREKLSFTEAQLSEALHKLMAGIEGCCILSTCNRTEIY-GASTDMEKGMTAVKRF-
HEM1_CAMC5      --------KNTDISVREKLAFDSDEKKDQILRLLKSSKNIIVLSTCNRVEVLAYTNDIKSAMTHIIRCLT
HEM1_BACSU      ---VVGVDKSAPIEIREKVSFQPNELAEAMVQLKESILENIIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_PELTS      LILVVGLNRTAPVEVREKLSFSAKSLQGALAQLKSYIEGCAILSTCNRTEIY---AATLEMDDGLNAIWD
HEM1_MANSM      ---VLGINKTASVALREKVAFSPEKRDLAFQQIAQSAQSEVILSTCNRTEIYLH-NKHISPEADQENLEQ
HEM1_ECOL5      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQAGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_DESHY      --------KTAPVEIREKVSFHPSEINKALMELLSALNGIVLLSTCNRLEIYA-ATPEVELGVSVIKKFL
HEM1_DESHD      --------KTAPVEIREKVSFHPSEINKALMELLSALNGIVLLSTCNRLEIYA-ATPEVELGVSVIKKFL
HEM1_DESAP      LITVVGLNRTAPLAVREKLS-FPEHTLKEVLRGLSDREGVVVISTCNRTEVYAVLSEEDGLQNIWCFLAE
HEM1_ECOUT      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_ECOL6      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_ECOK1      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_ECO81      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_ECO45      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_CHLL2      ----VGVNKTAPIEIRERIALSEVQNKEFITDLISSAHEAMVVSTCNRTELYVPAMTEVTGEYLKEYLIS
HEM1_ECO27      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_ECOSM      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_ECO7I      --------KTAPVSLRERVSFSPDKLDQALDSLLAQVQGGVVLSTCNRTELYLSVEERDDLQEALIRLCD
HEM1_PROA2      ----VGVNKTAPIEIRERISLSEVQAKEFLSDIISSAQEAMVLSTCNRTELYVPGMSEVTGHYLKEYLIS
HEM1_CHLTE      ----VGVNKTAPIEIRERIALSEVQNKELVTDLVSSASEAMVVSTCNRTELYVPGMPEVNCDYLKDYIIS
HEM1_ALISL      ---VIGINHSATVDLREKVAFSPDKLTKALDELKNSIKSGVILSTCNRTEIYCEVKLGISSGYVINWLAE
HEM1_KLEP7      --------KTAPVALRERVTFSPETLDKALESLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCN
HEM1_FUSNN      ---VIGVSHNLSLLEREN---FMRTRPKYIIERLYTEKKIINLSTCLRTEFYIELNSNIKAKEIK----N
HEM1_VIBF1      ---VIGINHSASVDLREKVAFSPEKLTKALDELKNSIQSGVILSTCNRTEIYCEVKHGISSGYVINWLAE
HEM1_VIBFM      ---VIGINHSASVDLREKVAFSPEKLTKALDELKNSIQSGVILSTCNRTEIYCEVKHGISSGYVINWLAE
HEM1_SALTY      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALTI      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALSV      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALPK      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALPB      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALPA      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALNS      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALHS      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALG2      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALEP      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALDC      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALCH      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALAR      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_SALA4      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_PASMU      ---VIGINKTASVAIREKVAFSAEKRVEXXXXXXXXXESAVILSTCNRTEVYFH-HKAIPPQEAESWTAR
HEM1_CITK8      --------KTAPVSLRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCD
HEM1_CHLP8      ----VGVNKTAPIEIRERIALSEVQNKEFVTDLVSSASEAMVVSTCNRTELYVPGMPEVNCDYLKDYIIS
HEM1_METM6      -------------------------------EFYKKYEACVVVQTCNRIEAYFDT--EVNSD--IDCILN
HEM1_ENTS8      --------KTAPVSLRERVTFSPDTLDQALESLLSQVQGGVVLSTCNRTELYLSVEEQ---DNLHDKLVR
HEM1_VIBPA      ----IGINHNTSVDLREKVAFGPDK----LGPALEQLRESVIVSTCNRTELYCD-VKQGARNKLIDWLAQ
HEM1_BACSK      --------KTAPVEIREKLVFSEHQLPEALKKLRSSMMECVILSTCNRTELYV-VADQLHTGRYFAKAF-
HEM1_PELLD      ----VGVNKTAPIEIRERISLSEVQNKEFITGLISGAHEAMVLSTCNRTELYVPAMHEVTGEYLKDYIIS
HEM1_KLEP3      --------KTAPVDLRERVTFSPETLDQALESLLAQVQGGVVLSTCNRTELYLSVEEQDNLQEALIRLCN
HEM1_ACTPJ      --------KTASVNLRSKVAFDDQKRQLAFEQIQHRAESVVILSTCNRTELYFHNAEITPREEHEDNIAQ
HEM1_ACTP7      --------KTASVNLRSKVAFDDQKRQLAFEQIQHRAESVVILSTCNRTELYFHNAEITPREEHEDNIAQ
HEM1_PSEHT      --------KTAPVELREKVAFSPEQISEALQQLSGHFNEAVIVSTCNRTEVYCSLAQQNSQTLL--QWLS
HEM1_SULNB      --------KNCEQSMREKLAFPNDEEKATFLEQLTGFEEAFIISTCNRVEIVMATRDNFSS---YHAVLG
HEM1_ALKMQ      VFGITHKKATIDL--REKVAFSQSKKQEAYSLLKESIHEAVILSTCNRSEVFAVVQDTSIARRWFKRFYT
HEM1_PROVI      ----VGVNKTAPIEIRERISLSEVQNKEFVTGLVSAAHEAMVLSTCNRTEIYVPAMHEVTGEYLKDYIIS
HEM1_ACTP2      --------KTASVNLRSKVAFDDQKRQLAFEQIQHRAESVVILSTCNRTELYFHNAEITPREEHEDNIAQ
HEM1_VIBHB      ----IGINHNTSVDLREKVAFGPDK----LGPALEQLRESVIVSTCNRTEVYCD-VKQGARNKLIDWLAQ
HEM1_CAMLR      --------KNTDIATREKLSFSNEDKKRELLKLINKILESLVLSTCNRVEIFLFVGDVESINEHILKTLS
HEM1_BACP2      ---VVGLDKTAPVEIREQLSFEPSELGTAMSKLKESILENIVISTCNRTEIYA-VVDQLHTGRFYIKRF-
HEM1_BACA2      ---VVGVDKSAPIEIREKISFQPDELAEAMLRLKGSVLENIIVSTCNRTEIYA-VVDQLHTGRYYIKTF-
HEM1_ACIBC      --------QTASVELREQIAFNAERLSNLLAEQRHSLKDLVVVSTCNRTEVY-----AMAEDAE-----S
HEM1_METM7      -------------------------------EFYKKYEACVVVQTCNRIEAYFDTEVNSNVDDIL-KDFQ
HEM1_ENT38      --------KTAPVALRERVTFSPDTLDQALDSLLAQVQGGVVLSTCNRTELYLSVEEQDNLHEALIRLCE
HEM1_BACLD      ---VVGLDKSAPVDIREKLTFQPDELGQAMAQLKESILENIIVSTCNRTELYA-VVDQLHTGRYYMKMF-
HEM1_METM5      -------------------------------EFYNKYDACVVVQTCNRIEAYFDTEINSNVDGIL-KDFQ
HEM1_HAEPS      --------KTASVSLREKVAFVEDKRQRAFEQIRDQSESVVILSTCNRTELYFHQPKIPPQEEHPDNIAQ
HEM1_CHLPB      ----VGVNKTAPIEIRERLSLSEVQAKEFLTNLIDDAQEAMVVSTCNRTELYVPGMPEVDGNYMKEFLIS
HEM1_ACIBY      --------QTASVELREQIAFNAERLSNLLAEQRHSLKDLVVVSTCNRTEVY-----AMAEDAE-----S
HEM1_ACIBT      --------QTASVELREQIAFNAERLSNLLAEQRHSLKDLVVVSTCNRTEVY-----AMAEDAE-----S
HEM1_ACIBS      --------QTASVELREQIAFNAERLSNLLAEQRHSLKDLVVVSTCNRTEVY-----AMAEDAE-----S
HEM1_ACIB5      --------QTASVELREQIAFNAERLSNLLAEQRHSLKDLVVVSTCNRTEVY-----AMAEDAE-----S
HEM1_ACIB3      --------QTASVELREQIAFNAERLSNLLAEQRHSLKDLVVVSTCNRTEVY-----AMAEDAE-----S
HEM1_CHLPD      ----VGVNKTAPIEIRERISLSEVQNKEFITDLISSAHEAMVISTCNRTELYVPAMHEVTGEYLKEYLIA
HEM1_PELPD      ---VVGLSKTAPVEVRERVAFSPNLIERPLRELLDDISEGVIVSTCNRVEIYAT-THDIAGGTARIKRFL
HEM1_METJA      -----------------------------------TFDNAILLQTCNRVEIIFDADEEIKGIE-------
HEM1_HELPY      --------KSMSLEMREKLAINSNATKEFLQTIKNNIKECMVLSTCNRFEIYASLKHGANTNEQKNALLK
HEM1_HELPS      --------KSMGLEMREKLAINSSATKEFLQTIKNNIKECMVLSTCNRFEIYASLKHGAHANEQKSALLK
HEM1_COLP3      -IVAVGINKTAPVAVREKISFNPDKLSIALQEMLNAVREVAILSTCNRTELYLDGDFDVTQQRLIKWLES
HEM1_ARCB4      --------KNTDIKLREKLAFNSDEDKDRFLKLIDITKEAILLSTCNRVEIITRSLNKQSSKDIIEKLAT
HEM1_AQUAE      -IFVAGVNFKVPVEVREKLACSLEETKKVLPILKRELEEVMLLSTCNRVEVYAYNFVENSED-LINKLLE
HEM1_VESOH      -IAILSVNHQLPVEVREKVAFTPDKLTQALSDLIYGIYACIILSTCNRVEIYVNSDNENPKEVLSNYLAK
HEM1_PELPB      ----VGVNKTAPIEIRERISLSEVQNKEFITGLISSAHEAMVVSTCNRTELYVPAIYEVNGEFLKEYLIS
HEM1_HELP2      --------KSMSLEMREKLAINSSTTLKEFLQTIKTIKECMVLSTCNRFEIYASLKHGANTNEQKNALLK
HEM1_METMP      -------------------------------EFYKKYDACVVVQTCNRIEAYFDT--EVNSD--LNCILN
HEM1_HELPH      --------KSMSLEMREKLAINSSATKEFLQTIKNNIKECMVLSTCNRFEIYASLRHGAHANEQKSALLK
HEM1_METCA      ------------VSIRERLAFPAEQLQSALRDLIDQVGEAAILSTCNRTEVYCELDGR-DQRPIVDWMCD
HEM1_BACCN      ---VVGVNRTVPVEIREKLTFQETELKRAMTTLQSSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_METVS      -------------------------------EFYGKYDACIIVQTCNRIEAYFD--EEINDIEKIIPDFK
HEM1_HELAH      --------KSMSLEMREKLAINPAILKEFLQTIKNNIKECMVLSTCNRFEIYASLKHNTHADEQKNALLK
HEM1_DESAD      -IYLIGLNRSAGVDVRERYALTNVEEFES-GLLELGVREVMALSTCNRVEILVVCAPEITQPNILEYAKR
HEM1_DECAR      MIFTLGINHHAPLAIRERVAFGADKLPHALADLTREVREVAILSTCNRTEIY--CSAE-SPDVVIDWLAH
HEM12_ACIBL     ---VIGVNKTAPVEVRERFAI-PESRLPEATKLLASYEEGMIVSTCNRVEMVARSVNGNADMRGFLK--Q
HEM1_PECCP      --------KTAPVSLRERVVFSPDKLGVALDSLLQQVQGGVVLSTCNRTELYLSVDEQENQREQLIRWLC
HEM1_GLOVI      -IAVIGLSRTAPVEIRERVSIAEGQVPEYVSRLCSQVAECAILSTCNRLEIYTVLRD--SEHGLREVTRF
HEM1_CHLCH      ----VGVNKTAPIEIRERISLSEVQNKEFITGLVSSAHEAMVLSTCNRTELYVPAMHEVTGEFLKEYLIS
HEM1_GEOSF      ---VVGLSKTAAVEIREKVAFSPTQMEKPLHALVSDITEGVIVSTCNRVEIYAT-TRDIAGGIARLKRFL
HEM1_BACME      --------RTAPVEIREKLSFNEQELASAMKTLSGSILENIIVSTCNRTEIYA-VVDQLHTGRYYVKAF-
HEM1_SHELP      ----IGINKTATVDLREKVAFAPDKIHEAMKSLASRTKEAVIVSTCNRTELYCNTGDEADVISWLESYHQ
HEM1_YERE8      --------KTAPVSLRERVTFSPESIDQALASLLQQVQGGVVLSTCNRTELYLSVEQQENHEQLIAWLCN
HEM1_SULDN      --------KNSTLDVREKLSYKDDYATKGCLSKLNSINESILISTCNRMEVFCSCSDIASATKIFEMLAA
HEM1_GEOUR      ---VVGLSKTATVEIREKVAFAPTQMEKPLHALVSDITEAVIVSTCNRVEIYAT-TRDIAGGVARLKRFL
HEM1_CAMFF      --------KNTDIGVREKLSFSDNNRRREILRLIDSIAESMALSTCNRVEIFAYVLDTQSS------IRH
HEM12_CLOPH     -ISMVGIDYNTSIEDREHFTLTSDKQLEIAKIIKETYHACIILSTCNRTEIWFS-ELGTSEAECFHQLVL
HEM1_DESPS      --------KTTPVAVREKIAFYETALTRLQEEV--GCDESYLLSTCNRVEIYADSTRDI-EAEVSRFLFA
HEM1_CHLT3      ----VGVNHNTPIELREKISLTDSMARSLLTELIDSASEALVLSTCNRTELYVPAMPEVTANYLKDYLIA
HEM1_YERPS      --------KTAPVSLRERVTFSPESMDQALNSLLQQVQGGVVLSTCNRTELYLSVEQQENHEQLTAWLCN
HEM1_YERPP      --------KTAPVSLRERVTFSPESMDQALNSLLQQVQGGVVLSTCNRTELYLSVEQQENHEQLTAWLCN
HEM1_YERPN      --------KTAPVSLRERVTFSPESMDQALNSLLQQVQGGVVLSTCNRTELYLSVEQQENHEQLTAWLCN
HEM1_YERPG      --------KTAPVSLRERVTFSPESMDQALNSLLQQVQGGVVLSTCNRTELYLSVEQQENHEQLTAWLCN
HEM1_YERPE      --------KTAPVSLRERVTFSPESMDQALNSLLQQVQGGVVLSTCNRTELYLSVEQQENHEQLTAWLCN
HEM1_YERPA      --------KTAPVSLRERVTFSPESMDQALNSLLQQVQGGVVLSTCNRTELYLSVEQQENHEQLTAWLCN
HEM1_YERP3      --------KTAPVSLRERVTFSPESMDQALNSLLQQVQGGVVLSTCNRTELYLSVEQQENHEQLTAWLCN
HEM1_SERP5      --------KTAPVSLRERVTFSPESIEQALTSLLQQVQGGVVLSTCNRTELYLSVEQEHIHEQLVSWLCE
HEM1_CYAP4      -IAVVGLSKTAPVEVREKLSVPEDGLEGAIAQLCSHIEEVAILSTCNRLEIYIVTSE--TESGIREVTQF
HEM1_CHLAD      ------------------------------------FTEAVILSTCNRVEIYGVANPGTTAQHVVDFLAN
HEM1_LAWIP      -IYLIGMNRTASIDVRECFALTEHCSKDWAIPLIKGIQESLILSTCNRVEILANTPEIILSAWAKVKTRS
HEM1_HALHL      ------------VAVRESLAF----NAEALGDALQSAREVAILSTCNRTEIYIRLPH--TDPEV------
HEM1_DESVV      -IYLIGLNRTAGVEVRERFALTDNVLEQGVVPIDDVVSEVLILSTCNRVEIL----AVGRGPEVVSRVLR
HEM1_DESVH      -IYLIGLNRTAGVEVRERFALTDNVLEQGVVPIDDVVSEVLILSTCNRVEIL----AVGRGPEVVSRVLR
HEM1_AERS4      ----LGINHNTSVALRERVAFGPDCIDRALRELVTQVSEAVIVSTCNRTELY--CSLEKGQGEQVLHWLQ
HEM1_PSYIN      --------------------------------------EAVIVSTCNRTEIYCHLKQD-NCDEVIKWLCS
HEM1_PAEMA      -IVVVGLNRTAPVEVRERFSFAEKDMPQALQELLRSVLEGVIIATCNRTEIYV-VVDRLHMCGYFIRSF-
HEM1_FRATN      ---------------------------------IDNVVHAVILSTCNRTEVYL----EISDLRVVDDILY
HEM1_ERWT9      --------KTAPVALRERVTFTPDTLEQALNSLMAQIQGGVVLSTCNRTELYLSVEQQENQDQLIAWLCD
HEM1_BACHD      --------KTAPVEIREKFSFQDSELPQALHQLMKSILECTIVSTCNRTELYV-VADQLHTGRHFTKTF-
HEM1_HELHP      --------KNVDIATREKLSFSQEEIVPFLQEICDSIRESILLCTCNRVELYVSM---IDKKRAREHIYE
HEM1_COREF      ---VVGMSRSAPVALLERLSMDDSVRGQTTSALVESLSEALIVSTCNRLEVYVTSSFHTGVNDVVEVLHE
HEM1_ACIAD      --------QTASVELREQVAFNAERLKDLLAQQRNHLNDMVVVSTCNRTEVY-------AMTEHADILLN
HEM1_IDILO      -ISALGINKTASVDLREQVAFSAEQLDAALQAVRNGVEEAVIVSTCNRTELY--CRGEVSGDLLLGWLTG
HEM1_HELPJ      --------KSMSLEMREKLAINSPIMLKELLQTIKTIKECMVLSTCNRFEIYASLKHGANTHEQKSALLK
HEM1_HELPG      --------KSMSLEMREKLAINSSATLKEFLQTIKTIKECMVLSTCNRFEIYASLKHNTHANEQKNALLK
HEM1_AERHH      ----LGINHNTSVALRERVAFGPDCIDRALRELVAQVSEAVIVSTCNRTELY--CSLAQGQGEQVLQWLQ
HEM1_ACAM1      -IAVVGLSKTAPVDVREKLSIPDDVKEKATSQLRSHLEEVAILSTCNRMEVYVVAQE--TDDGIRELTQF
HEM1_LISW6      ------------IDIREKLVFKETEEEMALITLLQSILENVIISTCNRTEIVA-VVDQIHTGRYYLKRF-
HEM1_CYTH3      --------RKAPLEIRERVALNEAECKSLMLRIFTDTAELLILSTCNRTEIYYTSNEDYSNDKLLGVEKN
HEM1_CORDI      ---VVGMSRSAPVALLEKLSMDDGVRTNTVSDLVASLAEAMIVSTCNRLEVYMTSSFHTGVNDVVEVLHD
HEM11_CLOPH     --------------------------KKMAADVLLNIKEIIILSTCNRMEVWVSCFEEF-ETSIYEILCS
HEM1_SHEWM      ----IGINKTATVDLREKVAFSPDKIHDAMKSLAKCTKEAVIISTCNRTELYTNTGDEAEVIRWFEEYHQ
