[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81144.1

[Show Plain Result]


## Summary of Sequence Search
    1::326
    1::322     2e-80  44%  337 aa  ASRC_SALTY RecName: Full=Anaerobic sulfite reductase subunit C;    
    1::322     2e-80  44%  337 aa  ASRC_SALTI RecName: Full=Anaerobic sulfite reductase subunit C;    
  355::619     2e-30  34%  620 aa  Y870_METJA RecName: Full=Uncharacterized protein MJ0870;
   16::218     1e-15  33%  275 aa  Y551_METJA RecName: Full=Uncharacterized protein MJ0551;
   99::376     5e-13  30%  418 aa  DSRA_ARCFU RecName: Full=Sulfite reductase, dissimilatory-type
  365::504     1e-10  32%  569 aa  NIR_MAIZE RecName: Full=Ferredoxin--nitrite reductase,
  131::243     5e-10  32%  250 aa  Y514_METJA RecName: Full=Uncharacterized polyferredoxin-like
   73::146     9e-10  43%  624 aa  SIR_SYNE7 RecName: Full=Sulfite reductase [ferredoxin];       
  394::531     9e-10  29%  596 aa  NIR_ORYSJ RecName: Full=Ferredoxin--nitrite reductase,
  380::518     9e-10  33%  583 aa  NIR_BETVE RecName: Full=Ferredoxin--nitrite reductase,
  316::453     2e-09  30%  512 aa  NIR_SYNE7 RecName: Full=Ferredoxin--nitrite reductase;       
  392::530     3e-09  31%  594 aa  NIR_SPIOL RecName: Full=Ferredoxin--nitrite reductase,
  367::521     3e-09  30%  586 aa  NIR_ARATH RecName: Full=Ferredoxin--nitrite reductase,
  239::321     1e-08  40%  501 aa  Y1303_METJA RecName: Full=Uncharacterized polyferredoxin-like
  566::692     2e-08  29%  805 aa  NASD_BACSU RecName: Full=Nitrite reductase [NAD(P)H];       
   68::206     4e-08  27%  510 aa  NIR_PHOLA RecName: Full=Ferredoxin--nitrite reductase;       
  639::775     4e-08  30% 1104 aa  NIR_EMENI RecName: Full=Nitrite reductase [NAD(P)H];       
   59::132     4e-08  44%  215 aa  NDHI_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     4e-08  44%  210 aa  NDHI_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     4e-08  44%  215 aa  NDHI_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
  578::623     6e-08  46%  793 aa  HDRA_METAC RecName: Full=CoB--CoM heterodisulfide reductase 1
  142::185     8e-08  52%  394 aa  VHUB_METJA RecName: Full=Polyferredoxin protein vhuB;
   59::132     1e-07  42%  202 aa  NDHI_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  202 aa  NDHI_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
    8::62      1e-07  44%   70 aa  FER2_THEAC RecName: Full=Probable ferredoxin TA0517;
   59::132     1e-07  42%  219 aa  NDHI_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  218 aa  NDHI_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  208 aa  NDHI_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  208 aa  NDHI_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  219 aa  NDHI_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  208 aa  NDHI_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  208 aa  NDHI_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  215 aa  NDHI_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  208 aa  NDHI_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     1e-07  42%  208 aa  NDHI_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     2e-07  42%  218 aa  NDHI_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     2e-07  42%  218 aa  NDHI_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     2e-07  41%  218 aa  NDHI_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     2e-07  41%  218 aa  NDHI_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   49::158     2e-07  36%  183 aa  NDHI_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-07  42%  194 aa  NDHI_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     2e-07  42%  194 aa  NDHI_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
  139::210     4e-07  42%  980 aa  FDHL_BACSU RecName: Full=Putative formate dehydrogenase yrhE;      
   34::75      5e-07  50%  398 aa  VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;
   59::161     5e-07  34%  165 aa  NDHI_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::132     5e-07  38%  209 aa  NDHI_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   94::146     5e-07  38%  146 aa  FWDE_METJA RecName: Full=Ferredoxin-type protein fwdE;
   49::132     9e-07  36%  181 aa  NDHI_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
  141::204     9e-07  38%  984 aa  FDHL_STAS1 RecName: Full=Putative formate dehydrogenase SSP0601;   
   75::121     1e-06  43%  635 aa  SIR_SYNY3 RecName: Full=Sulfite reductase [ferredoxin];       
  636::772     1e-06  29% 1176 aa  NIR_NEUCR RecName: Full=Nitrite reductase [NAD(P)H];       
   50::133     1e-06  38%  193 aa  NDHI_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   49::160     1e-06  34%  181 aa  NDHI_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::132     1e-06  38%  193 aa  NDHI_CYAP8 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::167     2e-06  32%  167 aa  NDHI_VITVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     2e-06  33%  170 aa  NDHI_SPIOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::132     2e-06  38%  200 aa  NDHI_CYAP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
  578::623     2e-06  41%  793 aa  HDRA_METMA RecName: Full=CoB--CoM heterodisulfide reductase 1
   49::132     2e-06  39%  165 aa  NDHI_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::132     2e-06  35%  173 aa  NDHI_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   46::129     2e-06  35%  182 aa  NDHI_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
  295::387     2e-06  43%  412 aa  MVHB_METTH RecName: Full=Polyferredoxin protein mvhB;
  106::215     2e-06  36%  412 aa  MVHB_METFE RecName: Full=Polyferredoxin protein mvhB;
   32::100     2e-06  46%  180 aa  HYCF_ECOLI RecName: Full=Formate hydrogenlyase subunit 6;       
  181::231     2e-06  37%  236 aa  FRHG_METTH RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
  375::502     2e-06  31%  571 aa  CYSI_SERP5 RecName: Full=Sulfite reductase [NADPH] hemoprotein
   50::114     3e-06  43%  140 aa  NUOI_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   72::332     3e-06  26%  366 aa  DSRB_ARCFU RecName: Full=Sulfite reductase, dissimilatory-type
   49::132     3e-06  36%  203 aa  NDHI_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::161     3e-06  33%  167 aa  NDHI_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     3e-06  38%  167 aa  NDHI_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::161     3e-06  33%  167 aa  NDHI_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
  141::204     3e-06  40%  984 aa  FDHL_STAAW RecName: Full=Putative formate dehydrogenase MW2229;    
  141::204     3e-06  40%  984 aa  FDHL_STAAS RecName: Full=Putative formate dehydrogenase SAS2201;   
  141::204     3e-06  42%  984 aa  FDHL_STAAR RecName: Full=Putative formate dehydrogenase SAR2393;   
  141::204     3e-06  40%  984 aa  FDHL_STAAN RecName: Full=Putative formate dehydrogenase SA2102;    
  141::204     3e-06  40%  984 aa  FDHL_STAAM RecName: Full=Putative formate dehydrogenase SAV2309;   
  141::204     3e-06  40%  984 aa  FDHL_STAAC RecName: Full=Putative formate dehydrogenase SACOL2301; 
  141::204     3e-06  40%  984 aa  FDHL_STAAB RecName: Full=Putative formate dehydrogenase SAB2186c;  
  141::204     3e-06  40%  984 aa  FDHL_STAA8 RecName: Full=Putative formate dehydrogenase
  141::204     3e-06  40%  984 aa  FDHL_STAA3 RecName: Full=Putative formate dehydrogenase
  375::502     3e-06  29%  576 aa  CYSI_YERPS RecName: Full=Sulfite reductase [NADPH] hemoprotein
  375::502     3e-06  29%  576 aa  CYSI_YERPB RecName: Full=Sulfite reductase [NADPH] hemoprotein