HEM1_MARAV      --------RTAPVEIRERVAFTPERMAEAFSELASGASEAAILSTCNRTELYLAGDDDCAPSVL--RWLA
HEM1_CAMJ8      --------KNTDIALREKLSFSNEAKKSEFLKIISTIEECLVISTCNRVEIVAFVKMACAEFIVKSLALL
HEM1_TRIEI      -IAVIGLSKTAPVEVREKLSLPETEIQNAISELCSGTQEVGILSTCNRLEIYVVTNEMIREVTQFLSESS
HEM1_SHEHH      ----IGINKTATVDLREKVAFAPDRIHDAMKSLASCTQEAVIISTCNRTELYCNNSEAADVVAWLEDYHQ
HEM1_RUBXD      LIAVAGMSRSAPVEARERVAFAPCAARSFLRRLRDGVPEAVLLSTCNRTELYVVAEAEPARDRLLGLLAE
HEM1_DESDA      --------RTAGVDVRERFALANHCDEEHWAPCTGAVSESIILSTCNRVEILAAGTGEVAEQVLRNWAGA
HEM1_FRATW      ---------------------------------IDNVVHAVILSTCNRTEVYL----EISDLRVVDDILY
HEM1_FRATT      ---------------------------------IDNVVHAVILSTCNRTEVYL----EISDLRVVDDILY
HEM1_FRATM      ---------------------------------IDNVVHAVILSTCNRTEVYL----EISDLRVVDDILY
HEM1_FRAT1      ---------------------------------IDNVVHAVILSTCNRTEVYL----EISDLRVVDDILY
HEM1_CORGB      ---IVGMSRSAPVSLLERLSMDDSVRGETTQALLGSLSEALIVSTCNRLEVYVTSSFHTGVNDVVEVLHE
HEM1_AKKM8      --------RTAPVEIRERFAV-PSHKLREEGQRIRSLPGVVVLSTCNRMEIYYSNAPENAQEHILSHFLG
HEM1_SHEPA      ----IGINKTATVDLREKVAFGPDKIHDAMKSLAASTQEAVIISTCNRTELYCNNCEAADVVAWLEDYHQ
HEM1_NITOC      --------KTASVAIREQITFAPERLPSALTELVNGAKEAAILSTCNRTELYCGCAPG-QQEAVIEWLRQ
HEM1_MARMS      --------KTAPVSIRERVAFAPEKMIDALSSLINKANEAVIVSTCNRTELYCS-VEDLS------KVDD
HEM1_ERWCT      --------KTAPVSLRERVVFSQDKLGVALDSLLQQVQGGVVLSTCNRTELYLSVDEQENQREQLIRWLC
HEM1_CORGL      ---IVGMSRSAPVSLLERLSMDDSVRGETTQALLGSLSEALIVSTCNRLEVYVTSSFHTGVNDVVEVLHE
HEM1_SHEPW      ----IGINKTATVDLREKVAFAPDRIHDAMKSLATHTQEAVIISTCNRTELYCNNGEEADVVQWLEDYHQ
HEM1_SHEFN      ---IIGINKTATVDLREKVAFSPDRIHDAMKSLASRTREAVIVSTCNRTELYCNNAEKEDIIEWLEDYHG
HEM12_CUCSA     -IVVIGLNHTAPVELREKLAIPEAQWPPGIGELLNHIEEAAVLSTCNRIEIYVVALSQ------HRGVKE
HEM1_VIBVU      ----IGINHHTSVDLREKVAFGPDKLANALQQLSQAVNGSVILSTCNRTEVYCD-VKSGARSKVIDWLSQ
HEM1_FRATH      ---------------------------------IDNVVHAVILSTCNRTEVYL----EISDLRVVDDILY
HEM1_BACCR      --------RTAPVEFREKLTFQAAEIERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACC4      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACC2      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_EDWI9      --------KTAPVSLRERVTFSPDTLDRAIESLLRSVQAGVVLSTCNRTELYLSVEQRADRQQIVDWLCS
HEM1_DESVM      -IYLIGLNRTASVEVRERFALTDTVLEQGVVPTGDDISEVVILSTCNRVEIMAVGNGPGVPARVLDCWAA
HEM1_FRATO      ---------------------------------IDNVVHAVILSTCNRTEVYL----EISNLRVVDDILY
HEM1_FRATF      ---------------------------------IDNVVHAVILSTCNRTEVYLEISDLIVVDDILVWWQG
HEM1_CYAPA      ---VVGLSKTAPVDFREKLSIPKVRIGEAIRELCNHIEEVAILSTCNRLEIYLLTSD--TYQGIREATQF
HEM1_BACHK      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACCZ      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACC3      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACC0      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACAN      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACAH      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACAC      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACAA      --------RTAPVEFREKLTFQAAELERAMTTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_PHOLL      --------KTAPVSLRERVTFSPDTIGEALDNLLQHVKGGVVLSTCNRTELYLSVEQQ---DNLYEQLIG
HEM1_CAMJJ      --------KNTDIALREKLSFSNEAKKSEFLKIISTIEECLVISTCNRVEIVAFVKMACAEFIVKSLALL
HEM1_CAMJE      --------KNTDIALREKLSFSNEAKK---GEFLKNIEECLVISTCNRVEIVAFVKMACAEFIVKSLALL
HEM1_BACCQ      --------RTAPVEFREKLTFQAAELEQAMTTLQNSVLENVIVSTCNRTEVYA-VVDQLHTGRYYIKKF-
HEM1_BACC7      --------RTAPVEFREKLTFQAAELEQAMTTLQNSVLENVIVSTCNRTEVYA-VVDQLHTGRYYIKKF-
HEM1_VIBVY      ----IGINHHTSVDLREKVAFGPDKLANALQQLSQAVNGSVILSTCNRTEVYCD-VKSGARSKVIDWLSQ
HEM1_ROSS1      -ITLIGVQRNTPVTVRERLAFNLYELPDALLALRRYVDEGIILSTCNRVEVCAVTRNGVAGDEAL-KTFL
HEM1_METST      ----------VNIRIDFKIADIETMEKSYAKDMINAILEEVTLKTCNRYEIYLLIDEEVNIPTTT-----
HEM1_SHEDO      ----IGINKTATVDLREKVAFSPDSIHDAMKSLASRTREAVILSTCNRTELY--CNDAVAT-EVIEWLAD
HEM1_LISIN      ------------IDIREKLVFKETEEEMALVTLLQSILENVIISTCNRTEIVA-VVDQIHTGRYYLKRF-
HEM1_WOLSU      --------KNTDIATRERLAFNGVRSESFLRELVNKFNEGILLSTCNRVEFILSVKEAHKAGDFLMEKLS
HEM1_SHESM      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIEWLEEYHG
HEM1_MICAN      -IAVVGLSKTAPVEIREKLSIPEAKIESALTHLKGHIQEVAIISTCNRLEIYAVVTDEITQAEIGHIPLN
HEM1_CAMJR      --------KNTDIALREKLSFSNEAKKSEFLKIISTIEECLVISTCNRVEIVAFVKMACAEFIVKSLALL
HEM12_FLAJ1     -------------------------------------ESLVVTSTCNRTEIYGFAHHPY---ELIKLLCE
HEM1_SHEON      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDETDIIEWLEEYHG
HEM1_NOSP7      -IAVVGLSKTAPVEVREKLSIPEPQIESAIAQLASHIDEVAILSTCNRLEIYIVTSEADQGIREITQFLA
HEM1_MACCJ      --------KTADVSLREKLTFSESSIQQALSALINSILEGVILSTCNRTEIYA-VTDQVHTGRYYVKSF-
HEM1_HAHCH      --------KTAPVAIREKVAFGPEKLADALERLRPDIDEVTILSTCNRTELYCATPGEPDEISLIEWLGQ
HEM1_CAMJD      --------KNTDIALREKLSFSNETKKSEFLKIISTIEECLVISTCNRVEIVAFVKMACAEFIVKSLALL
HEM11_HORVU     -IAVIGLSHTAPVEMREKLAVAEELWPRAISELLNHIEEAAVLSTCNRMEIY---VVALSWNR---GIRE
HEM1_SODGM      --------KTAPVALRERVAFSPETLDQALGSLLAHVQGGVVLSTCNRTELYLSVEQQADLQEALVRWLC
HEM1_ROSCS      -ITLIGVQRNTPVTVRERLAFSLRELPDALLALRRYVEEGIILSTCNRVEVCAVTHDSVGGDAALKSFLA
HEM1_PHOPR      ----LGINHNTSVDLREKVAFSPDKLKEALQQL-ESHPEVIIVSTCNRTEVYCDVTHS-GPGVMIDWLAK
HEM1_ORYSI      -IAVIGLSHTAPVEMREKLAVAEELWPRAISELLNHIEEAAVLSTCNRMEIY---VVALSWNR---GIRE
HEM1_BACWK      --------RTAPVEFREKLTFQAAELEQAMNTLQNSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_BACC1      --------RTAPVEFREKLTFQATELEQAMTTLQKSVLENVIVSTCNRTEIYA-VVDQLHTGRYYIKKF-
HEM1_XANCP      --------------------------------ILPQVREAALLSTCNRTELY----------AMADDPQT
HEM1_XANC8      --------------------------------ILPQVREAALLSTCNRTELY----------AMADDPQT
HEM1_SHESR      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIEWLEEYHG
HEM1_SHESA      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIEWLEEYHG
HEM1_RHOBA      --------------------------------------ELVLLSTCNRVELYGAGSNPASSDDLIDLVAD
HEM1_ORYSJ      -IAVIGLSHTAPVEMREKLAVAEELWPRAISELLNHIEEAAVLSTCNRMEIY---VVALSWNR---GIRE
HEM1_OCEIH      --------KTTPVDIREKFTFSEDSLQDAMVELKNSILEDVIISTCNRTEIYA-VVDQLHTGRYYIKQF-
HEM1_CHRSD      --------KTATIEVREQVAFTPAELAGALAELLPGVNEAAVLSTCNRTELYC-VTDSQGEREVLDWLGR
HEM1_AZOSE      ------------LTIREQVAFQPERLDDALHDLTHTVREAAILSTCNRTELYF-ATEQPQHAADWLARFH
HEM12_HORVU     -IAVIGLSHTAPVDMREKLAVAEELWPRAISELLNHIEEAAVLSTCNRMEIY---VVALSWNR---GIRE
HEM1_XANCB      ---------------------------------LPQVREAALLSTCNRTELY----------AMADDPQT
HEM1_STRMK      ---VLGLNQTAPVELRERAAFAGEALPRALGSLRDTIAEAVLLSTCNRTELY----------AVADSAQA
HEM1_METBU      --------------------------------------ECAVLKTCNRVEIYVVSSKGSSEMGVSAKIVE
HEM1_ALCBS      ----VGVNHTTDVELRERLAFSTQQAEVALASLMPGVREAALLSTCNRTELY--CLTDDVTPNFAQWLAS
HEM1_STRM5      ---VLGLNQTAPVELRERAAFAGEALPRALGSLRDTIAEAVLLSTCNRTELYAVADSAQALDQW------
HEM1_SHESW      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIEWLEEYHG
HEM1_SHEPC      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIEWLEEYHG
HEM1_PSEMY      --------KTASVEVRERVAFTPEQLVEALQQLLTPSREAAILSTCNRSELYLE-QDQLSSDEVLKWLAD
HEM1_MYCVP      --------RSAPVSVLEQLSVDDSDQAKLIDQVLQSVTEAMVLSTCNRVEIYAVVEAFHGGLSVIGQVLS
HEM1_THET2      ----------------------------------------VVLSTCNRTELYGVGSPEKARAFLLSR---
HEM1_PSEP1      --------KTASVDVRERVAFTPEQLVDALQQLLTSSREAAILSTCNRSELYIE-QDHLSADAVLQWLAD
HEM1_DESMR      --------KTAGVEVREAFAL---GERPKLGELLVDVREALVLSTCNRVEVLV--VDPVGRDP---KAAV
HEM1_DEIGD      ---VIGLNQTAPVEVREQAAVRAGDEGKVLQHLSRYAREVMLLNTCNRTEVYL---AGLQGDPL--RAFE
HEM1_MOOTA      --------RTAPVAIREQLAFARHGLPPALCRLKEEVEGCVILSTCNRTEVYIACNQE----EAGLKAAK
HEM1_ANAVT      -IAVVGLSKTAPVEIREKLSIPEPQTESAIAQLTSHIDEVAILSTCNRLEIYIVAGET---DHGIREVTQ
HEM1_THET8      ----------------------------------------VVLSTCNRTELYGVGSPEKARAFLLSR---
HEM1_PSEPK      --------KTASVDVRERVAFTPEQLVDALQQLLTSSREAAILSTCNRSELYIE-QDHLSADAVLQWLAD
HEM1_ANASP      -IAVVGLSKTAPVEIREKLSIPEPQTESAIAQLTSHIDEVAILSTCNRLEIYIVAGET---DHGIREVTQ
HEM1_DICNV      -IYVLGFRHQTTPAVREKLAFSPEN-------ILNTLPEILLLSTCNRSEWYFSNTPPRLEEWLYQ---H
HEM1_CORA7      ---VVGMSQSAPVALLEKLSMDETVQNDTCRAMVSSLSEAMIISTCNRLEVY--TVTNSFHSGVQDVVHN
HEM1_BREBN      -----------------------------------SIAECIILGTCNRTEIYVVCDQNIGRDYTRRFLAE
HEM1_ALHEH      --------KSAPVNIREQIVFAPDAVTAALQHLRTTAREAAILSTCNRTELYVRMDDRAPE--MLGEWLA
HEM13_HORVU     -IAVIGLSHTAPVEMREKLAVAEELWPRAVAELLNHIEKAAVLSPCNRMEIY---VVALSWNRGIREIVD
HEM1_GEOTN      ---VVGVNKTAPVEIREKLAFGEAELGEAMKQLAKSILENVIVSTCNRTEIYA-VVDQLHTGRYYIKAF-
HEM1_GEOLS      ---VVGLSKTASVDIREKVAFSPNSIEKPLHELVNGIVEGIIVSTCNRVEIYATTRDXXXXXXXXXXFMA
HEM1_BURP8      ----IGINHHTPVALRERVA-FPLEQIKFLGRTARTAPEAAILSTCNRTELYCATDDHAAREAAIHWLSE
HEM1_XYLFT      ---------------------------------LPNVNEAALLSTCNRTELYAETTNAQM----------
HEM1_XYLF2      ---------------------------------LPNVNEAALLSTCNRTELYAETTNAQM----------
HEM1_THICR      ---VLGVNHETPVDIREKVSFSPAQVQNALSELKSQANESVILSTCNRTEIYTTLKSQ-SPEKIRAWLHE
HEM1_THEEB      -IAVIGLSKTAPVDVREKLSVPEDVRERALQHLCGHIQEATILSTCNRLEIYIVTSDEVGVREVHQFLSE
HEM1_RUTMC      -IAILSVNHQVPVEVREKVAFTPDKLIQALNNLIDGIDACIILSTCNRVEIYVASNHKNSEELLSNYLAK
HEM1_METKA      -----------------------------VRDIVESFSGCVLLQTCNRVEVYASGARDRAE-ELGDLI--
HEM1_STACT      --------RTADVALREKVAFKADAIRESHLDLFESILENVILSTCNRTEVYA-VADQIHTGRYYIQRFL
HEM1_PROM5      -IVVVGLSRTAPVEVREKLSIPDQAISESLKSLYSDILEVSILSTCNRLEIYGLVKDKISSIKEFLSDYS
HEM1_LISMO      ------------IDIREKLVFKETEEEMALVTLQQSILENVIISTCNRTEIVA-VVDQIHTGRYYLKRF-
HEM1_EXISA      -IVVVGLNKTAPVAIREQFSFGEQEIVDAMIALRESIFESVILSTCNRTELYV-VTDQLHTGRYYTKRFN
HEM1_CYAP8      -IAVVGLSKTAPVEVREKLSIQEAKLEEALTHLRGHIEEVAIISTCNRLEIYAVVSDEKGVVEITQFLSE
HEM1_CYAP7      -IAVVGLSKTAPVEVREKLSIPEAKLEEVLAHLKSHIQEVAILSTCNRLEIYAVVTEEQGIIEISQFLSE
HEM11_CUCSA     -IVVIGLSHTTPVEMREKLAIPEAEWPRAIGELLNHIEEAAVLSTCNRMEIYVVALSQ------HRGVKE
HEM1_THERP      --------RTAPVTIRERLSLPVEQQCQWLQRWGNQVPEIVLLVTCHRTEVYWLDGEETAHRGV-EWLAE
HEM1_RALEJ      ------------VSLRERVAFPLEQIKPALGALRTHLAEAAILSTCNRTEIY--CATDILKPEGFEHTLR
HEM1_LISMH      ------------IDIREKLVFKETEEEMALVTLQQSILENVIISTCNRTEIVA-VVDQIHTGRYYLKRF-
HEM1_XANOM      ---------------------------------LPQVSEAALLSTCNRTELY----------AMADEARS
HEM1_XANAC      ---------------------------------LPQVSEAALLSTCNRTELYAMAEEAHS----------
HEM1_PSEPG      --------KTASVDVRERVAFTPEQLVDALQQLLTSSREAAILSTCNRSELYIE-QDHLSADAVLQWLAD
HEM1_LISMF      ------------IDIREKLVFKESEEEMALVTLQQSILENVIISTCNRTEIVA-VVDQIHTGRYYLKRF-
HEM1_LISMC      ------------IDIREKLVFKESEEEMALVTLQQSILENVIISTCNRTEI-IAVVDQIHTGRYYLKRF-
HEM1_CYAA5      -IAVVGLSKTAPVEVREKLSIQEAKIEEALTHLKGHIEEVAVISTCNRLEIYAVVTDEKGVVEITQFLSE
HEM1_XYLFA      ---------------------------------LPNVNEAALLSTCNRTELY----AETTNAQI------
HEM1_XANOR      ---------------------------------LPQVSEAALLSTCNRTELY----------AMADEARS
HEM1_XANOP      ---------------------------------LPQVSEAALLSTCNRTELY----------AMADEARS
HEM1_XANC5      ---------------------------------LPQVSEAALLSTCNRTELY----------AMADEAHS
HEM1_SYNP2      -IVVVGLSKTAPVEIREKLSIQEAKMDEAIAHLKSHVEEVAVISTCNRLEIYAVVQEEQGVREICQFLAE
HEM1_NITMU      -------------------------------------REAAIVSTCNRTEIYCST----------DKPDE
HEM1_CAMHC      --------KNTDIIVREKLSFANDVKKREILKLICSIKECLVLSTCNRVEVLAYIDDNYTSDYVIKAISK
HEM1_XYLFM      ---------------------------------LPNVNEAALLSTCNRTELYAETTNAQM----------
HEM1_SOLUE      --------KTAPVEVRECLAFREETLPAALADLCEGVSEAVILSTCNRVEISLTTEDAVDPREIVDNFLS
HEM1_RALME      ------------VSLRERVAFPLEQIKPALGALRTHLSEAAILSTCNRTEIY--CATDVLKEEGFE---H
HEM1_SHESH      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTKEAVIISTCNRTELYTNTGDEAEVIRWLEEYHQ
HEM1_SHEB9      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIAWLEEYHG
HEM1_SHEB8      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIAWLEEYHG
HEM1_SHEB5      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIAWLEEYHG
HEM1_SHEB2      ----IGINKTATVDLREKVAFSPDKIHDAMKSLASRTREAVIVSTCNRTELYCNNGDEADIIAWLEEYHG
HEM1_META3      -------------------------------EFYKKYDNCVLVQTCNRIEIYF------------DKNAK
HEM1_XANCH      ---------------------------------LPQVSEAALLSTCNRTELYAMAEEAHS----------
HEM1_PROMA      -IAVVGLSRTAPVEVREKLSISDEHIEKSFCSLTEQVLEVSILSTCNRLEIYALVNQELGVSAIKEFLID
HEM1_LYSSC      ---VVGLNKTAPVEIREKLSFIESELPQAMEALQKSILENVIVSTCNRTEIYA-VVDQLHTGRHFVKQF-
HEM1_GEOSM      ---VVGLSKTAAVEIREKVAFAPTQMEKPLQAVLPDITEAVIVSTCNRVEIYAT-TRDVAGGMARIKRFL
HEM1_GEOKA      -IVVVGVDKTAPVEIREKLAFAEAELGAAMKQLAKSVLENVIVSTCNRTEVYA-VVDQLHTGRYYMKAF-
HEM1_GEOBB      ---VVGLSKTAAVEIREKVAFAPTQMEKPLQAVLPDITEAVIVSTCNRVEIYAT-TRDVAGGMARIKRFL
HEM1_ALKOO      ----------------------------------------VIISTCNRTEIYISCEEDFCVNP-FEVLCN
HEM1_PERMH      --------KTAPVDVREKLAISEDQLSGLLKKIINSIYEVSILSTCNRVEIY-GVTDD--PDDAFNRIVQ
HEM1_PSEE4      --------KTASVDVRERVAFTPEQLVDALQQLLTASREAAILSTCNRSELYIE-QDHIAADAVLQWLAD
HEM1_PSEU2      --------KTASVDVRERVAFTPEQLVEALQQLLTQSREAAILSTCNRSELYIE-HEHLGADSILAWLAN
HEM1_PSEPW      --------KTASVDVRERVAFTPEQLVDALQQLLTASREAAILSTCNRSELYIE-QDQLSAEAVLQWLAD
HEM1_PSE14      --------KTASVDVRERVAFTPEQLVEALQQLLTESREAAILSTCNRSELYIE-HEHLGADSILAWLAN
HEM1_SYNP6      -LAVVGLSRTAPVAVREKLSI-PEQQVEAAIQQLKSYEEVAILSTCNRLEIY--CVTRATEPGVREITQF
HEM1_SYNE7      -LAVVGLSRTAPVAVREKLSI-PEQQVEAAIQQLKSYEEVAILSTCNRLEIY--CVTRATEPGVREITQF
HEM1_RALEH      ------------VSLRERVAFPLEQIKPALGALRSSGTEAAILSTCNRTEIY--CATDVLTPGT-DGFEH
HEM1_PROMP      -IVVVGLSRTAPVEVREKLSIPDQSISESLKTLINSILEVSILSTCNRLEIYALVKEGISSIKEFLTDYS
HEM1_DESAA      --------------------------------------EAVLISTCNRVEIAAACQDP---DEGIAAIKD
HEM1_THEFY      --------RSAPVTLLERVALSGEVRLKLMTEMVNTVNEAMVVSTCNRTEVYADVDQFHPGVAAICELLS
HEM1_SYNY3      -IAVVGLSKTAPVEIREKLSIQEAKLEEALTHLRSHIEEVTVISTCNRLEIYAVVTDEKGVVEITQFLSE
HEM1_SYNR3      -LAVVGLSRTAPVEVRERLSI-PEHHLETSLQSLRSHEQVLILSTCNRLEIYSLLRHEDGVEAIRDFLAN
HEM1_PSESM      --------KTASVDVRERVAFTPEQLVDALQQLLTESREAAILSTCNRSELYIE-HEHLGADSILAWLAN
HEM1_COXBU      --------QSAPLTVREKLVFTPERTPLALQSLLKAVNEALLLSTCNRTEIYTTV----------DEAAT
HEM1_COXBR      --------QSAPLTVREKLVFTPERTPLALQSLLKAVNEALLLSTCNRTEIYTTV----------DEAAT
HEM1_COXBN      --------QSAPLTVREKLVFTPERTPLALQSLLKAVNEALLLSTCNRTEIYTTV----------DEAAT
HEM1_BURCM      ----IGINHHTPVALRERVAFPLEQIKPALVTFKNVFPEAAILSTCNRTELYCATDDRAAREGAIRWLSE
HEM1_ARCFU      -----------------------------------SFSEYAYIFTCNRFEIYLSCLQDIAEELGITGKAE
HEM1_PROM0      -IVVVGLSRTAPVEVREKLSIPDQSITESLKALFSDVLEVSILSTCNRLEIYALVKDKNTGISSIKEFIS
HEM1_LEGPL      --------KTAPIHVREKVALQPAMQXXXXXXXXXEVNEAAILSTCNRTEIYCDTTPEVHEHQLSEEL--
HEM1_GEOMG      -IVVVGLSKTASVDIREKVAFAPTQMEKPLRALLEDIAEAVIVSTCNRVEVYIS-TRDIAGGMARIKRFL
HEM1_STRSV      -----------------------------------SILENIILSTCNRTELYL-VVDQLHTGRYYSKHF-
HEM1_SHEAM      ----IGINKTATVDLREKVAFSPDKIHDAMRSLATSSNEAVIVSTCNRTELYCN---NARAEEVIHWLES
HEM1_PSEAE      --------KTASVAVRERVAFTPEQMVEALQQLLTTSREAAILSTCNRSELYLEIDHPTADDVLAWLADY
HEM1_PSEAB      --------KTASVAVRERVAFTPEQMVEALQQLLTTSREAAILSTCNRSELYLEIDHPTADDVLAWLADY
HEM1_PSEA8      --------KTASVAVRERVAFTPEQMVEALQQLLTTSREAAILSTCNRSELYLEIDHPTADDVLAWLADY
HEM1_PSEA7      --------KTASVAVRERVAFTPEQMVEALQQLLTTSREAAILSTCNRSELYLEIDHPTADDVLAWLADY
HEM1_PROMM      -IAVVGLSRTAPVEIREKLSIPEQTMETSLQTLRGNDQEVSILSTCNRLEIYTLVRHPERGISAISDFLG
HEM1_MYXXD      --------RTAPLTVRERLALPESRQVDVLQRLAQAPVEALWVSTCNRVEVYLFAPDAAMARQRALMELQ
HEM1_LEGPH      --------KTAPIHVREKVALQPAMQXXXXXXXXXEVNEAAILSTCNRTEIYCDTTPEVHEHQLSEEL--
HEM1_LEGPC      --------KTAPIHVREKVALQPAMQXXXXXXXXXEVNEAAILSTCNRTEIYCDTTPEVHEHQLSEEL--
HEM1_LEGPA      --------KTAPIHVREKVALQPAMQXXXXXXXXXEVNEAAILSTCNRTEIYCDTTPEVHEHQLSEEL--
HEM1_PROMT      -IAVVGLSRTAPVEVREKLSIPEELVEKSFNNLIDQILEVSILSTCNRLEIYSLVKDPQLGIEAIKSFLL
HEM1_POLSQ      ------------VAIREKVAFDPELRQHLLGANQSGLPEATILSTCNRTEVYCAANDANAANILHEA---
HEM1_MYCGI      --------RSAPVSVLEQLSTDESDQAKIIAEVLRSVTEAMVLSTCNRVEIYAVVEAFHGGLSVIGQVLS
HEM1_MYCA9      --------RSAPVPVLEKLAIGEADQPKIIEHILQSVTEVMVLSTCNRVEVYFHGGLTVIGEAIARHAGM
HEM1_METAC      --------------------------------------ECVVLKTCNRVEIYVVSPKSSSVLFSFAKEMG
HEM1_BURA4      ----IGINHHTPVALRERVAFPLEQIKPALVTFKNVFPEAAILSTCNRTELYCATDDRAAREGAIRWLSE
HEM1_PSEF5      --------KTASVDVRERVAFTPEQLVEALQQLLTDSREAAILSTCNRSELYIE-QDHLSADVVLRWLAE
HEM1_NITEU      --------------IREHVAFSEESMQHALHDLVGHVKEAAIVSTCNRTEIYCNTTPDKAVGWLAD--FH
HEM1_BORA1      ------------VSVRERVSMPVDLVKPALAGLRSAFREAAILSTCNRTEVYCAADAAVAEQLPIWLADH
HEM1_PROM2      -IVVVGVSRTAPVEVREKLSI-PDHSITESLKALKAFSEVLILSTCNRLEIYALAKDKNTGISSIKEFLS
HEM1_METBF      -------------------------HNLYNHEYIH---ECVVLKTCNRVEIYFSFAKEMGAST---HIID
HEM12_ARATH     -IVVIGLSHTAPVEMREKLAIPEAEWPRAIAELLNHIEEAAVLSTCNRMEIYVLALSQ------HRGVKE
HEM1_MAGSM      ---VVGLNKSAPVSLREKVAYSSDTLPRSLQALLDAVHEGTILSTCNRVEIYMQTSQWIARDHALDPA--
HEM1_PSEPF      --------KTASVDVRERVAFTPEQLVEALQQLLTDSREAAILSTCNRSELYIE-QDQLSADIVLRWLAD
HEM1_PROM9      -IVVVGLSRTAPVEVREKLSIPDQSITKSL-KALKAFSEVLILSTCNRLEIYALVKDKISSIKEFISDYS
HEM1_MYCUA      --------RSAPVSVLEQLSIDESEQVKIVDRVLQSVTEAMVLSTCNRVEVYAVVEAFHGGLSAIGQVLS
HEM1_GRAFK      --------KKADAEIRGHFSLTEESKQR----LLEQAKEILVTSTCNRTEIYGFAQHPFQLIKLLCE--H
HEM1_FRAP2      ---------------------------------IDNVVHAVILSTCNRTEVYLEITDLRVVDDILAWWQS
HEM1_BURPP      ----IGINHHTPVALRERVA-FPLEQIKWLGPSARTAPEAAILSTCNRTELYCATDDQAAREAAIQWLSR
HEM11_ARATH     -IVVIGLSHTAPVEMREKLAIPEAEWPRAIAELLNHIEEAAVLSTCNRMEIYVLALSQ------HRGVKE
HEM1_WIGBR      ----------------------------------------VILSTCNRTEVYLSIKNFYKAKKII--ILW
HEM1_THIDA      ------------LAIREQVAFGPDKLVQALHELTLSKREAAILSTCNRTELYVNT---VSPDAL-SQWFA
HEM1_PSEA6      --------KTAPVELREKVAFSPDAMVEALKSLLTGADESVIVSTCNRTEIYAQA-ENLTADALTTWLAE
HEM1_PROMS      -IVVVGLSRTAPVEVREKLSIPDQSITESLKALFSDVLEVSILSTCNRMEIYALVKDKNTGISSIKEFIS
HEM1_EXIS2      -IVVVGLNKTAPVSIREQVSFGEHEMKGAVVALRDSIFESVIVSTCNRTELYV-VTDQPHTGRYYTKRF-
HEM1_AZOSB      ------------LAIRERVAFQPDRLDQALQALTDSVSEAAILSTCNRTELYF-AAEQPQRAADWLAGFH
HEM1_PROM3      -IAVVGLSRTAPVEIREKLSIPEQTMETSLQTLRGNDQEVSILSTCNRLEIY---TLVRHPERGISAISD
HEM1_LACRJ      --------------LREKFS-FTKEEVPKADKLLNDEKSILLISTCNRTEVYA-VVDQIHTGRYYIRRFL
HEM1_LACRD      --------------LREKFS-FTKEEVPKADKLLNDEKSILLISTCNRTEVYA-VVDQIHTGRYYIRRFL
HEM1_SYNJB      -IAVVGLSRTAPVEIRERLSIAEAEVGETIQQLRTHIEEAAILSTCNRLEVYIVTSEESGVRQTMQFLAE
HEM1_PROM1      -IAVVGLSRTAPVEVREKLSIPEELVERSFNNLIDQILEVSILSTCNRLEIYSLVKDPQLGIEAIKSFLL
HEM1_METS3      -----------------------------------SIVEYVEISTCNRKEYYIHNDNIDASDSLLSHE--
HEM1_HERA2      ---VVGAQRTAPISIRERIXXXXXXXXXXXXXXRQIAVEGFILSTCNRVELYALVEEADGGRSLRQFLAQ
HEM1_METMA      -------------------------HGDLDGLLRNLYKECVVLKTCNRVEIYVVSPKSSSVLFSFAKEMG
HEM1_DEIRA      -----------------------------LGHLARHADEVLLLATCNRTEVYL---AGVHGDPLFEGA--
HEM1_METFK      ------------VSIRENVA-FQNEHLSGALRDLNSIREAAILSTCNRTELYCNTDDP---QKALEWLAN
HEM1_CLOJO      --------KSAAIDIRERFSYTSTRIREILRRIADGVSGAVLLCTCNRTELY------ISGDNIENMLLC
HEM1_BURXL      ----IGINHHTPVALRERVA-FPLEQIKWLGPSARTAPEAAILSTCNRTELYCATDDQAAREAAIQWLSR
HEM1_PELCD      ---------------------------------LPGISEGMILSTCNRVEVYAASGDPAGGCACLQRFMA
HEM1_NITEC      --------------IREHVAFTEESMQHALHDLVGHVKEAAIISTCNRTEIYCNTD---TPDKAVGWLAD
HEM1_NEIM0      ------------LSIREKLAFAAACLPEAVRNLANAATEAVILSTCNRTELY--CVGD--SEEIIRWLAD
HEM1_CLOTH      ------------IDIREKFSFTKSTLQAVYNDLLKNENGAVIVSTCNRTELYLSCEEGLYINP-FELLCD
HEM1_RALSO      ------------LSLREKVAFPLEQLKPALGTLRQSTAEAAILSTCNRTELYCATDGNLPEDTAHEHAIR
HEM1_POLSJ      --------------------------------------EATLLSTCNRTEIYCAGDHNDLEHTLEWLAHN
HEM1_NEIMF      ------------LSIREKLAFAAACLPEAVRNLANAATEAVILSTCNRTELY--CVGD--SEEIIRWLAD
HEM1_NEIMC      ------------LSIREKLAFAAACLPEAVRNLANAATEAVILSTCNRTELY--CVGD--SEEIIRWLAD
HEM1_NEIMA      ------------LSIREKLAFAAACLPEAVRNLANAATEAVILSTCNRTELY--CVGD--SEEIIRWLAD
HEM1_METPP      --------------------------------------EAAILSTCNRTELYCAAEPQLVRPAL-EWLAG
HEM1_GEOSL      -IVVVGLSKTASVEIREKIAFAPTQMEKPLRMLXXXXXXXXXXSTCNRVELYASTRDVAGGMARLKRFLG
HEM1_BURPS      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSD
HEM1_BURP6      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSD
HEM1_BURP1      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSD
HEM1_BURP0      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSD
HEM1_BURMS      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSD
HEM1_BURMA      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSD
HEM1_BURM9      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSD
HEM1_BURM7      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSD
HEM1_BORPE      ------------VSVRERVSMPVDLVKPALEGLRATFREAAILSTCNRTELY--CAAEGQVAEHLPAWLA
HEM1_BORPA      ------------VSVRERVSMPVDLVKPALEGLRATFREAAILSTCNRTELY--CAAEGQVAEHLPAWLA
HEM1_BORBR      ------------VSVRERVSMPVDLVKPALEGLRATFREAAILSTCNRTELY--CAAEGQVAEHLPAWLA
HEM1_NEIG2      ------------LSIREKLXXXXXXLPEAVRNLANAATEAVILSTCNRTELY--CVGD--SEEIIRWLAD
HEM1_NEIG1      ------------LSIREKLXXXXXXLPEAVRNLANAATEAVILSTCNRTELY--CVGD--SEEIIRWLAD
HEM1_SYNJA      -IAVVGLSRTAPVEIRERLSIPEAE----VGERIQQLREAAILSTCNRLEVYIVTPEESGVRQTMQFLAE
HEM1_PSYA2      ---VIGVNKTAPVALRERLALVGDDVNIALAQLQGFSDGSVIVSTCNRTEIYALVPESILSPNTXXXILK
HEM1_BURVG      ----IGINHHTPVALRERVA-FPLEQIKFLGPQAPNTPEAAILSTCNRTELYCATHDRAARDGAIRWLSE
HEM1_BURCA      ----IGINHHTPVALRERVA-FPLEQIKFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGAVRWLSE
HEM1_PROM4      -IAVVGLSRTAPVEVREKLSISDDNIPSAFNTLNTNDQEVSILSTCNRLEIYFVKNSDNGVKAIKDFLCK
HEM1_CHRVO      ------------LSIREKLAFPAETLPRALESLLASAREAAIVSTCNRTEIYCSSPDPHAALDWLCQFHG
HEM1_BURCJ      ----IGINHHTPVALRERVA-FPLEQIKFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGALRWLSE
HEM1_BURS3      ----IGINHHTPVALRERVA-FPLEQIKFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGAVRWLSE
HEM1_BURCH      ----IGINHHTPVALRERVA-FPLEQIKFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGAVRWLSE
HEM1_BURCC      ----IGINHHTPVALRERVA-FPLEQIKFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGAVRWLSE
HEM1_NEIMB      ----------------------------------NAATEAVILSTCNRTELY--CVGD--SEEIIRWLAD
HEM1_METTH      --------------------------------------EKVPIRTCNRIEYYLS-VQEIPPGFEFDGFT-
HEM1_PSYCK      ---VIGVNKTAPVALRERLALVGDEVSIALAQLQGFSDGSVIVSTCNRTEIYANNSANLSSTIISAHILK
HEM1_POLNA      --------------------------------------EATLLSTCNRTEIY--CAGDTND---LDSTME
HEM1_BURM1      ----IGINHHTPVALRERVA-FPLEQIKFLGPQAPNAPEAAILSTCNRTELYCXXXXXXXXXXXXXWLSD
HEM1_SYNS9      -IAVVGLSRTAPVEIRERLSIPEQSMEMSLKTLRGNDQEASILSTCNRLEIY----TLVRHPELGVGAVN
HEM1_HERAR      --------------------------------------EAAILSTCNRTELYAASHQPGGVNEAIDLTAH
HEM1_STAS1      --------RTADVALREKVAFKDDAIRSANVDLYESILENVILSTCNRTEVYA-VADQIHTGRYYIQRFL
HEM1_STAHJ      --------RTADVALREQVAFRDDALRLAHEDLFESILENVILSTCNRTEVYA-IVDQIHTGRYYIQRFL
HEM1_ACIAC      --------------------------------------ETAILSTCNRTEIYC-AGQQPALDHTLDWLAH
HEM1_THEAC      ----------------------------------NGISRYVILLTCNRVEIYLRA---------------
HEM1_PSEFS      --------KTASVDVRERVAFTPEQLVEALQQLLTDSREAAILSTCNRSELYIE-QEHLSADVVLRXXXX
HEM11_ACIBL     ---VVGLNKTSPVAVRERFWMSELRRYEALHQLVRAIDELVVLATCNRTEFILWTSDA---GEAADSVLR
HEM1_METTM      --------------------------EEIVGELLGAVTEKVPLMTCNRVEYYLHVTGVPPE---FD--FN
HEM1_FLAPJ      --------KKADAEIRGKFSIDAQSKSNLLQQATEGIESLIVTSTCNRTEIYGFAQHPFQLIKLLCE--N
HEM1_CALMQ      ------------------------------GKLMNYYDEVFLLQTCNRVEVYVYGDDDSVAEDMY-KVKG