   59::132     4e-06  38%  194 aa  NDHI_PLEBO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::167     4e-06  31%  167 aa  NDHI_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::167     4e-06  31%  167 aa  NDHI_GOSBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
  384::467     4e-06  47%  760 aa  ACDA1_METKA RecName: Full=Acetyl-CoA decarbonylase/synthase complex
  143::204     6e-06  43%  574 aa  PHF1_CLOPA RecName: Full=Iron hydrogenase 1;       
   46::129     6e-06  35%  181 aa  NDHI_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::160     6e-06  33%  183 aa  NDHI_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     6e-06  33%  180 aa  NDHI_CHLSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
  208::275     6e-06  35%  287 aa  MAUN_METEA RecName: Full=Methylamine utilization ferredoxin-type
  141::204     6e-06  40%  984 aa  FDHL_STAHJ RecName: Full=Putative formate dehydrogenase SH0748;    
   46::97      8e-06  40%  105 aa  PORD_PYRAB RecName: Full=Pyruvate synthase subunit porD;AltName:
   59::160     8e-06  33%  166 aa  NDHI_PSIGN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  33%  166 aa  NDHI_PSAAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::170     8e-06  34%  180 aa  NDHI_PIPCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  33%  166 aa  NDHI_PHABO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  32%  166 aa  NDHI_MELLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  33%  166 aa  NDHI_MARCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  33%  166 aa  NDHI_INUBR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  33%  166 aa  NDHI_HYMLE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  33%  166 aa  NDHI_HELBG RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  32%  166 aa  NDHI_ENYSE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     8e-06  38%  196 aa  NDHI_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::160     8e-06  33%  166 aa  NDHI_BLEZA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  33%  166 aa  NDHI_ATHGP RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     8e-06  32%  166 aa  NDHI_AMBTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
    9::52      8e-06  45%   56 aa  FER_CLOPE RecName: Full=Ferredoxin;
  371::501     8e-06  30%  570 aa  CYSI_ENT38 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  379::507     8e-06  29%  576 aa  CYSI_ALISL RecName: Full=Sulfite reductase [NADPH] hemoprotein
   59::160     1e-05  32%  166 aa  NDHI_ZINJU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ZEXSE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ZALME RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_WEDTE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_VILAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_VERJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_VARMX RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_TRIPN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_TRIME RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_TILBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_TETRE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_TETOR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_TARER RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_SYNNO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_STESO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_STERE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   46::121     1e-05  35%  181 aa  NDHI_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_SQUKU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_SPIUR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_SPHTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_SMAMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_SIGBL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_RUMPE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_RUDHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ROJSU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_RATCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     1e-05  32%  176 aa  NDHI_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     1e-05  32%  176 aa  NDHI_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_PODEM RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_PEUSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_PEROV RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_PERMO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_PERLI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_PERCD RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_PALAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_OXYSB RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_OBLMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_NEULO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_MONRV RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_MONPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_MONGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_MILQU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  190 aa  NDHI_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::160     1e-05  32%  166 aa  NDHI_MELNV RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_MADSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_LUNJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_LIPIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_LASMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_LAGRA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_KINPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_IDIQU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ICHTE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_HULAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_HELAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_GRERE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_GALQU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_GALPT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_FLOPE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_FLARA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_EUTPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ENCCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ECLPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  31%  166 aa  NDHI_EATNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DYSTE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DYSMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DUGME RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DIMVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DIMHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DESFU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DELBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DAMCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_DAHCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_CYMVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_CONNE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  36%  167 aa  NDHI_COFAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_COETI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_CLIAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_CHRHE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  36%  159 aa  NDHI_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_CHAST RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_CHASO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_CALVA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_BEBJU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_BAHTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_BAHAB RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ARNMO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ARNDE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_APHJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_ACAAU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