HEM1_CHLSY      ------------VEIREQLAFSQTDLPSALMQLTSSFAEAVILSTCNRVELYGVTNPGTTAQHVVD-FLA
HEM1_CHLAA      ------------VEIREQLAFSQTDLPSALMQLTSSFAEAVILSTCNRVELYGVTNPGTTAQHVVD-FLA
HEM1_BURTA      ----IGINHHTPVALRERVA-FPLEQIKFLGHPAPNAPEAAILSTCNRTELYCXXXXXXXXXXXXXWMSD
HEM1_SYNPW      -IAVVGLSRTAPVEVREKLSIPEQTMEESLQNLRDQVLEASILSTCNRLEIYTNPELGISAVREFLSSHS
HEM1_STAES      --------RTADVTLREQVAFRDDALRLAHEDLYETILENVILSTCNRTEVYA-IVDQVHTGRYYIQRFL
HEM1_STAEQ      --------RTADVTLREQVAFRDDALRLAHEDLYETILENVILSTCNRTEVYA-IVDQVHTGRYYIQRFL
HEM1_SYNS3      -IAVVGLSRTAPVEVREKLSIPEQTMEESLQNLRNHEQEASILSTCNRLEIYTLVRNDLGIAAVRDFLSG
HEM1_STAAW      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAAT      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAAS      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAAN      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAAM      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAAE      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAAC      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAA9      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAA3      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAA2      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAA1      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_STAAR      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_METTP      ----------------------------------DTVEECAVLKTCNRVEIY------VVSPRGEKVLFE
HEM1_STAA8      --------RTADVALREQVTFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGRYYIQRFR
HEM1_SACD2      ----LGINHNTSLDVREKVAFSSTQIESALRAAIAGLSEVAILSTCNRTELYAYGSSQANSLIQWLAEYK
HEM1_SYNAS      ----------------------------------------------------------------------
HEM1_STAAB      --------RTADVALREQVAFRDDALRIAHEDLYESILENVILSTCNRTEVYA-VVDQIHTGCYYIQRFR
HEM1_PSEU5      --------KTASVDVRERVAFTPDQMVEALRQLVTPTREAAILSTCNRSELYLQQDXXXXXXXXXXXXSY
HEM1_METMJ      ----------------------------FLHEARERFRGVLLLQTCNRIEVLVQGDARSLEGFLQEK---
HEM1_CORU7      --------RSAPVSLLEQVSTVDTDLPKLENALLDSLSEALVLSTCNRMEFYTVANAHPGLDHIVDTIAT
HEM1_VEREI      --------------------------------------ETAMLSTCNRTEIYC-AAEQAAIDHTLGWLAH
HEM1_FRASN      --------RTAPTSLLELAAVSADDAPKVLHDLVGALSEAVLLSTCNRTEIYAEVTFHGGLADISDQLSR
HEM1_RHOFD      --------------------------------------EAALISTCNRTEIY--CAGEKPELE------H
HEM1_PSYWF      ---VIGVNKTAPVALRERLAFVGGDIQVAQAQLQQITAGSLIISTCNRTEIYANSDAALSKQSTVDLTEQ
HEM1_FRAAA      --------------------------------------EAVVLSTCNRTEIYADVTFHGGVADISDQLSR
HEM1_ACISJ      --------------------------------------ETAIISTCNRTEIYC-AAEAPALDHTLDWLAH
HEM11_FLAJ1     --------KKADAEVRGQFSLDAVAKTRLLEQAKNDIESLLVTSTCNRTEIYGFAEHPF---QLIKLICD
HEM1_SYNFM      --------KTAPVEMRERLAVACRQEVNPLRLLLENVDELLFLSTCNRVEFLFTCRDRLREVTALLRTYL
HEM1_SALAI      ---VVGASRTAPVAALERLAVAPADLPHALARLVAQVSEAVLVSTCNRVEVYAAVSGFHGG---LGDICA
HEM1_MYCLE      --------RSAPVSVLEQLSLDRSDQIKIVDRVLQSVTEAMVLSTCNRVEVYAVVEAFHAGLSVIGQVLS
HEM1_MYCPA      --------RSAPVSVLEQLSIDESDHGKIVDRVLQSVTEAMVLSTCNRVEVYAVVDAFHGGLAVIGQVLS
HEM1_MYCA1      --------RSAPVSVLEQLSIDESDHGKIVDRVLQSVTEAMVLSTCNRVEVYAVVDAFHGGLAVIGQVLS
HEM1_JANMA      --------------------------------------EAAILSTCNRTELYAASNLPGGVNEAIDITAH
HEM1_SALTO      ---VVGASRTAPVAALERLTVAPADLSRVLTRLVAQVSEAVLVSTCNRVEVYAVVSGHGGLGDICAVLAE
HEM1_HALSA      -------------------------------------EEAFVLQTCHRVEAYV-----VTADQASGRRXX
HEM1_HALS3      -------------------------------------EEAFVLQTCHRVEAYV-----VTADQASGRRXX
HEM1_MYCSS      --------RSAPVSVLEQLSTDESDQAKIVDQVLQSVTEAMVLSTCNRVEVYFHGGLSVIGQVLAEHCGM
HEM1_MYCSK      --------RSAPVSVLEQLSTDESDQAKIVDQVLQSVTEAMVLSTCNRVEVYFHGGLSVIGQVLAEHCGM
HEM1_MYCSJ      --------RSAPVSVLEQLSTDESDQAKIVDQVLQSVTEAMVLSTCNRVEVYFHGGLSVIGQVLAEHCGM
HEM1_SYNSC      -ISVVGLSRTAPVEIRERLSIPEQTMETSLQSLRGNEQEASILSTCNRLEIYTLVRNDLGVSAVSDFLSS
HEM1_SALRD      ----------------------------YANLSLSADAEVVVLSTCNRTEAYLYGTEDLRQVKALIGQGG
HEM1_UNCMA      ---------------------------------LPGVSEAVVLQTCNRVEIYA-VAESVEDIVGFARIAE
HEM1_METB6      --------------------------KKFAGALL--------LQTCNRVEVIVEGDAASLRDFL------
HEM11_NOCSJ     ---VVGISKSAPVALLEQLALDGPGLHKLIDDVAASVTEATVIATCNRLEIYHGSVEEVSR-LVVDR---
HEM1_SYNPX      -IAVVGLSRTAPVEIRERLSI-PEQTMETSLQSLRGHEQVLILSTCNRLEIYTLVRHPDLGVSAVSEFLS
HEM1_RHOSR      ---LVGVSRTAPVPVLERVAVTDTDRPKLTDKLLASISEAMIVSTCNRVEIYHGALAEVGELLADHSGLD
HEM1_HALWD      ---ICGVRVSHNRASVEEIELAGERDSRTIMETLDGITESFAIQTCNRSEXXXXXXXXXXXXXXXX----
HEM12_ANADE     --------KSAPIDVRERVALTGDALKAALCELMEGVTEALVVSTCNRVEVFVHSDRPDAARRFFTER--
HEM1_TERTT      ----LGINHNTTLDVREKVAFSPAELEVALCALRESAEEVAILSTCNRTEIYCETGAEAQHLLVWLAEHK
HEM1_RHOOB      ---LVGVSRTAPVPVLERVAVTDTDRPKLTDKLLASISEAMIVSTCNRVEIYHGALAEVGELLADHSGLD
HEM1_CHLTB      LLGVIGVSRETTLQQREQLHILQQAQGSFRPEVFQEERDYVLLATCHRVELY-----SVAPAELFDSLAQ
HEM1_CHLT2      LLGVIGVSRETTLQQREQLHILQQAQGSFRPEVFQEERDYVLLATCHRVELY-----SVAPAELFDSLAQ
HEM1_PICTO      ----------------------------------SSIDEFVILITCNRVEIYAYTRNEIDKDLFKDSL--
HEM1_SULAC      -----------------------KLYEHYIPELINSDTQVSLLQTCNRVELYLYTKDRNKINDILSKLNE
HEM1_CORJK      --------------------------------------ESLVLSTCNRMEFYTVANAFHSGDHVVDTIAQ
HEM1_SORC5      --------KTAPIEVRERLAIGRDRLPEVLARLTAAIGEALVLSTCNRVEIYXXXXEELSRNNLRAAVAT
HEM1_CHLTA      -LGVIGVSRETTLQQREQLHILQQAQGSFRLEVFQEEKDYVLLATCHRVELY-----SVAPAELFDSLAQ
HEM1_MYCTU      --------RSAPVVVLEQLSIDESDQVKIIDRVLASVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLA
HEM1_MYCTA      --------RSAPVVVLEQLSIDESDQVKIIDRVLASVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLA
HEM1_MYCBT      --------RSAPVVVLEQLSIDESDQVKIIDRVLASVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLA
HEM1_MYCBP      --------RSAPVVVLEQLSIDESDQVKIIDRVLASVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLA
HEM1_MYCBO      --------RSAPVVVLEQLSIDESDQVKIIDRVLASVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLA
HEM1_HALMA      -------------------------------------EEAIALQTCNRTEGYVVVSDHEDGLEALELFTR
HEM1_CHLTR      -LGVIGVSRETTLQQREQLHILQQAQGSFRPEVFQEERDYVLLATCHRVELY-----SVAPAELFDSLAQ
HEM1_NOCFA      ---LVGVSRSAPVSVLEKVAITDADRPKLIDKMLASISEAMIVSTCNRVEVYHGGLAEVGE--LLTRHSG
HEM1_FRASC      --------------------------------------EAVVLSTCNRIEIYAEVTFHGGVADISDQLSR
HEM1_ACIC1      ---VVGVSRGTPLSLLERAVLDSDQATKLLDDLVGSVREGMVLSTCNRVEIYA-CVEKFHPSELLSRHGN
HEM12_ANADF     MLVAVGLQKGATVADREVLALPAEGFQSTLAEYLDAVDEIAVMSTCYRVEIYARCPAAATLS-----LRQ
HEM11_PYRAR     -----------------------------------------VLHTCNRVEAYYNPPDEVVEIV-------
HEM1_MYCS2      --------RSAPVSVLEQLSTNEAEQAKIIDQVLQSVTEAMVLSTCNRVEVYFHGGLSVIGQVLAERSGM
HEM1_KINRD      ---VVGLSRTASLEVLERAAFDARGAEEVLRALTASVEEAFVLSTCNRVELYCDVSRHGGVADIGDVLCR
HEM1_PARUW      -IGVIGINHXXXXXXXXXXXXXXCQKRFGANQSVHDQHHFILLSTCNRTEVYFSSHDLTATHSYLLSILR
HEM1_NATPD      -----------------------------VEELLSKVSEAFVLQTCNRAEAYVVAND--SEXXXXXXXXX
HEM1_IGNH4      -------------------------------------REVVLLQTCNRVEVYAITTNKKATVESIKSLLE
HEM1_STRAW      ----------------------------------------------------------------------
HEM11_ANADF     --------KSAPIEVRERVALTGDLLKAALCELXXXXXXXXXXXTCNRVEVY------VQADGIEPARRF
HEM1_RHOE4      ---LVGVSRTAPVPVLERVAVTDTDRPKLIDKLLASISEAMIVSTCNRVEVYHGALTEVGEILADHSGLD
HEM1_METHJ      ------------------------------------FKGVILLQTCNRIEI-------------------
HEM1_METS5      --------------------------------------EMAVLQTCNRIEIYLFSRNESSVNEILHYLNE
HEM1_METLZ      ------------------IAVATADHSKYGEEVLGLFRGVVLLETCNRVEILVHGSAKQLRDFLHGE---
HEM1_STRCO      --------------------------------------------TCNRIELYADVDKFHAGVAELSTLLA
HEM1_SACEN      ------------VRVLERVAIGADELGKVLHELLDHICEAFVVSTCNRVEVYAVAETFHGGLEDVTSVLA
HEM1_CHLMU      ----------------------------------------VLLSTCHRVELYGMATEAIFEKEI------
HEM1_SULIY      ---------------------------KSLRQLINA--EFAILQTCNRVEIYYSNTNTISENKMIQYLNN
HEM1_SULIN      ---------------------------KSLRQLINA--EFAILQTCNRVEIYYSNTNTISENKMIQYLNN
HEM1_SULIM      ---------------------------KSLRQLINA--EFAILQTCNRVEIYYSNTNTISENKMIQYLNN
HEM1_SULIL      ---------------------------KSLRQLINA--EFAILQTCNRVEIYYSNTNTISENKMIQYLNN
HEM1_SULIK      ---------------------------KSLRQLINA--EFAILQTCNRVEIYYSNTNTISENKMIQYLNN
HEM1_SULIA      ---------------------------KSLRQLINA--EFAILQTCNRVEIYYSNTNTISENKMIQYLNN
HEM1_AERPE      -LAMIGV--NVKTASREHVARLEKEWEKHLDTIGYASRGTVIIATCNRFEVYLDSPSRLVED-LASSIAS
HEM1_TROWT      -----------------------------------------ILSTCNRFEVYIDAIQKGDQDDVCKTGLL
HEM1_TROW8      -----------------------------------------ILSTCNRFEVYIDAIQKGDQDDVCKTGLL
HEM1_THEVO      -------------------------------------EKYVILLTCNRVELYYRG----DPFDVQEKGYN
HEM1_CHLFF      ----------------------------------------VLLLTCHRAEIYYFSKSNANVQS------K
HEM1_PYRAE      LAAVILTYREVDA---DTLGRVGEEMKKCI-EILGVKRPMFVLHTCGRVEAYLY---NASEEEINSVTLR
HEM1_CENSY      -----------------------------VGAALEGFRECVIVQTCNRVEL-FGASASPDMGSIRRTWAS
HEM1_CHLPN      VLGVVGISREAALKERERAIQYLQSFEKNLQRFLGKGGAFIPLLTCHRAELYYYSSPEIAQAALLSELTS
HEM1_CHLAB      VLGVVGISYR-EAALKEREAVINEANSFFSQHFFGDDGSFVLLLTCHRAEIYFSKSNRHIQSKLLSRISS
HEM11_PYRCJ     --------------------------------------QAFVFHTCNRVEVYLYDADAGPAEHI------
HEM1_HYPBU      --------------------------------------EAVVLATCNRFEVYALPRRGFVE--------T
HEM1_CHLCV      ----------------------------------------VLLLTCHRAEIYFSKSNHNVQSELLSRI--
HEM1_ARTAT      ----------------------------------------VVLATCNRYEVYGETANEAARSALVSQISE
HEM12_PYRAR     -------------------------------EVIGPKTPMFVLHTCHRVEAYLYGA---SEEELSSLV--
HEM1_SULSO      ---------------------------KSLKQLINA--EFAILQTCNRVEIYYSDTNTLKENKIIQYLNN
HEM1_RHORT      ----------------------------------------------------------------------
HEM1_ARTS2      -------------------------------------KGAVVLATCNRFEIYGEAPHEAARAALVAQISE
HEM1_ARTCA      ----------------------------------------VVLATCNRYEIYGEAPNEAARAALVAQISA
HEM1_SULTO      -----------------------------------------VLQTCNRAETYLYTYNKEEFKDFLQKLDE
HEM1_PYRIL      ---------------------------------------IYVLHTCGRVEAYLYSPEEVQTAETYRKYVN
HEM12_PYRCJ     ----------------------------------------------------------------------
HEM11_ANADE     MLVAVGLQKGATVADREVLALPSEELLDALTQALDGVDEVAIVSTCYRVEIFAAARCPAAAEL---SLRH
HEM1_KOCRD      ----------------------------------------ITLSTCNRLELYGELPEHASVDQLAERIAR
HEM1_THENV      ----------------------------------------------------------------------
HEM1_CLAMS      ---------NASFEVLEKLSVAAPSVAGTLMEQNDFIAGAVVLATCNRFEAYLDVEEPLTAEATVDVVSG
HEM12_NOCSJ     --------RSIPMAVLERLSVAARELPASVRALVPGVDQVLVLSTCERTEVYAWWTDEADPXXXXXXXXX
HEM1_MICLC      --------------------------------------------TCNRVEIYAEAVEXXXXXXXXXXXXX
HEM1_CLAM3      ---------NASFEVLEKLSVAAPSVAGALMEQNDFIAGAVVLATCNRFEAYLDVEEPLTAEATVDVVSG
HEM1_PROAC      ----------------------------------------LVLSTCNRVCLIVETSPEAVADEAALRRCI
DVA1_DICVI      ----------------------------------------------------------------------
SYFB_MYCCT      ---------------------------------------------CALNEIGINQSVINKEDQL--KIYN


                         .         .         *         .         .         .         .:140
query           VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAI
HEM1_CLOPE      VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAI
HEM1_CLOPS      VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAI
HEM1_CLOP1      VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKGAYKTAISDNSISSELQKMFEIAI
HEM1_CLOB8      IFNWDYEYKKYVFITNNKDAYRHLFEVCSGFHSKILGEDQILGQVKDAYEEALEFKAVSLELHRLFQEAI
HEM1_CLOBA      IFNWNYSYRKYIFISEDKKACKHLFEVTCGFHSKILGEDQILGQVKTSYFKSLNAKALNLELQRLFQYAI
HEM1_CLOBB      IFNWNYSYRKYIFISEDKKACKHLFEVTCGFHSKILGEDQILGQVKTSYFKSLNAKALNLELQRLFQYAI
HEM1_CLOTE      CLNWDENYKKYTFHYKDDEAINHLMRVICGFDSLILGEDQILSQIKQAYEIALSSKSVNRDLNKLFQMAI
HEM1_CLOK5      GLDWDYDLVSYIFYIKDKYAIKHLMEVSCGFHSKILGEDQILGQIKTAYDAALEAKTIKGKLQRLFQKAI
HEM1_CLOK1      GLDWDYDLVSYIFYIKDKYAIKHLMEVSCGFHSKILGEDQILGQIKTAYDAALEAKTIKGKLQRLFQKAI
HEM1_CLOAB      KMGWNINFLENFFYCKGDEAINHLMEVACGFDSLILGEDQILGQIKAAYDTALKNKTSGSELKKLFQLVI
HEM1_ANATD      ELDWDKRYMHLFYIYKDKDCIKHLFEVVCGFDSLLIGEDQIVAQVKEAKEISKLVGGKNPVLERLFEVAL
HEM1_CALS8      ELDWDRRYMPLFYIYKDKDCIKHLFEVVCGFDSLLIGEEQIVAQVKEAKDIAKQVGGKNPVLERLFEVAL
HEM1_CLONN      IFFNVESVNEYIFIKKDKEAVSHIYNVSAGLDSMILGEDQILGQVKEALRYSMENKFSRKVLNKLFREAI
HEM1_CARHZ      LANWASDIKNYTYNYTLYDAVHHLFRVASGLDSMILGETQILGQVRDAFLKASSLKASNKILNTLFQHAI
HEM1_CAMC1      IFSFEDELYERADIYENSGAAHHLFAVASSLDSLVVGETQIVGQLKNAFKFAYDNNSCGEDISKIIHYAC
HEM1_DESRM      VWSFLSEIKNFTFCHTLYDAIRHLFRVVSGLDSMILGETQILGQVKKAYELALEAKTTNVVLNTLFQQAI
HEM1_PROMH      YHQIEPELKNSVYWHQDNQAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQNYHSLSSELERLFQKSF
HEM1_ACTSZ      CVAWFTDLQDCLYFYQNQQAVTHLMRVACGLDSLILGEPQILGQVKQAYQLAEKSAVISSELSRLFQKTF
HEM1_THEYD      FHNIEGEFENYLYVYKDTEAVEHLFKVASSLDSMIVGEPQITGQVKESYEIALSERTTSLILNYLMNRAL
HEM1_NITSB      VSGINEELEGRADIYEDNGAIHHVFSVASGLDSLVVGETQITGQIKDAYKEAYEKGWCGQKLGRVMHYAF
HEM1_NATTJ      FSDLDPEYVDHLYFITDQEAVSHIFKVTAGLNSLVTGETEILGQVKKAYQLSDEAGGVDSIFHGLYQQAL
HEM1_HAES1      IHQVDEELKSCLYSQQNLQASRHLMRVASGLDSLILGEPQILGQVKQAYQMSEEYYSLSTELSRLFQKTF
HEM1_DESDG      ARGQHEELRPYVYIHRGLAAVEHLFTVASSLDSMVLGEPQILGQLKDAYRDAVARNTTRVILNRMMHKAF
HEM1_ECOLC      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECOHS      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_VIBCM      FHQVSDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAF
HEM1_VIBCH      FHQVSDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAF
HEM1_VIBC3      FHQVSDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAF
HEM1_ESCF3      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_VIBSL      VFHQPEELKPSIYIHEEQAAIKHLMRVACGLDSLVLGEPQILGQVKQAYTDSRDNKSVDASMEKLFQKSF
HEM1_SHISS      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_SHIDS      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_SHIBS      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_SHIB3      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_HAES2      IHQVDEELKSCLYSQQNLQASRHLMRVASGLDSLILGEPQILGQVKQAYQMSEEYYSLSTELSRLFQKTF
HEM1_ECOSE      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECO8A      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECO55      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECO24      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_SHIFL      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFVDSQKGHMKASELERMFQKSF
HEM1_SHIF8      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFVDSQKGHMKASELERMFQKSF
HEM1_ECOLU      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECOLI      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECODH      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECOBW      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECO5E      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECO57      YHNLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_THEM4      PLTINEIIEPYIIRKSGIDVVRHLFKVSCGLDSMVLGEHQILSQVKNTHKNFCH----GKILNKLFNEAV
HEM1_SULSY      ILSQYNTLKDYLFFYTNKEAIRHIFRVSSSLDSMVIGEPQIVCQFKDSFTKAKEYKAVRHILTRLFDKAL
HEM1_HELMO      VLEWGQDFSKYFYVHTLYDAIRHLFRVASGLDSMVLGETQILGQVRTAYQRSCNEDCSNGIVNTWFQQAI
HEM1_CAMC5      VYSFEDELFERADIYEDSGAVHHLFAVASSLDSLVVGETQIVGQLKNAFKFAFDNASSGEHISRLVHYAC
HEM1_BACSU      LADWKEELSPFLTFYESDAAVEHLFRVACGLDSMVIGETQILGQVRDSFKTAQQEKTIGTIFNELFKQAV
HEM1_PELTS      FLSWSSEIKNFTYSHTLYDTIRHLFRVAAGLDSMILGETQILGQVREAYQRAIEYESTNRVLNTLFQQAI
HEM1_MANSM      CIQWFDELRNCLYIKQNQSAVNHLMRVSCGLDSLVLGEPQILGQVKQAYQYSAQHMPMSSEFSRLFQKTF
HEM1_ECOL5      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_DESHY      ARHGKEDINQYLYVHTLYDSVRHLFRVVAGLDSMVMGETQILGQVAEAYEKSSQLNLSNKIIHAIFQNAL
HEM1_DESHD      ARHGKEDINQYLYVHTLYDSVRHLFRVVAGLDSMVMGETQILGQVAEAYEKSSQLNLSNKIIHAIFQNAL
HEM1_DESAP      RCGSPEAIKSHTYNYSFGESVRHLFRVSSGLDSMVLGETQILGQVKQAYQFAQQVGTVNWLLNCAFQQAL
HEM1_ECOUT      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECOL6      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECOK1      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECO81      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECO45      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_CHLL2      FKDARKEVRPEHFFSRFYCGTAHLFEVSSAIDSLVLGEGQILGQVKDAYRIAAEVQAAGILITRLCHTAF
HEM1_ECO27      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECOSM      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_ECO7I      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSF
HEM1_PROA2      YKNAEKEVRPEHFFNRFYNTARHLFEVSSATDSLVLGEGQILGQVKNAYRIAVEEQSAGILLTRLCHTAF
HEM1_CHLTE      YKNARNAVRPEHFFSRFYCGTAHLFEVSCAIDSLVLGEGQILGQVKNAYRIAAEVGTAGILLTRLCHTAF
HEM1_ALISL      FHHVALDLMPSIYIYEEQAAVKHLMRVSCGLDSLVLGEPQILGQVKKAFADAREHNAVEGVVEKLFQSDF
HEM1_KLEP7      YHGLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSSRGHLNVSELERMFQKSF
HEM1_FUSNN      LFSVD------MIVKSRVEAIEYLFKVGCGFYSVIKGEDQILAQVKGAYAEALENEHSSKFLNIIFNKSI
HEM1_VIBF1      FHHVAETLMPSIYIHEEQAAVKHLMRVSCGLDSLVLGEPQILGQVKKAFADAREHNAVEGTIEKLFQQDF
HEM1_VIBFM      FHHVAEILMPSIYIHEEQAAVKHLMRVSCGLDSLVLGEPQILGQVKKAFADAREHNAVEGTIEKLFQQDF
HEM1_SALTY      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALTI      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALSV      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALPK      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALPB      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALPA      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALNS      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALHS      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALG2      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALEP      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALDC      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALCH      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALAR      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_SALA4      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSF
HEM1_PASMU      CMQWFDALAGCLYSQQNQQAVLHLMRVACGLDSLVLGEPQILGQVKDAYQLSKQNQPLSSEFSRLFQKTF
HEM1_CITK8      YHNLNDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLHASALERMFQKSF
HEM1_CHLP8      YKDARNAVRPEHFFNRFYCGTAHLFEVSSAIDSLVLGEGQILGQVKDAYRIAAEVGTAGILLTRLCHTAF
HEM1_METM6      DFSGFDVLKG-------KTATFHFLRVSCGMESMILGENQILGQIKTSFQKARELKKTSRYLDGLFLKAI
HEM1_ENTS8      ---WEEEVRNSLYWHHDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSGRGHANASELERMFQKSF
HEM1_VIBPA      FHQVSEDLMPSLYVHEEQAAIKHLMRVSCGLDSLVLGEPQILGQVKQAFSDSRDHQAVDSSIDKLFQKTF
HEM1_BACSK      LAEWMEDVTPYLVIRENDHAIEHLFRVACGLDSMVIGETQILGQVKQAFLLAQEEKVTGTVFNQLFKQAV
HEM1_PELLD      FRDARKDVRPEHFFSRFYCGTAHLFEVSSAIDSLILGEGQILGQVKEAYRIAAEVQAAGILITRLCHTAF
HEM1_KLEP3      YHGLNEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSSRGHLNVSELERMFQKSF
HEM1_ACTPJ      CFEWHNELRECIYFKQNMEAARHLMRVACGLDSLILGEPQILGQVKQAYQYSQSQNSISTKLSRLFQRTF
HEM1_ACTP7      CFEWHNELRECIYFKQNMEAARHLMRVACGLDSLILGEPQILGQVKQAYQYSQSQNSISTKLSRLFQRTF
HEM1_PSEHT      SFHGLDELSKNIYCHEGSDAINHLMRVACGLDSLVLGEPQILGQIKQAYNSAKTHNAVGVTFDRLFQKTF
HEM1_SULNB      LMSQKGGLNFYELKSTAKRAIEHIFSVVSSLDSLVIGESQITGQVKEAFRFSFQHGTAGRRLNRVLSYAV
HEM1_ALKMQ      DFFQLKELEGCNHFEKGREAVQYLYHVCVGVDSLVIGEDQILGQVKEAHAEALDFAATGKILNKLFLEAV
HEM1_PROVI      FREAGKDVRPEHFFSRFYCGTAHLFEVSSAIDSLILGEGQILGQVKEAYRIAAEVQTAGILLTRLCHTAF
HEM1_ACTP2      CFEWHNELRECIYFKQNMESARHLMRVACGLDSLILGEPQILGQVKQAYQYSQSQNSISTKLSRLFQRTF
HEM1_VIBHB      FHQVNEDLMPSLYVHEEQAAIKHLMRVSCGLDSLVLGEPQILGQVKQAFSDSRDHQAVDTSIDKLFQKTF
HEM1_CAMLR      LLCGVDNLSTKADFYEDSGAIHHLFSVASSLDSLVIGETQIAGQLKDAYKFALQEQRCGVHLTRAVHYAF
HEM1_BACP2      LADWKEDVSPYLKFYENDGAVEHLFRVACGLDSMVIGETQILGQVRSSFKVAQEEKTIGTVFNYLFKQAV
HEM1_BACA2      LSEWKEELSPFLKFYESDAAIEHLFRVACGLDSMVIGETQILGQVRSSFKTAQAEKTIGTIFNELFKQAV
HEM1_ACIBC      LLKWNIDVKQHVYRYENAQAITHLMRVASGLDSLMLGEPQILGQVKSALALSKEAQTVSPELNSVFEYAF
HEM1_METM7      GFD----------ILKGKNATFHFLKVSCGMDSMILGENQILGQIKTSFQKAREFKKTSRYLDSLFLKAI
HEM1_ENT38      YHNLNEELRTSVYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLKASELERMFQKSF
HEM1_BACLD      LANWKEDISPYLKFYENDGAVEHLFRVSCGLDSMVIGETQILGQVRTSFKLAQEEKTIGTVFNYLFKQAV
HEM1_METM5      GFD----------VLKGKNATFHFLKVSCGMDSMILGENQILGQIKTSFQKARELKKTSRYLDSLFLKAI
HEM1_HAEPS      CFNWKEELSEAYYFKQNLEAARHLMSVACGLDSLILGEPQILGQVKQAYQESSQGSGVSTNLSRLFQKTF
HEM1_CHLPB      YKDAQGEVRPEHFFNRFYNTARHLFEVSSAVDSLILGEGQILGQVKNAYRIAVEVQSAGILLTRLCHTAF
HEM1_ACIBY      LLKWNIDVKQHVYRYENAQAITHLMRVASGLDSLMLGEPQILGQVKSALALSKEAQTVSPELNSVFEYAF
HEM1_ACIBT      LLKWNIDVKQHVYRYENAQAITHLMRVASGLDSLMLGEPQILGQVKSALALSKEAQTVSPELNSVFEYAF
HEM1_ACIBS      LLKWNIDVKQHVYRYENAQAITHLMRVASGLDSLMLGEPQILGQVKSALALSKEAQTVSPELNSVFEYAF
HEM1_ACIB5      LLKWNIDVKQHVYRYENAQAITHLMRVASGLDSLMLGEPQILGQVKSALALSKEAQTVSPELNSVFEYAF
HEM1_ACIB3      LLKWNIDVKQHVYRYENAQAITHLMRVASGLDSLMLGEPQILGQVKSALALSKEAQTVSPELNSVFEYAF
HEM1_CHLPD      YKDARKEVRPEHFFSRFYCGTAHLFEVSSAIDSLILGEGQILGQVKDAYRISAEVQAAGILLTRLCHTAF
HEM1_PELPD      ADHHRESLEQYLYSYHSEAAIRHVFRVASSLDSMVVGEPQILGQIKTAYGYAAEYRTSGTILNRFLHKAF
HEM1_METJA      ----NIDLEKFDILFGDK-AIEHLFRVACGLESMIVGEDQILGQLKNAYLKAKEKGRISKKLEKIILKAI
HEM1_HELPY      ILAQNSDLEKCVLMNTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAF
HEM1_HELPS      ILAQNSDLEKCVLMSVDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAF
HEM1_COLP3      FHNVPSTILPSLYWHKDQQAVNHMMRVACGLDSLVLGEPQILGQMKQAYSQAKAAGSMSLIMDRLFQRTF
HEM1_ARCB4      YSKVDFDLYDRADIYDADGAVHHLFSVASALDSLVIGETQIVGQLKDAFRFSQAKGYCSLNITRVMHYAF
HEM1_AQUAE      IKRLNPSFKRYFFVKRGEEAVYHIFKVASSLDSMVIGEPQIVAQFKEAYRVAKEAGTVGKILNRVYEKAL
HEM1_VESOH      IHNTRDRINPYLNYFEDNEALTHVCNVATGLDSLVLGEPQILGQLKNAYHMAKEAKTLNKLLEKLFQHAF
HEM1_PELPB      FKDARKEVRPEHFFSRFYCGTAHIFEVASAIDSLVLGEGQILGQVKNAYRIAAETQCAGILITRLCHTAF
HEM1_HELP2      ILAQNSDLEKCVLMNTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAF
HEM1_METMP      DFSGFDILKG-------KNATFHFLKVSCGMDSMILGENQILGQIKTSFQKARELKKTSRYLDSVFLKAI
HEM1_HELPH      ILAQNSDLEKCVLMNTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAF
HEM1_METCA      QRQFDDDISQYLYSHFDAGTIRHMFRVACGLDSMILGEPQILGQMKTAYQAAREAGTVGKILTKLFHRTF
HEM1_BACCN      LADWFEEISPYLSIFEQDGAIEHLFRVTCGLDSMVVGETQILGQIRNSFLTAQEVKTTGTIFNELLKQVI
HEM1_METVS      GFD----------VIKGKKATLHFLNVACGMDSMILGENQILGQIKSSYHKSKELKKTSKYLENLFLKAI
HEM1_HELAH      ILAQNSDLEKCVLMSTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAF
HEM1_DESAD      CCGSVSELEPNTYCHDGLNAVKHLFRVACSLDSMIVGEPQILGQLKDSYRKAVEAGAARVIINRMLHKSF
HEM1_DECAR      YHQGREEIAPYIYTHDQPEAIRHAFRVASGLDSMVIGEPQILGQMKDAVRAAEENGTLGTQLHKLFQRSF
HEM12_ACIBL     LYNIDPQYEQYLYEYRSTEAVRHMFRVASSLDSMVVGEPQILGQVKEAYATARAVGAVSSQLDALLTRAF
HEM1_PECCP      EYHQPEDVNGSLYWHQDNAAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESQRGHSLSSELERLFQKSF
HEM1_GLOVI      LAESKGTLQRHLFVLLHQDAVMHLMRVAAGLDSIVLGEGQILAQVKMTQSLAQQGKGVDRVLNQLFKTAI
HEM1_CHLCH      YRDARKEVRPEHFFSRFYCSTAHLFEVASAIDSLVLGEGQILGQVKNAYRIAAEAQCAGIMITRLCHTAF
HEM1_GEOSF      ADYHNETLEPHLYSYHGEAATRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAF
HEM1_BACME      LAEWKEEFSPYLTIYENDGAIEHLYRVACGLDSMVIGETQILGQVRSSFLLAQEEETIGTVFNQLFKQAV
HEM1_SHELP      LSH--DDVLPCLYKYQGQQVVQHLMRVSSGLDSLILGEPQILGQVKQSFVKAKEAGTVAVTMDRLFQNTF