    8::51      1e-05  43%   55 aa  FER_CLOSM RecName: Full=Ferredoxin;
  375::502     1e-05  29%  576 aa  CYSI_YERPY RecName: Full=Sulfite reductase [NADPH] hemoprotein
  375::502     1e-05  29%  576 aa  CYSI_YERPP RecName: Full=Sulfite reductase [NADPH] hemoprotein
  375::502     1e-05  29%  576 aa  CYSI_YERPN RecName: Full=Sulfite reductase [NADPH] hemoprotein
  375::502     1e-05  29%  576 aa  CYSI_YERPE RecName: Full=Sulfite reductase [NADPH] hemoprotein
  375::502     1e-05  29%  576 aa  CYSI_YERPA RecName: Full=Sulfite reductase [NADPH] hemoprotein
  375::502     1e-05  29%  576 aa  CYSI_YERP3 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  375::502     1e-05  30%  576 aa  CYSI_YERE8 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  381::509     1e-05  26%  578 aa  CYSI_VIBPA RecName: Full=Sulfite reductase [NADPH] hemoprotein
  152::197     1e-05  43%  208 aa  YDHY_SHIFL RecName: Full=Uncharacterized ferredoxin-like protein
  152::197     1e-05  43%  208 aa  YDHY_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein
  152::197     1e-05  43%  208 aa  YDHY_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein
   59::160     1e-05  32%  166 aa  NDHI_TRIBB RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  180 aa  NDHI_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  180 aa  NDHI_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  180 aa  NDHI_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  180 aa  NDHI_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  180 aa  NDHI_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  180 aa  NDHI_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  180 aa  NDHI_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     1e-05  32%  172 aa  NDHI_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     1e-05  32%  167 aa  NDHI_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  38%  180 aa  NDHI_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     1e-05  32%  167 aa  NDHI_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     1e-05  32%  167 aa  NDHI_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_HOFFA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     1e-05  36%  180 aa  NDHI_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     1e-05  32%  172 aa  NDHI_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     1e-05  32%  166 aa  NDHI_CHAPD RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     1e-05  32%  167 aa  NDHI_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
    8::51      1e-05  43%   55 aa  FER_CLOST RecName: Full=Ferredoxin;
  914::972     1e-05  31% 1442 aa  ECM17_YEAST RecName: Full=Sulfite reductase [NADPH] subunit beta;  
  101::314     1e-05  27%  437 aa  DSVA_DESVH RecName: Full=Sulfite reductase, dissimilatory-type
  142::205     2e-05  40%  985 aa  YJGC_BACSU RecName: Full=Probable oxidoreductase yjgC;       
   45::97      2e-05  40%  105 aa  PORD_PYRFU RecName: Full=Pyruvate synthase subunit porD;AltName:
   59::132     2e-05  35%  163 aa  NDHI_SOYBN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  180 aa  NDHI_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     2e-05  35%  166 aa  NDHI_RAIAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  42%  167 aa  NDHI_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     2e-05  33%  180 aa  NDHI_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  167 aa  NDHI_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  38%  180 aa  NDHI_DIOEL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::132     2e-05  35%  193 aa  NDHI_CYAP4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::160     2e-05  32%  160 aa  NDHI_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     2e-05  31%  172 aa  NDHI_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::163     2e-05  32%  180 aa  NDHI_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
    6::50      2e-05  49%   54 aa  FER_MEGEL RecName: Full=Ferredoxin;
    9::52      2e-05  45%   56 aa  FER_CLOPA RecName: Full=Ferredoxin;
    8::51      2e-05  43%   55 aa  FER_CLOBU RecName: Full=Ferredoxin;
    8::51      2e-05  43%   55 aa  FER_CLOAC RecName: Full=Ferredoxin;
  381::509     2e-05  27%  578 aa  CYSI_VIBHB RecName: Full=Sulfite reductase [NADPH] hemoprotein
  379::507     2e-05  27%  576 aa  CYSI_VIBFM RecName: Full=Sulfite reductase [NADPH] hemoprotein
  379::507     2e-05  27%  576 aa  CYSI_VIBF1 RecName: Full=Sulfite reductase [NADPH] hemoprotein
   80::153     2e-05  36%  408 aa  Y51B_METJA RecName: Full=Uncharacterized polyferredoxin-like
   59::132     2e-05  36%  166 aa  NDHI_VENCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  167 aa  NDHI_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  167 aa  NDHI_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  167 aa  NDHI_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  167 aa  NDHI_SOLBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_SILPE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_RIEOB RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_RENSL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_PSEAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_POLCN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_PHIZI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_PARHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_OTESC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  167 aa  NDHI_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  167 aa  NDHI_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_MONCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_LOXSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  35%  161 aa  NDHI_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_LAYHE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_LACSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_JAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_JAEHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_HYMFF RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_GUATU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_ERIST RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_ERICN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_ENGPE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::124     2e-05  36%  167 aa  NDHI_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  40%  164 aa  NDHI_DAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_CALME RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  167 aa  NDHI_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::124     2e-05  36%  172 aa  NDHI_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::124     2e-05  36%  167 aa  NDHI_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     2e-05  32%  167 aa  NDHI_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::161     2e-05  32%  167 aa  NDHI_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  35%  179 aa  NDHI_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     2e-05  36%  166 aa  NDHI_ACMRA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   95::155     2e-05  36%  370 aa  HMC2_DESVH RecName: Full=Protein DVU_0535;AltName: Full=HMC operon
   95::378     2e-05  26%  417 aa  DSRA_CHRVI RecName: Full=Sulfite reductase, dissimilatory-type