HEM1_YERE8      YHKLSDEVKKSLYWHHGNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESQREQSLSGELERLFQKTF
HEM1_SULDN      RSGVSDELEGRADIFDDSSAIHHLFSVASSLDSMVIGETQIAGQLKDAFRFSYDNGFCSQKLARAMHHAF
HEM1_GEOUR      ADYHNETLEPHLYSYHGEAATRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAF
HEM1_CAMFF      ILNSISILTLVPFEALELRAIHHLFAVASSLDSLVVGETQIAGQLKEAFKFAYDNEDCGVNISSAMHFAF
HEM12_CLOPH     GENAKETMRSICVCRQGDEAVTYLMELGCGIHSQIFGEDQILTQLKQALQQARDYQYVDSVLECLFRTAI
HEM1_DESPS      GKVPEEDCRDYLYALKGLPAVQHLFTVAASLDSMVVGEAQILGQLKTAYRHASALGCTGPLLNRLLHKSF
HEM1_CHLT3      HKGVRKEVTRDHFFNYFAGAARHFYNVACAIDSLILGEVQIIGQVKTAYNRAVEMKTVGPILNKMCHTGF
HEM1_YERPS      YHKLSDDVRQSLYWHHGNDAVRHLMRVASGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERLFQKSF
HEM1_YERPP      YHKLSDDVRQSLYWHHGNDAVRHLMRVASGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERLFQKSF
HEM1_YERPN      YHKLSDDVRQSLYWHHGNDAVRHLMRVASGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERLFQKSF
HEM1_YERPG      YHKLSDDVRQSLYWHHGNDAVRHLMRVASGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERLFQKSF
HEM1_YERPE      YHKLSDDVRQSLYWHHGNDAVRHLMRVASGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERLFQKSF
HEM1_YERPA      YHKLSDDVRQSLYWHHGNDAVRHLMRVASGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERLFQKSF
HEM1_YERP3      YHKLSDDVRQSLYWHHGNDAVRHLMRVASGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERLFQKSF
HEM1_SERP5      YHHLREEVSKSLYWHHGNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESQRGQSLSGELERLFQKSF
HEM1_CYAP4      LSEWSHELRQHLFILLHQDAVMHLMRVAAGLDSLVIGEGQILSQVKNTHKLGQQYNGIGTILNRLFKQAI
HEM1_CHLAD      FHRRPGSFVHTLYFYQGEAVARHLCATAAGLRSLVLGEAQIQGQVRSAYEAAQRIGSVGSVLHRLFQIAL
HEM1_LAWIP      I----EELVPHTYTYQGRSAISHLFCVASSLDSMVLGEPQILGQLKDAYKLATIAGASKTILNRLLHKAF
HEM1_HALHL      VIGWRVDLRKHLYVRRSTEAMRHLMRVSAGLDSLVLGEPQILGQVKDAYHKAANAGCLGAVLERLFQHAF
HEM1_DESVV      GWQCEHDLAPYVYTHKGHEAVRHLFRVASSLDSMVVGEPQILGQLKDAYRKAIERNCTRVILNRLLHKAF
HEM1_DESVH      GWSCEHDLAPYVYTHKGPEAIRHLFRVASSLDSMVVGEPQILGQLKDAYRKAIERNCTRVILNRLLHKAF
HEM1_AERS4      RFHGLDEVVSAIYQHQDEEAVRHLMRVACGLDSLVLGEPQILGQIKQSYAHAQQSEAVKGSLERLFQKSF
HEM1_PSYIN      FHQIEDHLRPSLYCYSEYQAIQHLFRVSCGLDSLVLGEPQILGQIKQAFATAKQAKGVDKIVQKWFQHTF
HEM1_PAEMA      MERWREEFTRHLYMYEDEQAVRHLFRVACGLDSMVLGETQILGQVKSAFLLSQRQKGTGTWFNMLFKQAV
HEM1_FRATN      VRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_ERWT9      YHQLSDEVLKSLYWHHGNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQRGHSLSGELERMFQKSF
HEM1_BACHD      LADWKDEFTPFLTIRENDHAIEHLFRVVTGLDSMILGETQILGQVRNSFFIAQEEQVTGSIFNHLFKQAI
HEM1_HELHP      CFCTHEDIKNIALMRLNQYAIYHIFSVASSLDSLVIGETQITGQLKLAYKLAFENALCAKDMTRLMHFAF
HEM1_COREF      ISGVDETLRGYLYVRYADAAAEHMLVVASGLDSMVVGEQQIIGQVRTAYQQATEAGTVGPXXXXXXXXXX
HEM1_ACIAD      WLAQTNDIKQHVYRYEDAQAVTHLMRVASGLDSLMLGEPQILGQVKSALALSKESHTVSRDLNRIFEYAF
HEM1_IDILO      FHKLAPNLENHHYHFQGEQAITHLMSVASGLDSLVLGEPQILGQVKQAYQAAKRQASVGGILERLFQQTF
HEM1_HELPJ      ILAQNSDLEKCVLINTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAF
HEM1_HELPG      ILAQNSDLEKCVLMNTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYRFAFEEKFCSKDLTRLLHFAF
HEM1_AERHH      RFHGLDEVVSAIYQHQDEEAVRHLMRVACGLDSLVLGEPQILGQIKQSYAHAQQSEAVKGSLERLFQKSF
HEM1_ACAM1      LSEWSQELRQHLFILLHQDAVMHLMRVSAGLDSLVLGEGQILAQVKQTHKLSQKYSGAGPILNRLFKQAI
HEM1_LISW6      MANWMEKIEPYLFFHEEKEAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTGTTGTLLNKLFREVV
HEM1_CYTH3      ITGLIQQKEYFEIYNEQADAVLHLFEVGIGLDSQVVGDMQIVNQVKYAYQWSADLNLAGPFLHRLMHTIF
HEM1_CORDI      MSGVDEELRGYLYVRYADAAAEHMMEVTSGLDSMVVGEQQIIGQVRTAYHSATEAGTVGPALHGLVQASL
HEM11_CLOPH     IKKVDDNRYRHCFIERGGYAIEHLFYMTCGLKSKIIGEDQILTQVREALELSRENYCTDSVLETLFRFAI
HEM1_SHEWM      LSH--EEVEPCLYKFEGQGVVKHLMRVSSGLDSLILGEPQILGQVKQSFAKAREAGSVAITMDRLFQNTF
HEM1_MARAV      GFHELDDLENVLYVHRDSDAVRHMMRVAAGLDSMVLGEPQILGQLKDAYALAREHSATGSFLSRLFEQTF
HEM1_CAMJ8      CDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAF
HEM1_TRIEI      KIPLNQ-LRPHLFMLLHEDSIMHLMRVASGLDSLVLGEGQILAQVKQTHKLGQKYKGIGRILNRLFKQAV
HEM1_SHEHH      LSH--EDVEPCLYQYKGQEAVKHLMRVSAGLDSLILGEPQILGQVKQSFVKAKEAGTVAATMDRMFQNTF
HEM1_RUBXD      DRGVEPSLYRDTYWHTDAEAVRHLYRVSASLDSMVVGEAQILGQVRDAYRMATEERCTGPVLNRLFHTAL
HEM1_DESDA      RKSDVEDLRPYVYVHKNLEAVRHLFSVASSLDSMVLGEPQILGQLKTAYRKAVKSRATGVILNRLLHKAF
HEM1_FRATW      VRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_FRATT      VRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_FRATM      VRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_FRAT1      VRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_CORGB      ASGVDETLRGYLYVRYADAAAEHMLVVTSGLDSMVLGEQQIIGQVRTAYQAANEYGSVGPALHSLTQTAL
HEM1_AKKM8      DGRGELDMASYFYSHQGEDALGHLCRVLSGLDSMVLGETEIFGQVKTAYQTALDAGVTAACANKTFQKAF
HEM1_SHEPA      LSH--EDVEPCLYQYKGQEAVKHLMRVSAGLDSLILGEPQILGQVKQSFVKAKEAGTVAATMDRMFQNTF
HEM1_NITOC      YHGMEPKLETCLYTHPDHSAVRHLLRVASGLDSMVLGEPQILGQIKAAYSYGLEAGTIGRVLGRLFQHTF
HEM1_MARMS      VIAWLGELQQYCYTHADDDSVRHVMRVASGLDSLILGEPQILGQVKSAYAVSQEGSCIGPELESLFQRTF
HEM1_ERWCT      EYHQPEEVNSSLYWHQGNAAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESQRGHSLSSELERLFQKSF
HEM1_CORGL      ASGVDETLRGYLYVRYADAAAEHMLVVTSGLDSMVLGEQQIIGQVRTAYQAANEYGSVGPALHSLTQTAL
HEM1_SHEPW      LSH--ADVEPCLYQFKDQEAVKHLMRVSAGLDSLILGEPQILGQVKQSFVKAKEAGTVATTMDRLFQNTF
HEM1_SHEFN      LDH--NDLMPCIYAYEEQVAVKHLMRVASGLDSLVLGEPQILGQVKQAFVKAKEAGTIALTIDRLFQNTF
HEM12_CUCSA     VTEWMSELCKHRVLLYNTDATQHLFEVSAGLDSLVLGEGQILAQVKHVVKTGQGVAGFDRKISGLFKHAI
HEM1_VIBVU      FHQIGEELKPSLYVYEEQAAIRHLMRVSCGLDSLVLGEPQILGQVKQAYSDSREQQAVDASLEKLFQKTF
HEM1_FRATH      VRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_BACCR      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACC4      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACC2      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_EDWI9      YHQLTEEVSDSLYWHQDNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFSESQREQALSADLERLFQKTF
HEM1_DESVM      ARGQKSDLEPFVYVHKGIDAVRHLFSVASSLDSMVVGEPQILGQLKDAYRKAVGRNATRVVLNRLLHKAF
HEM1_FRATO      VRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_FRATF      VRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_CYAPA      LADSSDELRQHLFILLHQDAVMHLMRVTAGLDSLIIGEGQILSQVKQCYQLGQQYQGIGPVLNNIFKQAI
HEM1_BACHK      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACCZ      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACC3      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACC0      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACAN      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACAH      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACAC      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACAA      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_PHOLL      LCEYHQELKSSIYWHCDNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFAXXXXXXXXXXXXXRLFQKSF
HEM1_CAMJJ      CDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAF
HEM1_CAMJE      CDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAF
HEM1_BACCQ      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_BACC7      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_VIBVY      FHQIGEELKPSLYVYEEQAAIRHLMRVSCGLDSLVLGEPQILGQVKQAYSDSREQQAVDASLEKLFQKTF
HEM1_ROSS1      VEQRGVDQALFLYVYHNEAVVRHLYRLAAGLDSMVLGEDQIVGQVKEXXXXXXXXXXXXPVLHRVLHGAL
HEM1_METST      -----------FIVEKNDMAINHLLRLASGLESMIMGEDQILGQIKTARKNAIKNKTIGPKLEKVFTKAI
HEM1_SHEDO      YHDLNQDLLACTYQHEDQAAVKHLMRVAAGLDSLVLGEPQILGQVKQAFVKAKEAGTTALTIDRLFQNTF
HEM1_LISIN      MANWMEKIEPYLFFHEEAEAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTGTTGTLLNKLFREVV
HEM1_WOLSU      EYSKKEELSERADVYEDTGAIHHLFCVCSSLDSLVVGETQIAGQLKSAFKFAYDGGFCSQKLSRAMHFAF
HEM1_SHESM      LDH--QDVAPCLYNYHGQAAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRMFQNTF
HEM1_MICAN      V------LRRYLFTLLHQDAVRHLLRVSAGLESLVLGEGQILAQVKNTHKLAQKYNTISQLLDRLFKQAM
HEM1_CAMJR      CDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAF
HEM12_FLAJ1     NSNGSEEFQQAAYIYKNEEAVSHMFRVGTGLDSQILGDFEIISQIKTAFNNSKQEGLVNTFLDRLVNTVI
HEM1_SHEON      LEH--QDVAPCLYNYHGQEAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTF
HEM1_NOSP7      EYSKLPSLRQHLFMLLHDDAVMHVMRVAGGLDSLVLGEGQILAQVKTTHKLGQQYNGIKTILNRLFKQAL
HEM1_MACCJ      MSEWFDTIKSATDVKVGNEAIHHLFKVITGLDSIVLGETQILGQIRDSFLLAQSEGTTGTVFNKLFKDAI
HEM1_HAHCH      YHQVSTELKACCNIYNDEDAAQHMMRVASGIDSMVLGEPQILGQMKEAHASGRAAGSLGGPLDRLFQHAF
HEM1_CAMJD      CDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNSFCGVHLSRAVHSAF
HEM11_HORVU     VVDWMSELREHLFMLRDSDATRHLFEVSAGLDSLVLGEGQILAQVKQVVRNGQNSGGLGKNIDRMFKDAI
HEM1_SODGM      DYHQPDEVRQSLYWHLGDEAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESRRGHGLSVDLERWFQKSF
HEM1_ROSCS      EQRGVDQFVPSLYIYHNEAVVRHLYRLAAGLDSMVLGEDQIVGQIKEALAIAHASGAIGPVLHRVLHGAL
HEM1_PHOPR      FHRLSEEILPSLYFHEEQAAARHLMRVACGLDSLVLGEPQILGQVKQSYYSSQEYDAIHGTLEKLFHKTF
HEM1_ORYSI      VVDWMSELREHLFMLRDSDATRHLFEVSAGLDSLVLGEGQILAQVKQVVRSGQNSGGLGKNIDRMFKDAI
HEM1_BACWK      LADWFEEVAPYLSIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVV
HEM1_BACC1      LADWFEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVI
HEM1_XANCP      LVAWLDGLSGYLYQHRDAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTF
HEM1_XANC8      LVAWLDGLSGYLYQHRDAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTF
HEM1_SHESR      LDH--QDVAPCLYNYHGQAAVKHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTF
HEM1_SHESA      LDH--QDVAPCLYNYHGQAAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTF
HEM1_RHOBA      CLNQSRDVANHMIIREGREAVEHLFLVAASLDSMVVGEAQILSQVKQSYDLANDADRTGPITHGVFQAAN
HEM1_ORYSJ      VVDWMSELREHLFMLRDSDATRHLFEVSAGLDSLVLGEGQILAQVKQVVRSGQNSGGLGKNIDRMFKDAI
HEM1_OCEIH      LSNWKEEFSTYLRITEDDGAMEHLFRVSTGLDSMVLGETQILGQVKQAFLNSQQVNTTGTIFNELFKQAI
HEM1_CHRSD      FHALPPETSAYHYLDGE--AARHLMRVAAGLDSMVLGEPQILGQLKEAYQLARDNAGLGGELERLFQHTF
HEM1_AZOSE      HMPLSE-VSPYLYTYPQRDAIRHVFRVASGLDSMVLGEPQILGQVKDAVRRAEEAGTMGTLLHKLFQNTF
HEM12_HORVU     VVDWMSELREHLFMLRDSGATRHLFEVSAGLDSLVLGEGQILAQVKQVVRNGQNSGGLGKNIDRMFKDAI
HEM1_XANCB      LVAWLDGLSGYLYQHRDAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTF
HEM1_STRMK      LDQWAGDLQGYLYQHADAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWSTARDHGLLGQRLDRLFQQTF
HEM1_METBU      FYDHDESLR-------------HLLRLACGLESMIIGEDQILGQIKDFFLMAKGAGTVGKVLSTAFSKAI
HEM1_ALCBS      SRNLSERLSTVLYQHTGEQALEHMMRVAGGLDSLVLGEPQILGQMREAYARAHEAGLLNGELSRLFQEVF
HEM1_STRM5      LHTQAGDLQGYLYQHADAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWSTARDHGLLGQRLDRLFQQTF
HEM1_SHESW      LDH--KDVAPCLYNYHGQTAVKHLMRVASGLDSLILGEPQILGQVKQAFAKAKEAGTVALTIDRLFQNTF
HEM1_SHEPC      LDH--KDVAPCLYNYHGQTAVKHLMRVASGLDSLILGEPQILGQVKQAFAKAKEAGTVALTIDRLFQNTF
HEM1_PSEMY      YHRLSDELRACAYVHSEQDAVRHMMRVACGLDSMVLGEPQILGQLKSAYAVAREAGTVGPLLGRLFQATF
HEM1_MYCVP      EHSGMSDLTKHAYVRYAEAAVEHLFSVAGGLDSAVIGEQQVLGQVRRAYASAEANHTVGRTLHELSQRAL
HEM1_THET2      -----GVVPRHLYVKEGVEALRHLYRVAAGLDSLVVGEAQILGQVREALFLARRQGATESLLEKAFQSAI
HEM1_PSEP1      YHRLSDELRASAYVHEEHEAVKHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_DESMR      LAAWAGQLAPHLYAHQGMAAVDHLFCVASGLDSLVLGEPQILGQLKAAYRHAVASRTAGVIINRLCHKAF
HEM1_DEIGD      S-GWGRALDGHLYVHRGEAAATHLYRVAAGLDSLVIGETQIQGQVKRAWQEAHARGLSGTLLNKVAQGAL
HEM1_MOOTA      NFLGRSDLEGYLYTLNTHHAVRHLFRVAAGLDSMILGEDQVLAQVAEAYQVARETGTTNNVLNTLWQQAI
HEM1_ANAVT      FLSEHSSLRQHLFVLLHEDAVMHIMRVAAGLDSLVLGEGQILAQVKNTHKLGQQYNGIKTILNRLFKQAL
HEM1_THET8      -----GVAPRHLYVKEGVEALRHLYRVAAGLDSLVVGEAQILGQVREALFLARRQGATESLLEKAFQSAI
HEM1_PSEPK      YHRLSDELRASAYVHEEHDAVKHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_ANASP      FLSEHSSLRQHLFVLLHEDAVMHIMRVAAGLDSLVLGEGQILAQVKNTHKLGQQYNGIKTILNRLFKQAL