  380::508     2e-05  27%  577 aa  CYSI_VIBCM RecName: Full=Sulfite reductase [NADPH] hemoprotein
  380::508     2e-05  27%  577 aa  CYSI_VIBCH RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALTI RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALSV RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALPC RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALPB RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALNS RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALHS RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALG2 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALEP RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  570 aa  CYSI_SALDC RecName: Full=Sulfite reductase [NADPH] hemoprotein
  425::501     2e-05  31%  579 aa  CYSI_SALCH RecName: Full=Sulfite reductase [NADPH] hemoprotein
  379::502     2e-05  29%  576 aa  CYSI_PHOLL RecName: Full=Sulfite reductase [NADPH] hemoprotein
  372::501     2e-05  31%  570 aa  CYSI_ENTS8 RecName: Full=Sulfite reductase [NADPH] hemoprotein
   27::85      3e-05  36%   86 aa  PORD_METJA RecName: Full=Pyruvate synthase subunit porD;AltName:
  570::696     3e-05  28%  847 aa  NIRB_ECOLI RecName: Full=Nitrite reductase [NAD(P)H] large subunit;
   59::132     3e-05  40%  180 aa  NDHI_PLAOC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     3e-05  40%  163 aa  NDHI_PHODC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     3e-05  35%  161 aa  NDHI_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   10::56      3e-05  43%   58 aa  FER_METTE RecName: Full=Probable ferredoxin;
   12::52      3e-05  41%   59 aa  FER_ENTHI RecName: Full=Ferredoxin;
    8::51      3e-05  41%   58 aa  FER6_METJA RecName: Full=Uncharacterized ferredoxin MJ0624;
  379::514     3e-05  28%  584 aa  CYSI_COLP3 RecName: Full=Sulfite reductase [NADPH] hemoprotein
   93::223     4e-05  27%  555 aa  SIR2_MYCPA RecName: Full=Sulfite reductase [ferredoxin] 2;       
   45::97      4e-05  38%  105 aa  PORD_PYRHO RecName: Full=Pyruvate synthase subunit porD;AltName:
   70::141     4e-05  42%  230 aa  NQO9_RHOMR RecName: Full=NADH-quinone oxidoreductase subunit 9;    
   49::132     4e-05  38%  176 aa  NDHI_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::160     4e-05  32%  166 aa  NDHI_CORPT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::132     4e-05  38%  175 aa  NDHI_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     4e-05  35%  180 aa  NDHI_CALFG RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     4e-05  36%  182 aa  NDHI_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::132     4e-05  35%  167 aa  NDHI_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   49::132     4e-05  36%  200 aa  NDHI_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
  485::616     4e-05  27%  623 aa  IORA_ARCFU RecName: Full=Indolepyruvate oxidoreductase subunit
    6::51      4e-05  41%   55 aa  FER_CLOTS RecName: Full=Ferredoxin;
  430::501     4e-05  32%  570 aa  CYSI_SALTY RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     4e-05  32%  570 aa  CYSI_SALPK RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     4e-05  32%  570 aa  CYSI_SALPA RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     4e-05  32%  570 aa  CYSI_SALA4 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  372::502     4e-05  27%  576 aa  CYSI_PROMH RecName: Full=Sulfite reductase [NADPH] hemoprotein
  371::501     4e-05  30%  570 aa  CYSI_CITK8 RecName: Full=Sulfite reductase [NADPH] hemoprotein
   46::104     5e-05  36%  105 aa  VORD_PYRHO RecName: Full=Ketoisovalerate oxidoreductase subunit
   46::104     5e-05  36%  105 aa  VORD_PYRAB RecName: Full=Ketoisovalerate oxidoreductase subunit
   59::132     5e-05  36%  180 aa  NDHI_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   48::131     5e-05  35%  196 aa  NDHI_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   59::132     5e-05  40%  167 aa  NDHI_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     5e-05  35%  179 aa  NDHI_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     5e-05  35%  179 aa  NDHI_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     5e-05  35%  180 aa  NDHI_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     5e-05  35%  180 aa  NDHI_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   59::132     5e-05  36%  180 aa  NDHI_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
    8::52      5e-05  42%   56 aa  FERA_METJA RecName: Full=Uncharacterized ferredoxin MJ0533;
  380::508     5e-05  28%  577 aa  CYSI_VIBC3 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     5e-05  31%  570 aa  CYSI_SALAR RecName: Full=Sulfite reductase [NADPH] hemoprotein
   59::132     6e-05  35%  180 aa  NDHI_AMBTC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
  552::668     6e-05  28%  771 aa  NASB_BACSU RecName: Full=Assimilatory nitrate reductase electron
    8::56      6e-05  35%   59 aa  FER2_DESNO RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II;
   35::153     6e-05  29%  294 aa  FDNH_SHIFL RecName: Full=Formate dehydrogenase, nitrate-inducible,
   35::153     6e-05  29%  294 aa  FDNH_ECOLI RecName: Full=Formate dehydrogenase, nitrate-inducible,
  116::202     8e-05  36%  207 aa  RNFB_HAEDU RecName: Full=Electron transport complex protein rnfB;
   29::80      8e-05  29%  421 aa  PHFL_DESVO RecName: Full=Periplasmic [Fe] hydrogenase large
   37::104     8e-05  41%  171 aa  NUOI_SHEWM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::129     8e-05  38%  188 aa  NUOI_RHOSR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::129     8e-05  38%  188 aa  NUOI_RHOOB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     8e-05  44%  180 aa  NUOI_ENTS8 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   47::114     8e-05  40%  181 aa  NUOI_BLOPB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   61::123     8e-05  42%  167 aa  NUOI1_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
  379::501     8e-05  27%  570 aa  CYSI_ZYMMO RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     8e-05  32%  570 aa  CYSI_ECOSM RecName: Full=Sulfite reductase [NADPH] hemoprotein
   45::104     1e-04  33%  105 aa  VORD_PYRFU RecName: Full=Ketoisovalerate oxidoreductase subunit
  111::158     1e-04  38%  190 aa  RNFB_SODGM RecName: Full=Electron transport complex protein rnfB;
    9::61      1e-04  35%   81 aa  PSAC_EUGGR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      1e-04  37%   81 aa  PSAC_ANTFO RecName: Full=Photosystem I iron-sulfur center;AltName:
   53::129     1e-04  38%  195 aa  NUOI_RHOE4 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::123     1e-04  42%  175 aa  NUOI2_ACIBL RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   60::126     1e-04  40%  149 aa  NUOI1_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
  568::694     1e-04  28%  957 aa  NIRB_KLEOX RecName: Full=Nitrite reductase [NAD(P)H] large subunit;
   49::132     1e-04  34%  209 aa  NDHI_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
  367::497     1e-04  31%  566 aa  CYSI_SODGM RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     1e-04  32%  570 aa  CYSI_KLEP7 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  436::508     1e-04  30%  577 aa  CYSI_ERWCT RecName: Full=Sulfite reductase [NADPH] hemoprotein
  369::497     1e-04  32%  566 aa  CYSI_BAUCH RecName: Full=Sulfite reductase [NADPH] hemoprotein
   42::129     1e-04  35%  157 aa  VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;
   22::147     1e-04  25%  218 aa  SIR_DESVH RecName: Full=Sulfite reductase, assimilatory-type;      