HEM1_DICNV      TAISSEELKRHLFIYTDREAVQHLYRVACGLDSLILGEPQILGQLKAAYRLAKKAGSIGSWLERLFQHSF
HEM1_CORA7      LAEVSEKLRSYLYVRYADAAAEHLMMVTSGLDSMVVGEQQIIGQVRTAYQFASEQGTVGPRIHALAQSAL
HEM1_BREBN      WFGVEEQFKDHLYIKENEQAIEHLFRVSSGLDSMVMGETQILGQVRDAFLLGQEHQTTGTVFNTLFKQAI
HEM1_ALHEH      RYHRLDPLRDYLYLHEGAGAVRHLMRVSAGLDSLVLGEPQILGQAKIAYQGAIDAGTMGRVLDRLFQHAF
HEM13_HORVU     WMSMKSELREHLFMFRDSDATRHLFEVSSGLDSLVLGEGQILAQVKQVVRSGQNSGGLGKNIDRMFKDAI
HEM1_GEOTN      LAEWFDAIAPYLRVLEGEAAAGHLFRVAAGLDSMVLGETQILGQVKGSYLLAQEIGTSGTILNHLFKQAV
HEM1_GEOLS      EYHHHDLLEPHLYSYHGEEAIRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAF
HEM1_BURP8      YHNIADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQIVGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_XYLFT      LLNWLEQLQNHLYQYRDAAAVRHLFRVATGLDSMVLGESQILGQVKDSWSMARTHGTLGNTLDRLFQHSF
HEM1_XYLF2      LLNWLEQLQNHLYQYRDAAAVRHLFRVATGLDSMVLGESQILGQVKDSWSMARTHGTLGNTLDRLFQHSF
HEM1_THICR      YFELEEDINSFLYEYADIEAIKHMMRVSSGLNSLVLGEPQILGQIKEAFHLAHKSDSVHQTLHALFQYIF
HEM1_THEEB      ---WSHQLRPYLFILLHQDAVMHLMRVASGLDSLVIGEGQILSQVKRCHQLGQQYKSIGPILNRVFTGAI
HEM1_RUTMC      THNIKRDIDSYLNYFEGNEALTHLCNVATGLDSLVLGEPQILGQLKNAYHIAKEVKTLNKLLEKLFQHTF
HEM1_METKA      ----HDDA----WVKRGSEAVRHLFRVACGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKIVFRRAI
HEM1_STACT      ARKFGDEIKEMSEVFVGDEAVEHIFRVTAGLDSIVLGETQILGQMRDAFFIAQEEGTTGTIFNHLFKQAI
HEM1_PROM5      QVNC-EVLTPHLFDFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLSQSV
HEM1_LISMO      MANWMEKIEPYLFFHEETEAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTETTGTLLNKLFREVV
HEM1_EXISA      WFNLEEQFTPYLSIREGEEAIRHLFRVTSGLDSMIIGETQILGQVKTSFFRAQEHGTTGTVFNKLFKEAV
HEM1_CYAP8      TGHLPNYLRRYLFTLLHQDAVRHLLRVAAGLESLVLGEGQILAQVKTTHKLGQKYKGIGRLLDRLFKQAI
HEM1_CYAP7      KXXXXXXXXXXXXXXXXQDAVRHLMRVAAGLESLVLGEGQILAQVKNTHKLAQKYGGIGRLLDRLFKQAM
HEM11_CUCSA     VTEWMSEICQHRFLLYNNDATQHIFEVSAGLDSLVLGEGQILXXXXXXXXXXXXXXXFGRNISGLFKHAI
HEM1_THERP      LGGLTEELERWVLQRSGAEAVRHAFCVAAGLDSRVVGEPQILGQVRRARDLARAAGTLGPILDRLFSCSL
HEM1_RALEJ      WLSQHSDLAPHLYSLPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGSLGTYLNQLFQRTF
HEM1_LISMH      MANWMEKIEPYLFFHEESEAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTATTGTLLNKLFREVV
HEM1_XANOM      LVNWLETLSGYLYQHQEAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTF
HEM1_XANAC      LVNWLETLSGYLYQHQEAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTF
HEM1_PSEPG      YHRLSDELRASAYVHEEHDAVKHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_LISMF      MANWMEKIEPYLFFHEETDAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTATTGTLLNKLFREVV
HEM1_LISMC      MANWMEKIEPYLFFHEESDAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTATTGTLLNKLFREVV
HEM1_CYAA5      IGHIPSYLRRYLFTLLHQDAVRHLLRVAAGLESLVLGEGQILAQVKTTHKLSQKYKGIGRLLDRLFKQAI
HEM1_XYLFA      LLNWLEQLQNHLYQYRDAAAVRHLFRVATGLDSMVLGESQILGQVKDSWSMARTHGTLGNTLDRLFQHGF
HEM1_XANOR      LVNWLETLSGYLYQHQEAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTF
HEM1_XANOP      LVNWLETLSGYLYQHQEAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTF
HEM1_XANC5      LVNWLETLSGHLYQHREAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTF
HEM1_SYNP2      TGQLQNRLRRYLFTLLHQDAIRHLLRVAAGLESLVLGEGQILAQVKAAHKLGQQHKGLGRLLDRMFKRAI
HEM1_NITMU      ATHWLADLEPYLYRLPREKAVKHAFRVASGLDSMVLGEPQILGQLKDAVKSAEHAGTLGMLLHKLFQRTF
HEM1_CAMHC      LSGVDDELKERADIYEDDGAIHHLFSVASSLDSLVVGETQIVGQLKDAYNFAKNERKSGVMLDLAINSAL
HEM1_XYLFM      LLNWLEQLQNHLYQYSDAAAVRHLFRVATGLDSMVLGESQILGQVKDSWSMARTHGTLGNTLDRLFQHSF
HEM1_SOLUE      RHKASASIGPHLYRHEGRDAIHHLFRVAASLDSMVVGEPQILGQLKVAYAAAKDCGALCGWLDGLMSRSF
HEM1_RALME      TLRWASELAPHLYALPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGALGTYLNQLFQRTF
HEM1_SHESH      LSH--EDVEPCLYKFEGQAVAQHLMRVSSGLDSLILGEPQILGQVKQSFVKAKEAGSVAITMDRLFQNTF
HEM1_SHEB9      LDH--KDVAPCLYNYHGQDAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTF
HEM1_SHEB8      LDH--KDVAPCLYNYHGQDAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTF
HEM1_SHEB5      LDH--KDVAPCLYNYHGQDAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTF
HEM1_SHEB2      LDH--KDVAPCLYNYHGQDAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTF
HEM1_META3      IIDINEFAEFEMI--KSNNAIKHLLRTASGLNSMIVGEDQIIGQIKNSHRKAKELKKTTKYLDTIFLKAI
HEM1_XANCH      LVTWLETLSGYLYQHQEAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGTLGSGLDRLFQQTF
HEM1_PROMA      HSGLSEDLFPHLFTFNQAEAVNHLMRVSGGLDSLVLGEGQILSQVKKMVRLGQDYKSIGPILNRLLTQAV
HEM1_LYSSC      LADWFDTFSSYLTIREEDEAVEHLFKVTAGIDSMVLGETQILGQVKKSFLSGQEIGTTGTVYNQLFKQAV
HEM1_GEOSM      ADYHNELLEKHLYSYHGEDATRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAF
HEM1_GEOKA      LAEWFEAIAPYLRVLEGEAAIKHLFRVAAGLDSMVLGETQILGQVKDSYLLAQEVGTSGTIFNHLFKQAV
HEM1_GEOBB      ADYHNELLEKHLYSYHGEDATRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAF
HEM1_ALKOO      AAGIDTPYEKVHRVKEGDEVIKHLCQLACGVKSQIWGEDQIITQVKNAIAVSREMRAADSYLEVMFRNAI
HEM1_PERMH      ILSQKNELEKYLFKLTGREAIKHIFKVSASLDSMVIGEPQIVCQFKDAFTKAREEKTVRHILTRLFDKAL
HEM1_PSEE4      YHQLSDELRASAYIHEEHDAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_PSEU2      YHHLSEELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_PSEPW      YHRLSDELRASAYIHEEHDAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_PSE14      YHHLSEELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_SYNP6      LSEHSHELRPHLFVLLHQDAVMHLMRVAAGLDSLVLGEGQILSQVKTMYKLGQQYEGVGRILNRLLKQAV
HEM1_SYNE7      LSEHSHELRPHLFVLLHQDAVMHLMRVAAGLDSLVLGEGQILSQVKTMYKLGQQYEGVGRILNRLLKQAV
HEM1_RALEH      TLRWLSELAPHLYALPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGSLGTYLNQLFQRTF
HEM1_PROMP      SVNF-EDLNPHLFDFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLSQSV
HEM1_DESAA      FFSRTENFEQNLFVYKGDEAVQHVFRVASSLDSMVLGEPQILGQMKESYRLATQAKTTGAVLNRLMHRCF
HEM1_THEFY      QYTGQEELTQHCYVHYEERAVQHLFSVACGLDSMVVGEGQILGQVRNALKDAQHVGTLGRVLNDLGQRAL
HEM1_SYNY3      TGNIPATLRRYLFTLLHEDAVRHLMRVAAGLESLVLGEGQILAQVRTTHKLGQKYKGVGRLLDRLFKQAI
HEM1_SYNR3      HSGLADDLQPHLFALHHEEAIQHLLRVSAGLDSLVLGEGQILSQVKKMYRLGQDHKSIGPILNRLLNQAV
HEM1_PSESM      YHHLSEELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_COXBU      ILRWLSDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVF
HEM1_COXBR      ILRWLSDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVF
HEM1_COXBN      ILRWLSDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVF
HEM1_BURCM      YHRISDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_ARCFU      IFVGESCLR-------------HLLRVASGIESMIVGEEQILGQVRQCFNLCREGGQAGEVLERVFGKAV
HEM1_PROM0      EYSGIDDLNPHLFCFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSV
HEM1_LEGPL      -------LSQFLYIHQGKEGIKHTLRVASGLDSMMIGEPQILGQMKQAYQHACRLGTVKTQLRPVFEYIF
HEM1_GEOMG      ADYHGEILEPHLYAHHGEAAIRHVFRVASSLDSMVVGEPQILGQIKTAYGYAAEFKTSGIILNRFLHKAF
HEM1_STRSV      LADWFQELEEYLVFREGDEALRHLLRVSIGLESKIVGESQVLGQLKQAFLTAQDAGTTGIVLNQAFKQAL
HEM1_SHEAM      YHNLSDELMPCVYHHEGQEAVRHLMRVASGLDSLVLGEPQILGQVKQSFAKAKEAGTVAVTLDRLFQSTF
HEM1_PSEAE      HRLTLDELRACAYVHQDEDAVRHMMRVASGLDSMVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_PSEAB      HRLTLDELRACAYVHQDEDAVRHMMRVASGLDSMVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_PSEA8      HRLTLDELRACAYVHQDEDAVRHMMRVASGLDSMVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_PSEA7      HRLTLDELRACAYVHQDEDAVRHMMRVASGLDSMVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_PROMM      QHSGTEDLSPHLFNFHHDEAVAHLMRVAAGLDSLVLGEGQILSQVKKMVRLGQEHKSMGPILNRLLTQAV
HEM1_MYXXD      VLGGVEALE-HLYEHQGEAALVHLFRVACSLDSMVLGEAQILGQVKEAFERGQGAGAVRGELMRACAAAF
HEM1_LEGPH      -------LSQFLYIHQGKEGIKHTLRVASGLDSMMIGEPQILGQMKQAYQHACRLGTVKTQLRPVFEYIF
HEM1_LEGPC      -------LSQFLYIHQGKEGIKHTLRVASGLDSMMIGEPQILGQMKQAYQHACRLGTVKTQLRPVFEYIF
HEM1_LEGPA      -------LSQFLYIHQGKEGIKHTLRVASGLDSMMIGEPQILGQMKQAYQHACRLGTVKTQLRPVFEYIF
HEM1_PROMT      QFSGLDDLSPHLFNYVQEKAVSHVMRVSAGLDSLVLGEGQILSQVKKMVRLGQDHHSLGPILNRLLTQAV
HEM1_POLSQ      TFDWPSSLQPHIYSLPQSDAVRHAFRVACGLDSMVIGETQILGQMKDAVRTANDAGVLGTYLNQLFQKTF
HEM1_MYCGI      DHSGMSDLTKXXXXXXXXXXXXHLFAVASGLDSAVVGEQQVLGQVRRAYASAESNHTVGRTLHELSQRAL
HEM1_MYCA9      GMN---ELTKYAYVRYSEAAVEHLFAVASGLDSMVVGEQQVLGQVRNAYATAESHQAVGRVLHELSQSAL
HEM1_METAC      ASTHIIDFYGH------DESLEHLLRLAGGLESMIVGEDQILGQIKDLYAYSKKAGTTGKILDTAFEKAI
HEM1_BURA4      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_PSEF5      YHHLSDELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM1_NITEU      HLRFGD-LEPYLYRLLREQAVKHAFRVASGLDSMVLGEPQILGQMKNAVKSAEQAGTLGLLLHKMFQRTF
HEM1_BORA1      HCMEAGSLHPHLYRLHQNDAVRHAFRVASGLDSMVLGEPQILGQMKDAVRAAEEAGSLGTLLHQLFQRTF
HEM1_PROM2      EYSGIEDLDPHLFCFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSV
HEM1_METBF      FYGHDESLE-------------HLLRLAGGLESMIVGEDQILGQIKELYAYSKKAGTTGKILDTAFDKAI
HEM12_ARATH     VTEWMSEICQHRFLLYNKDVTQHIFEVSAGLDSLVLGEGQILAXXXXXXXXXXXXNGFGRNISGLFKHAI
HEM1_MAGSM      ------DVTPHLYTKAESEAVRHGFCVASSLDSMVLGEAQILGQMKQAYQDALSAGSTGVVLNRFFQHAF
HEM1_PSEPF      YHHLSDELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTIGPLLGRLFQATF
HEM1_PROM9      GIIF-EDLNPHLFCFRQEDAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSV
HEM1_MYCUA      DHSGMSELTKHAYVRYSEAAVEHLFAVASGLDSAVVGEQQVLGQVRRSYSAAEANRTVGRVLHELAQRTL
HEM1_GRAFK      THGTVEEFEKVAYVYKNKQAITHIFKVGTGLDSQILGDFEIISQLKIAFVRSKKLGLVNAFLERLVNAVI
HEM1_FRAP2      VRNPEFKIRDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVF
HEM1_BURPP      YHNLPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQIVGQMKDAVRTASEAGALGTYLNQLFQRTF
HEM11_ARATH     VTEWMSEICQHRFLLYNKDATQHIFEVSAGLDSLVLGEGQILAXXXXXXXXXXXXNGFGRNISGLFKHAI
HEM1_WIGBR      LYKFFNDLKKNNFYSYDNYAVSHLMRVTSGLDSMILGEHQILSQVKSAFFRSLKNKNISIDLQKLFESAF
HEM1_THIDA      DFHHLDELAPYLYTLPREKAAQHAFRVAAGLDSMVLGETQILGQMKQAVXXXXXXXXXXXXXHKLFQRTF
HEM1_PSEA6      FHQAKDELGLNSYIYHQEDAIKHIMRVACGLDSLILGEPQILGQVKQAFVSAKDSGVIKSDFERLFQQTF
HEM1_PROMS      EYSGIEDLNPHLFCFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSV
HEM1_EXIS2      LANWMEELEPYLFIHEGFDAMKHLFRVTSGLDSMIVGETQILGQVKTSFFTAQKLETTGTVFNKLFKEAV
HEM1_AZOSB      QLPLAQ-VSPYLYSYPQRDAVRHVFRVASGLDSMVLGEPQILGQVKEAARRAEEAGTLGTLLHKLFQNTF
HEM1_PROM3      FLGQHEDLSPHLFNFHHDEAVAHLMRVAAGLDSLVLGEGQILSQVKKMVRLGQEHKSMGPILNRLLTQAV
HEM1_LACRJ      AFHYTDDFTKFVTVTTKDAVAEHLFKVITGLDSLIKGEPQILGQMKDAFQIATKEGTTGAILNHLFRQAI
HEM1_LACRD      AFHYTDDFTKFVTVTTKDAVAEHLFKVITGLDSLIKGEPQILGQMKDAFQIATKEGTTGAILNHLFRQAI
HEM1_SYNJB      LKGIPPQLRPHLFTLLYQDAVTHLMRVAAGLDSLVLGEGQILSQVKKAQQLGQACNGMDRILNRLFKAAI
HEM1_PROM1      EFSGLEDLSPHLFNYVQEKAVSHVMRVSAGLDSLVLGEGQILSQVKKMVRLGQDHHSLGPILNRLLTQAV
HEM1_METS3      --------NKSIIIDYGDSVIKHLFRMTSGLESMIVGEDQILGQVSDAKQKAFKERHCGKILDSIFTKAI
HEM1_HERA2      QRSIDDELMPHVYTYLDEDAVRHLFRVASGLDSMALGEAQILSQIKTAYNAAQQTELLGTTMHRLIQAAL
HEM1_METMA      ASTHIIDFYGH------DESLEHLLRLAGGLESMIVGEDQILGQIKDLYAYSKKAGTTGKILETAFEKAI
HEM1_DEIRA      ---WGHALLDHLYVYRGEAAVRHLYRVTAGLDSLVIGETQIQGQVKRAWQSARERGLSGTLMNKVVQGAL
HEM1_METFK      YHRLKPQIAPYMYTLPQENAVKHAFRVASGLDSMVLGEAQILGQMKQAVRIAENAGTLGTLLHKLFQRTF
HEM1_CLOJO      QLSGEEDHKSLMTLFSDSEAIFHLMEVACGLQSMVLFEDRVITQVKNAAAISREEKTIDSTLETLFRLCX
HEM1_BURXL      YHNLPGELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQIVGQMKDAVRTASEAGALGTYLNQLFQRTF
HEM1_PELCD      EHHGLDELKPHLYIHSGRDAIRHLFRVASSLDSMILGEPQILGQLKEAYNLAESSCTAGPVLNRLLPRAF
HEM1_NITEC      FHHLHSDLEPYLYKLLREQAVKHAFRVASGLDSMVLGEAQILGQMKNAVKSAEQAGTLGLLLHKMFQHTF
HEM1_NEIM0      YHSLPEEISPYLYTLGMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTF
HEM1_CLOTH      AANFDEEYSNMHVLRTGVDVIRHLCELACGVKSQIWGEDQIITQVRNAIELAREMNASDSTLEVMFRIXX