  113::158     1e-04  39%  185 aa  RNFB_TOLAT RecName: Full=Electron transport complex protein rnfB;
   11::61      1e-04  37%   81 aa  PSAC_PINKO RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      1e-04  37%   81 aa  PSAC_DIOEL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      1e-04  37%   81 aa  PSAC_CYCTA RecName: Full=Photosystem I iron-sulfur center;AltName:
   53::119     1e-04  37%  181 aa  NUOI_MYCA1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::119     1e-04  37%  181 aa  NUOI2_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   53::115     1e-04  40%  175 aa  NUOI1_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
   49::132     1e-04  34%  183 aa  NDHI_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
  224::275     1e-04  36%  283 aa  MAUN_PARDP RecName: Full=Methylamine utilization ferredoxin-type
  240::297     1e-04  29%  355 aa  FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;
  103::152     1e-04  43%  312 aa  FDXH_HAEIN RecName: Full=Formate dehydrogenase iron-sulfur
   74::175     1e-04  36%  565 aa  CYSI_SHESR RecName: Full=Sulfite reductase [NADPH] hemoprotein
   74::175     1e-04  36%  565 aa  CYSI_SHESM RecName: Full=Sulfite reductase [NADPH] hemoprotein
   74::175     1e-04  36%  565 aa  CYSI_SHESA RecName: Full=Sulfite reductase [NADPH] hemoprotein
   74::175     1e-04  36%  565 aa  CYSI_SHEON RecName: Full=Sulfite reductase [NADPH] hemoprotein
  366::496     1e-04  29%  565 aa  CYSI_PSEHT RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     1e-04  32%  570 aa  CYSI_KLEP3 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  377::494     1e-04  31%  569 aa  CYSI_BLOFL RecName: Full=Sulfite reductase [NADPH] hemoprotein
   47::86      2e-04  45%  209 aa  Y934_METJA RecName: Full=Uncharacterized polyferredoxin-like
  111::159     2e-04  41%  163 aa  Y51A_METJA RecName: Full=Uncharacterized polyferredoxin-like
   48::94      2e-04  42%  153 aa  Y264_METJA RecName: Full=Uncharacterized protein MJ0264;
  364::433     2e-04  39%  519 aa  RNFC_RHOCA RecName: Full=Electron transport complex protein
  113::160     2e-04  35%  192 aa  RNFB_SHISS RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SHIDS RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SHIB3 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALTY RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALTI RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALSV RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALPK RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALPC RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALPB RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALPA RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALNS RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALHS RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALG2 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALEP RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALDC RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALCH RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALAR RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SALA4 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOUT RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOSM RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOSE RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOLU RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOLI RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOLC RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOL6 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOL5 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOK1 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOHS RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECODH RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECOBW RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO8A RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO81 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO7I RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO5E RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO57 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO55 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO45 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO27 RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_ECO24 RecName: Full=Electron transport complex protein rnfB;
  111::165     2e-04  39%  167 aa  RNFB_BUCAT RecName: Full=Electron transport complex protein rnfB;
  111::165     2e-04  39%  167 aa  RNFB_BUCAI RecName: Full=Electron transport complex protein rnfB;
  111::165     2e-04  39%  167 aa  RNFB_BUCA5 RecName: Full=Electron transport complex protein rnfB;
   11::61      2e-04  39%   81 aa  PSAC_RHDSA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_NOSS9 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_NOSS8 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_NOSP7 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  37%   81 aa  PSAC_MICAN RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_FREDI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_ANAVT RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_ANASP RecName: Full=Photosystem I iron-sulfur center;AltName:
   37::132     2e-04  26%  163 aa  NUOI_COXBU RecName: Full=NADH-quinone oxidoreductase subunit I;    
   37::132     2e-04  26%  163 aa  NUOI_COXBR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   37::132     2e-04  26%  163 aa  NUOI_COXBN RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  41%  180 aa  NUOI_ACIAD RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::131     2e-04  34%  210 aa  NDHI_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
    8::51      2e-04  41%   55 aa  FER_CLOTM RecName: Full=Ferredoxin;
    8::59      2e-04  37%   77 aa  FER7_METJA RecName: Full=Uncharacterized ferredoxin MJ0722;
   15::96      2e-04  41%  105 aa  FER3_RHISN RecName: Full=Putative ferredoxin-3;AltName:
   81::126     2e-04  35%  131 aa  FER2_METJA RecName: Full=Uncharacterized ferredoxin MJ0099;
  381::509     2e-04  26%  578 aa  CYSI_VIBVU RecName: Full=Sulfite reductase [NADPH] hemoprotein
  407::475     2e-04  43%  774 aa  ACDA_METJA RecName: Full=Acetyl-CoA decarbonylase/synthase complex
   64::98      2e-04  49%  639 aa  YGFT_ECOLI RecName: Full=Uncharacterized protein ygfT;
   93::153     2e-04  28%  555 aa  SIR_MYCTU RecName: Full=Sulfite reductase [ferredoxin];       
   93::153     2e-04  28%  555 aa  SIR_MYCBO RecName: Full=Sulfite reductase [ferredoxin];       
   97::157     2e-04  31%  197 aa  RNFB_VIBHB RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SHIFL RecName: Full=Electron transport complex protein rnfB;
  113::160     2e-04  35%  192 aa  RNFB_SHIBS RecName: Full=Electron transport complex protein rnfB;
   93::156     2e-04  36%  187 aa  RNFB_RHOCA RecName: Full=Electron transport complex protein
  113::159     2e-04  36%  192 aa  RNFB_ESCF3 RecName: Full=Electron transport complex protein rnfB;
  113::159     2e-04  36%  192 aa  RNFB_CITK8 RecName: Full=Electron transport complex protein rnfB;
  110::159     2e-04  35%  169 aa  RNFB_BUCBP RecName: Full=Electron transport complex protein rnfB;
   11::61      2e-04  35%   81 aa  PSAC_SYNY3 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_PROM9 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_PROM4 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_MARPO RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_CYAP8 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      2e-04  35%   81 aa  PSAC_CYAP7 RecName: Full=Photosystem I iron-sulfur center;AltName:
   46::113     2e-04  42%  180 aa  NUOI_SHISS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_SHIF8 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_SHIDS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_SHIBS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   34::113     2e-04  35%  180 aa  NUOI_SHEON RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_SALTY RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_SALTI RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_SALPA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_SALCH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::119     2e-04  35%  175 aa  NUOI_MYCGI RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  41%  180 aa  NUOI_ERWT9 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_ERWCT RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_ECOUT RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_ECOL5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_ECOK1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  42%  180 aa  NUOI_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  41%  180 aa  NUOI_ACIBY RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  41%  180 aa  NUOI_ACIBT RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  41%  180 aa  NUOI_ACIBS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     2e-04  41%  180 aa  NUOI_ACIBC RecName: Full=NADH-quinone oxidoreductase subunit I;    
   37::104     2e-04  37%  164 aa  NUOI2_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   37::104     2e-04  37%  164 aa  NUOI2_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   48::131     2e-04  41%  210 aa  NDHI_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
    8::51      2e-04  39%   55 aa  FER1_RHORU RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
  430::501     2e-04  31%  570 aa  CYSI_SHIFL RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     2e-04  31%  570 aa  CYSI_SHIF8 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  334::386     3e-04  34%  431 aa  Y1684_METTH RecName: Full=Uncharacterized protein MTH_1684;
   97::157     3e-04  31%  197 aa  RNFB_VIBSL RecName: Full=Electron transport complex protein rnfB;
   97::157     3e-04  31%  198 aa  RNFB_VIBPA RecName: Full=Electron transport complex protein rnfB;
  111::157     3e-04  36%  188 aa  RNFB_RHOS4 RecName: Full=Electron transport complex protein
  111::157     3e-04  36%  188 aa  RNFB_RHOS1 RecName: Full=Electron transport complex protein
  106::153     3e-04  33%  193 aa  RNFB_HAEIN RecName: Full=Electron transport complex protein rnfB;
  106::153     3e-04  33%  193 aa  RNFB_HAEIE RecName: Full=Electron transport complex protein rnfB;
  106::153     3e-04  33%  193 aa  RNFB_HAEI8 RecName: Full=Electron transport complex protein rnfB;
  113::158     3e-04  35%  187 aa  RNFB_AERS4 RecName: Full=Electron transport complex protein rnfB;
  113::158     3e-04  35%  187 aa  RNFB_AERHH RecName: Full=Electron transport complex protein rnfB;
   11::61      3e-04  35%   81 aa  PSAC_ZYGCR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_WHEAT RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_VITVI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_TOBAC RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_STAPU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SPIOL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SOYBN RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SORBI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SOLTU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SOLLC RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SOLBU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SECCE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SACOF RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_SACHY RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_PSEPI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_POPTR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_POPAL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_PLAOC RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_PIPCE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_PHAAO RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_PELHO RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_PANGI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_ORYSJ RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_ORYSI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_ORYSA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_ORYNI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_OLIPU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_OENEH RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_NYMAL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_NICTO RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_NICSY RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_NASOF RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_NANDO RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_MORIN RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_MASLA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_LOTJA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_LOLPR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_LOBMA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_LEPVR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_LACSA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_JASNU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_IPOPU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_HORVU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_HELAN RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_GOSHI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_GOSBA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_EUCGG RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_DRANE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_DAUCA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CUSRE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CUSOB RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CUSGR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CUSEX RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CRUWA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_COFAR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CITSI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CHAVU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CHAGL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CAPBU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_CALFG RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_BUXMI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_BARVE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_ATRBE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_ARATH RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_ARAHI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_AMBTC RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_AGRST RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_AETGR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_AETCO RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_AEGTA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      3e-04  35%   81 aa  PSAC_ACOCL RecName: Full=Photosystem I iron-sulfur center;AltName:
   29::80      3e-04  31%  421 aa  PHFL_DESVH RecName: Full=Periplasmic [Fe] hydrogenase large