HEM1_RALSO      AHHHNIDLAPHVYALGQSQAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_POLSJ      GGVSPALLRSHAYTLQDDQAARHAFRVASGLDSMVLGEPQILGQLKDAVRAAEDAGAMGSTLHQLFQRSF
HEM1_NEIMF      YHSLPEEISPYLYTLGMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTF
HEM1_NEIMC      YHSLPEEISPYLYTLGMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTF
HEM1_NEIMA      YHSLPEEISPYLYTLGMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTF
HEM1_METPP      VGGVGDTLSHHAYMLEGGEAARHAFRVASGLDSMVLGEPQILGQMKQAVREADAAGTLGSTLHQLFQRSF
HEM1_GEOSL      DYHGVEVLEPHLYSHHGEAAIRHVFRVAASLDSMVVGEPQILGQIKTAYGYAAEFRTSGIILNRFLHKAF
HEM1_BURPS      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_BURP6      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_BURP1      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_BURP0      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_BURMS      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_BURMA      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_BURM9      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_BURM7      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_BORPE      EHNRLEALRPHLYRHQHDDAVRHAFRVASGLDSMVLGEPQILGQMKDAVRAANEAGALGTLLHQLFQRTF
HEM1_BORPA      EHNRLEALRPHLYRHQHDDAVRHAFRVASGLDSMVLGEPQILGQMKDAVRAANEAGALGTLLHQLFQRTF
HEM1_BORBR      EHNRLEALRPHLYRHQHDDAVRHAFRVASGLDSMVLGEPQILGQMKDAVRAANEAGALGTLLHQLFQRTF
HEM1_NEIG2      YHSLPEEIRPYLYTLDMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRAAQEQESMGAKLNALFQKTF
HEM1_NEIG1      YHSLPEEIRPYLYTLDMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRAAQEQESMGAKLNALFQKTF
HEM1_SYNJA      AKGIPPQLRPHLFTLLYQDAVTHLMRVAAGLDSLVLGEGQILSQVKKAQQLGQACNGMDRILNRLFKAAI
HEM1_PSYA2      IKTWLADFKQYLYVHRDMHALTHWLRVAAGLDSMILGEPQILGQIKRAVHLAQDQKALSNQLGWIVDQVF
HEM1_BURVG      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_BURCA      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_PROM4      HSGLGDELDPHLFSYDQAEAVKHVMRVAGGLDSLVLGEGQILSQVKKMVRLGQENHSMGPILNRLLTQAV
HEM1_CHRVO      LSR--AELEPYLYRLEASQAARHAFRVASGLDSMVLGETQILGQLKDAVRSAEHAGALGTLLNGLFQRTF
HEM1_BURCJ      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_BURS3      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_BURCH      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_BURCC      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTF
HEM1_NEIMB      YHSLPEEIRPYLYALDMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTF
HEM1_METTH      -------------VEGDEDALRHILRLASGLESMIIGEDQILGQIKAARVQALREGTCGPVLDMVFTKAV
HEM1_PSYCK      IKTWLDEIDPYLYVHRNTHALTHWLRVAAGLDSMILGEPQILGQIKRAVHMAQDQKALSNQLGWIVDQVF
HEM1_POLNA      WLAHNGGLRAHAYTLQDDQAARHAFRVASGLDSMVLGEPQILGQMKDAVRAAEDAGAMGTTLHQLFQRSF
HEM1_BURM1      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTASEAGALGTYLNQLFQRTF
HEM1_SYNS9      EFLSNHELSPHLFNFHHQDAVDHLLRVAAGLDSLVLGEGQILSQVKKMMRLGQEHKSLGPILNRLLTQAV
HEM1_HERAR      FLDYHSELRPYLYALPQDNAVRHAFRVASGLDSMVLGEPQILGQMKDAVRQAEAAGGLGTYLHQMFQRTF
HEM1_STAS1      ARSFGEDIKNMTEVKVGDEAVKHLLQVTSGLDSVVLGETQILGQIRNAFFLAQEEDTTGTIFNHLFKQAI
HEM1_STAHJ      ARSFGDDIKNMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQMRDAFFLAQDIQTTGTIFNHLFKQAI
HEM1_ACIAC      SGGVSPSLRSHSYTLEESLVARHAFRVASGLDSMVLGEAQILGQMKDAVRXXXXXXXXXXXXNQLFQRSF
HEM1_THEAC      --GFPEDLEAMKNVLHDEEAIKHLMEVSSGLDSMSLGENEILKQVKEAYELSVRNGKVDKVLSLIFQKAI
HEM1_PSEFS      XXXXXXXXRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATF
HEM11_ACIBL     FLTHEYGLKSHFYRLMDDVALNHIFRVASSLDSMVIGEPEIVGQFKNAWSQAQAAGTTGRFLDAVMQKAL
HEM1_METTM      GFT----------VEKDEDAXXXXXXXXXXXESMIIGEDQILGQIKAARLQALREGTCGPLLDMVFTKAV
HEM1_FLAPJ      SKGTVEDFQKVAYVYKNQEAISHLFKVGTGLDSQILGDFEIISQIKIAFTESKALDLANSFMERLVNSVI
HEM1_CALMQ      TINHVDKLVGM-------NAVRHIFRVAAGLESAAVGESEILGQVEDAFNDARKRGAXXXXXXFTIERAI
HEM1_CHLSY      AFHRRPSFVHTLYFYQGEAVARHLCATAAGLRSLVLGEAQIQGQVRNAYEAAQRIGSVGSILHRLFQIAL
HEM1_CHLAA      AFHRRPSFVHTLYFYQGEAVARHLCATAAGLRSLVLGEAQIQGQVRNAYEAAQRIGSVGSILHRLFQIAL
HEM1_BURTA      YHRIPDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTF
HEM1_SYNPW      GLE-TGDLKPHLFAYHHEDAVGHLLRVAAGLDSLVLGEGQILSQVKKMMRLGQEHKSLGPILNRLLTQAV
HEM1_STAES      ARSFGDDIKDMSQVKVGDDAVEHLLRVTSGLDSIVLGETQILGQMRDAFFLAQNTGTTGTIFNHLFKQAI
HEM1_STAEQ      ARSFGDDIKDMSEVKVGDDAVEHLLRVTSGLDSIVLGETQILGQMRDAFFLAQNTGTTGTIFNHLFKQAI
HEM1_SYNS3      HSGLESDLSPHLFTYHHDEAIAHLMRVTAGLDSLVLGEGQILSQVKKMMRLGQEHKSIGPILNRLLTQAV
HEM1_STAAW      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAAT      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAAS      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAAN      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAAM      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAAE      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAAC      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAA9      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAA3      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAA2      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAA1      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_STAAR      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_METTP      IAKKARVSSRXXXXXXXXXXXXXXXXXXXXXXXMIIGEDQILGQMKELYRTAKSLGYTGWVLDTAFKKAI
HEM1_STAA8      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_SACD2      QVNVAE-LEQSHYLYTASEAASHMMKVASGLDSLVLGEPQILGQMKSAYAVAREAGVLGGHLHDVFQRVF
HEM1_SYNAS      ------ELERCLYTLSGAEAVRHLFRVASSLDSLVMGEPQILGQVKEAYREAVEHGVTGILLNRILHHAF
HEM1_STAAB      AFGFEDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAI
HEM1_PSEU5      HRLSLDELKACAYVHVDDQAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGSVGPLLGRLFQATF
HEM1_METMJ      --------GRHGFTVIEGEAVPHLLELAAGIDSLIVGEDQILXXXXXXXXXXXXXXTCCSAIGLCIKKAV
HEM1_CORU7      YSGLDDELEPHLYVHYSDAAVEHMLNVASGLDSMVLGEQQIIGQLRGAYEESKGAGTVGRTLHDLTQRAL
HEM1_VEREI      SGGVSTALRAHSYTLQDSRAARHAFRVASGLDSMVLGEAQILGQMKDAVRAAETAGVLGSTLNQLFQRSF
HEM1_FRASN      VCGVPTDLASHLYVHHEARAVSHLFSVVCGLDSMLVGETQILGQVRAAFRLAQAAEVTSGTLANLFQTAL
HEM1_RHOFD      TLDWSSLLRTHSYTLQDDLAARHAFRVASGLDSMVLGETQILGQIKNXXXXXXXXXXLGNTLSQLFQRSF
HEM1_PSYWF      LITWLADFKQYLYDYVDGQALTHMLRVAAGLDSMILGEPQIFGQIKRSVNQAKEQGFLTNQLNWVVEQIF
HEM1_FRAAA      ISGIDGDLAGHLYVHHDARAVGHLFSVVCGLDSMLVGESQILGQVRGAFRTGQSAGVAGSALSGLFQAAL
HEM1_ACISJ      SGGVSPALLRSHSYSLENGLVAHAFRVASGLDSMVLGEAQILGQMKDAVRXXXXXXXXXXXXNQLFQRSF
HEM11_FLAJ1     NSNGSDAFQKVGFVYKNQEAINHMFRVGTGLDSQILGDFEIISQIKTSFTHSKSMGLANAFMERLVNAVI
HEM1_SYNFM      GLDSTEGVENHVYAFRGMEAVRHVFRVASSLDSMVVGEPQILGQLKSAYREATEWRTVKVILNRLLHKTF
HEM1_SALAI      VLAESTGLADHLYVHFDAAAVKHAFRVATGLDSMVVGEAQILGQLRDAYHWASGADTTGRLLHELMQQAL
HEM1_MYCLE      EYSAMSDLTKYAYVRYSEAAVEHLFTVASGLDSAVVGEQQVLGQVRRAYAAAEANRTVGQVLHEVAQRAL
HEM1_MYCPA      DHSGMSDLTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYATAETNRTVGRVLHELAQRAL
HEM1_MYCA1      DHSGMSDLTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYATAETNRTVGRVLHELAQRAL
HEM1_JANMA      FLDYHKELRPYLYALPQDNAVRHAFRVASGLDSMVLGEPQILGQMKDAVRQAEAAGGLGTYLHQMFQRTF
HEM1_SALTO      STGCQPALADHLYVHFDAAAVNHVFRVAVGLDSMVVGEAQILGQLRDAYHWASEAETVGRLLHELMQQAL
HEM1_HALSA      XXXXXXXXXXXXISMGHEDSLRHLLRVAAGLESLVVGEDQILGQLRDAYDAAKDAGGIDHVLREAVTKAM
HEM1_HALS3      XXXXXXXXXXXXISMGHEDSLRHLLRVAAGLESLVVGEDQILGQLRDAYDAAKDAGGIDHVLREAVTKAM
HEM1_MYCSS      SLN---DLTKXXXXXXXXXXXXHLFAVASGLDSAVIGEQQVLGQVRRAYTSAEANHTVGRTLHELSQRAL
HEM1_MYCSK      SLN---DLTKXXXXXXXXXXXXHLFAVASGLDSAVIGEQQVLGQVRRAYTSAEANHTVGRTLHELSQRAL
HEM1_MYCSJ      SLN---DLTKXXXXXXXXXXXXHLFAVASGLDSAVIGEQQVLGQVRRAYTSAEANHTVGRTLHELSQRAL
HEM1_SYNSC      HSGLETELTPHLFSYHHEDAVDHLMRVAAGLDSLVLGEGQILSQVKKMMRLGQEHKSLGPILNRLLTQAV
HEM1_SALRD      GTRWPEETA---FQERDEAAVRHLLQVTSGLRSVVLGERQIFAQVKAAYERAVDAGGIHSVMHRLFHTAF
HEM1_UNCMA      VRAGDDCLKG-------------LLRLACGLESMIVGEDQILGQLKTALLQARRLGTIGPVLSTAIQKSI
HEM1_METB6      ----ESQERKGFFLLEGREALRHLFSLAAGIDSMIVGEDQIIGQLKKSLADGEAACTASPFLSLCINKAV
HEM11_NOCSJ     AGERTEAMLPHLYVHYDDGAVSHLFQVVAGLDSMAVGEGQILGQTRAALNAGQEIGTVGPALNVLFQQAL
HEM1_SYNPX      GHSGTGELTPHLFNYHHEDAVDHLMRVAAGLDSLVLGEGQILSQVKKMMRLGQEHKSLGPILNRLLTQAV
HEM1_RHOSR      L----TDLHRHAYVRYSEAAAEHLFAVASGLDSMVIGEQQILGQIRTAYASSDAQQAAGRTLHELAQQAL
HEM1_HALWD      --SFAPDVRDGAVVDSHEESLRHLLRVATGLESLVLGEDQILGQFKRAIEVARGIGALGPMLEAGVTKAI
HEM12_ANADE     ----SPAAADHLYAKDGVEAVRHLFRVASSLDSMVVGEQQILGQVKEXXXXXXXXXXXXXXFSRLCNRAF
HEM1_TERTT      AAS-AQELQHAHYARWGDDAARHMMAVASGLDSLVLGEPQILGQMKSCYAVAREAGVLGRGLHDAFQRVF
HEM1_RHOOB      L----TDLHRHAYVRYSEAAAEHLFAVASGLDSMVIGEQQILGQIRTAYASSDAQQAAGRTLHELAQQAL
HEM1_CHLTB      EIKL---LGVSPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSFALHFLFQKAL
HEM1_CHLT2      EIKL---LGVSPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSFALHFLFQKAL
HEM1_PICTO      IYNYPE-------------STMHLLRVASGLESMSIGENDIMRQVKEAYELSIKRKTSGKILSYIFKKAL
HEM1_SULAC      THG--KDISSNAIVLRGKDAINHLYQVASGLDSLAIGEYEILGQIKEALTSCKKHSLCNEEIELLFNAAI
HEM1_CORJK      FSGLQTELEPHLYVHYADSAAEHMLKVASGLDSMVIGEQQIIGQLRSAYQSANETGTVGRTLHDLTQRAL
HEM1_SORC5      LVGLGGDVRGHLAGRVGSDAVLHLFRVAASLDSMVVGEPQILGQMKEAIEVARGAKTLGVRLGRAAHRAI
HEM1_CHLTA      EIEL---LGVSPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSFALHFLFQKAL
HEM1_MYCTU      EHSGMSELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRAL
HEM1_MYCTA      EHSGMSELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRAL
HEM1_MYCBT      EHSGMSELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRAL
HEM1_MYCBP      EHSGMSELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRAL
HEM1_MYCBO      EHSGMSELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRAL
HEM1_HALMA      AVP--DDVVVEM---GHEESLRHLLRVAAGLESIVLGEDQILGQLRTAYETARGVGGIGPMLEDGVTKAI
HEM1_CHLTR      EIEL---LGVSPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSFALHFLFQKAL
HEM1_NOCFA      LAM--PDLTKHAYVRYSEAAAEHLFAVASGLDSMVVGEQQVLSQIRGAYATADAQQAVGRTLHELAQHAL
HEM1_FRASC      ICGIDGDLAGHLYVHHEARAIGHLFSVVCGLDSMLVGESQILGQVRTAFRXXXXXXXXXXXXXXXFQAAL
HEM1_ACIC1      V-NF-DEIAGHVHVHYDDRAVQHLFAVAAGLDSMLIGEHQVVGQVRDAFRLAQERGYAGRDLHAIVQDAL
HEM12_ANADF     ALNARAGRELPLFELHGEEAYRHLVRVASSLESAILGEPQILGQVKEAFQRSIDQGVAAKELTSVLNRAL
HEM11_PYRAR     ----KSGYAPYVEKVVERRGVDHLFRVAAGLESMLIGETDVLGQLEEAFDRQVRAGYTRELLKTVVERAI
HEM1_MYCS2      SLN---DLTKXXXXXXXXXXXXHLFAVTSGLDSAVIGEQQVLGQVRRAYATAEANRTVGRTLHELAQRAL
HEM1_KINRD      IGRGLDELGDQLYVHYEDAGVEHLFKVACGLDSMAVGESQILGQLRLALRGLHERGLAGGTLDRLLQTAL
HEM1_PARUW      QDVKEDDHKLYSFFGMD--CFSHLTRVTSGLDSAIVAETEIQGQVKNAYNLATTFLCLPKELHFLFQKSM
HEM1_NATPD      XXXVDDDAIRML---SHNQSLKHLMAVACGLESLVIGEDQILGQVRDAYEDARGVGGVGPTLNDAVLKAL
HEM1_IGNH4      ARAGEPIPEEKFVIYYGTDAVRHLFRVAAGLESMVLGEPDILRQVREAAEFAAKEGYIGKALKLTFENAV
HEM1_STRAW      -----EELTPYLYVHYEDRAVHHLFSVACGLDSMVVGEGQILGQIKDALATAQELHTAGRLLNDLFQQAL
HEM11_ANADF     FTERAPDADEHLYAKIGVEAIRHLFRVSASLDSMVVGEQQILGQVKXXXXXXXXXXXXXPFMSRLCNRAF
HEM1_RHOE4      L----TALHAHAYVRYSEAAVEHLFAVASGLDSMVIGEQQILGQIRXXXXXXXXXXXXGRVVHELAQQAL
HEM1_METHJ      MVHGNADLLG-TFLESEGRAGWQMWKXXXXXXSMVIGEDQILGQLRKSLSLSESMSVADPLITLCINKAI
HEM1_METS5      VHN--KVISTDATILRGEEAIKHLFEVASGIDSLSVGEYEILKQIKDAMRDSIKLGIGSRYIRALLERSL
HEM1_METLZ      --------QRFGFIXXXXXXXXXXXXXXXGTKSMIIGEDQILGQMRRALLLAESTNDVITDVCLNTAIRE
HEM1_STRCO      QHSGVEELTPYLYVHYEDRAVHHLFSVACGLDSMVVGEGQILGQIKDSLARAQDLHTAGRLLNDLFQQAL
HEM1_SACEN      RHSGSDELTDHMYVFYAGAAVEHLFSVAAGLDSMVVGEAQILGQIRQSYGVADEAGTVGRTLHELAQQAL
HEM1_CHLMU      -----REMGAIPYFYRNQDCFSHLFCVVGGMDSLVLGETEIQGQVKRAYLQAIEEQKLAFALHFLFQKAL
HEM1_SULIY      VH--NEPIGNQARVICGKDSIKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQILFERAI
HEM1_SULIN      VH--NEPIGNQARVICGKDSIKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQILFERAI
HEM1_SULIM      VH--NEPIGNQARVIC