   34::113     3e-04  35%  180 aa  NUOI_AERHH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   82::194     3e-04  34%  208 aa  NUOI2_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   13::67      3e-04  38%  107 aa  FER_PYRIL RecName: Full=Ferredoxin;AltName: Full=Seven-iron
  381::509     3e-04  26%  578 aa  CYSI_VIBVY RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_SHISS RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_SHIDS RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_SHIBS RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_SHIB3 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  382::510     3e-04  29%  589 aa  CYSI_NEIMA RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ESCF3 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOUT RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOSE RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOLU RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOLI RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOLC RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOL6 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOL5 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOK1 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOHS RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECOBW RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO8A RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO81 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO7I RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO5E RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO57 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO55 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO45 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO27 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  430::501     3e-04  31%  570 aa  CYSI_ECO24 RecName: Full=Sulfite reductase [NADPH] hemoprotein
   84::184     3e-04  32%  575 aa  CYSI_BLOPB RecName: Full=Sulfite reductase [NADPH] hemoprotein
  370::429     4e-04  36%  703 aa  RNFC_SERP5 RecName: Full=Electron transport complex protein rnfC;
  114::157     4e-04  36%  198 aa  RNFB_VIBVY RecName: Full=Electron transport complex protein rnfB;
  114::157     4e-04  36%  198 aa  RNFB_VIBVU RecName: Full=Electron transport complex protein rnfB;
   11::61      4e-04  37%   81 aa  PSAC_TRIEI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_THEVL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_THEEB RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_SYNEN RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_PROMT RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_PROM1 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  37%   81 aa  PSAC_PINTH RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_PHYPA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_PHATR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_OLTVI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_MAIZE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_LEPTE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_HUPLU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  37%   81 aa  PSAC_GUITH RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_CYAP4 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  37%   81 aa  PSAC_CYACA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_CYAA5 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_CHLVU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_ANGEV RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_ADICA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      4e-04  35%   81 aa  PSAC_ACAM1 RecName: Full=Photosystem I iron-sulfur center;AltName:
   46::113     4e-04  42%  180 aa  NUOI_YERPY RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_YERPS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_YERPP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_YERPN RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_YERPG RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_YERPE RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_YERPB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_YERPA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_YERP3 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEU2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSESM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEPK RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEPF RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEFL RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEF5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEE4 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEAB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEA8 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSEA7 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   48::115     4e-04  42%  182 aa  NUOI_PSE14 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   79::142     4e-04  39%  186 aa  NUOI_PELPD RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::119     4e-04  35%  174 aa  NUOI_MYCVP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::123     4e-04  38%  181 aa  NUOI_MYCUA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   80::150     4e-04  38%  211 aa  NUOI_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit I;    
   80::150     4e-04  38%  211 aa  NUOI_MYCTA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::123     4e-04  38%  181 aa  NUOI_MYCMM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   80::150     4e-04  38%  211 aa  NUOI_MYCBT RecName: Full=NADH-quinone oxidoreductase subunit I;    
   80::150     4e-04  38%  211 aa  NUOI_MYCBP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   80::150     4e-04  38%  211 aa  NUOI_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     4e-04  42%  180 aa  NUOI_EDWI9 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   88::146     4e-04  42%  238 aa  NUOI_ANADF RecName: Full=NADH-quinone oxidoreductase subunit I;    
   34::113     4e-04  40%  180 aa  NUOI_AERS4 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   54::124     4e-04  40%  199 aa  NUOI_ACIC1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
  495::645     4e-04  26%  648 aa  IORA_PYRAB RecName: Full=Indolepyruvate oxidoreductase subunit
   24::91      4e-04  37%   96 aa  FER3_PLEBO RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
   83::358     4e-04  22%  381 aa  DSVB_DESVH RecName: Full=Sulfite reductase, dissimilatory-type
  113::160     5e-04  35%  192 aa  RNFB_PECCP RecName: Full=Electron transport complex protein rnfB;
   11::61      5e-04  35%   81 aa  PSAC_SYNSC RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_SYNS9 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_SYNS3 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_SYNR3 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_SYNPZ RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_SYNPX RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_SYNPW RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_SYNP2 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_STIHE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_PROMS RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_PROMP RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_PROMA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_PROM5 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_PROM2 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_PROM0 RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  37%   81 aa  PSAC_PORYE RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  37%   81 aa  PSAC_PORPU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_OSTTA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_MESVI RecName: Full=Photosystem I iron-sulfur center;AltName:
    9::61      5e-04  33%   81 aa  PSAC_CYAME RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      5e-04  35%   81 aa  PSAC_CHLRE RecName: Full=Photosystem I iron-sulfur center;AltName:
   46::113     5e-04  42%  180 aa  NUOI_YERE8 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   46::113     5e-04  44%  180 aa  NUOI_TOLAT RecName: Full=NADH-quinone oxidoreductase subunit I;    
   53::119     5e-04  37%  180 aa  NUOI_MYCS2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   45::112     5e-04  39%  179 aa  NUOI_CHRSD RecName: Full=NADH-quinone oxidoreductase subunit I;    
  464::530     5e-04  35%  597 aa  NUOHI_NOCFA RecName: Full=NADH-quinone oxidoreductase subunits H/I;
  146::202     5e-04  40%  853 aa  NUOG2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit G 2; 
  119::182     5e-04  35%  219 aa  NDUS8_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase 23 kDa
  591::634     5e-04  39%  659 aa  HDRA_METTM RecName: Full=CoB--CoM heterodisulfide reductase
  592::635     5e-04  39%  659 aa  HDRA_METTH RecName: Full=CoB--CoM heterodisulfide reductase
   13::64      5e-04  31%  510 aa  GLUS_METJA RecName: Full=Glutamate synthase;         EC=1.4.1.13;
   23::93      5e-04  29%   97 aa  FER3_ANASP RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
   35::144     5e-04  31%  300 aa  FDOH_SHIFL RecName: Full=Formate dehydrogenase-O iron-sulfur
   35::144     5e-04  31%  300 aa  FDOH_ECOLI RecName: Full=Formate dehydrogenase-O iron-sulfur
   35::144     5e-04  31%  300 aa  FDOH_ECOL6 RecName: Full=Formate dehydrogenase-O iron-sulfur
  366::493     5e-04  27%  562 aa  CYSI_SHEDO RecName: Full=Sulfite reductase [NADPH] hemoprotein
  381::510     5e-04  24%  588 aa  CYSI_MANSM RecName: Full=Sulfite reductase [NADPH] hemoprotein
   46::90      7e-04  40%  287 aa  YJJW_ECOLI RecName: Full=Uncharacterized protein yjjW;
  169::207     7e-04  46%  216 aa  Y726_METJA RecName: Full=Uncharacterized protein MJ0726;
  109::156     7e-04  27%  188 aa  RNFB_THIDA RecName: Full=Electron transport complex protein rnfB;
  115::158     7e-04  36%  190 aa  RNFB_SERP5 RecName: Full=Electron transport complex protein rnfB;
  113::160     7e-04  33%  192 aa  RNFB_ERWCT RecName: Full=Electron transport complex protein
  114::168     7e-04  33%  168 aa  RNFB_BUCAP RecName: Full=Electron transport complex protein rnfB;
  114::157     7e-04  34%  186 aa  RNFB_ALHEH RecName: Full=Electron transport complex protein rnfB;
   11::61      7e-04  35%   81 aa  PSAC_THAPS RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      7e-04  35%   81 aa  PSAC_SKECO RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      7e-04  35%   81 aa  PSAC_PSINU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      7e-04  35%   82 aa  PSAC_ODOSI RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      7e-04  35%   81 aa  PSAC_NEPOL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      7e-04  37%   81 aa  PSAC_GRATL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      7e-04  37%   81 aa  PSAC_EMIHU RecName: Full=Photosystem I iron-sulfur center;AltName:
   54::107     7e-04  42%  192 aa  PHSB_SALTY RecName: Full=Thiosulfate reductase electron transport
   54::107     7e-04  42%  192 aa  PHSB_SALTI RecName: Full=Thiosulfate reductase electron transport
   59::113     7e-04  42%  159 aa  NUOI_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit I;    
   59::113     7e-04  42%  159 aa  NUOI_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   59::113     7e-04  42%  159 aa  NUOI_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   59::113     7e-04  42%  159 aa  NUOI_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   52::122     7e-04  40%  217 aa  NUOI_FRASC RecName: Full=NADH-quinone oxidoreductase subunit I;    
   52::122     7e-04  40%  220 aa  NUOI_FRAAA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   47::114     7e-04  37%  181 aa  NUOI_BLOFL RecName: Full=NADH-quinone oxidoreductase subunit I;    
   61::185     7e-04  30%  200 aa  NUOI1_STRAW RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
  368::429     0.001  36%  698 aa  RNFC_YERPY RecName: Full=Electron transport complex protein rnfC;
  368::429     0.001  36%  659 aa  RNFC_YERPN RecName: Full=Electron transport complex protein rnfC;
  368::429     0.001  36%  659 aa  RNFC_YERPG RecName: Full=Electron transport complex protein rnfC;
  368::429     0.001  36%  659 aa  RNFC_YERPB RecName: Full=Electron transport complex protein rnfC;
  368::429     0.001  36%  620 aa  RNFC_YERPA RecName: Full=Electron transport complex protein rnfC;
  368::429     0.001  36%  698 aa  RNFC_YERP3 RecName: Full=Electron transport complex protein rnfC;
  368::429     0.001  36%  697 aa  RNFC_YERE8 RecName: Full=Electron transport complex protein rnfC;
  370::429     0.001  38%  676 aa  RNFC_ECOSM RecName: Full=Electron transport complex protein rnfC;
  117::159     0.001  37%  192 aa  RNFB_KLEP3 RecName: Full=Electron transport complex protein
   11::61      0.001  35%   81 aa  PSAC_PSEAK RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      0.001  35%   81 aa  PSAC_PHAVU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      0.001  35%   81 aa  PSAC_PEA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      0.001  33%   81 aa  PSAC_LIRTU RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      0.001  33%   81 aa  PSAC_ILLOL RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      0.001  33%   81 aa  PSAC_DRIGR RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      0.001  35%   81 aa  PSAC_CUCSA RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      0.001  33%   81 aa  PSAC_CHLSC RecName: Full=Photosystem I iron-sulfur center;AltName:
   11::61      0.001  33%   81 aa  PSAC_CERDE RecName: Full=Photosystem I iron-sulfur center;AltName:
   34::113     0.001  34%  180 aa  NUOI_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   37::104     0.001  41%  171 aa  NUOI2_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
   66::127     0.001  38%  264 aa  NUOI2_ANADE RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
  937::985     0.001  33% 1009 aa  DPYD_DICDI RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
  379::500     0.001  28%  569 aa  CYSI_PSEA6 RecName: Full=Sulfite reductase [NADPH] hemoprotein
  439::510     0.001  28%  589 aa  CYSI_NEIM0 RecName: Full=Sulfite reductase [NADPH] hemoprotein
    1::326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLDINTKKLKKNAFRVTKRRGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTRQGFEIPGIDM
ASRC_SALTY      MSIDIDIIKARKNEYRLSKVRGEAMISVRIPGGILPAHLLTVARDIAETWGNGQIHLTTRQKLAMPGIRY
ASRC_SALTI      MSIDIDIIKARKNEYRLSKVRGEAMISVRIPGGILPAHLLTVARDIAETWGNGQIHLTTRQKLAMPGIRY
Y870_METJA      --------------------------RVRAPGGWYKPEEIKEILDIAEEY-NAKIKVTDRAGYELHGISG
Y551_METJA      ----------------IMKKDCYTL-RISLKPGFINAEQLKAIAYVIENFGDNKAHITTRQG-----IEF
DSRA_ARCFU      --------------------------RINQPSGWFSTKALRGLCDVWEKWGSGLTNFHGSTG------DI
NIR_MAIZE       ------------------KQEGLSYVGLHVPVGRLQAADMFELARLADEYGTGELRLTVEQNIVLPNVS-
Y514_METJA      ----------------------------------------------------------------------
SIR_SYNE7       --------------------------RLRSPGGYIPPQLYLTLDQLADDYGNGTLRATTRQAFQLHGILK
NIR_ORYSJ       ------------------KQEGMSYVGLHVPVGRVQAADMFELARLADEYGSGELRLTVEQNIVIPNVK-
NIR_BETVE       ------------------KQEGLSYVGLHIPVGRVQADDMDELARLADTYGCGELRLTVEQNIIIPNIE-
NIR_SYNE7       ------------------KQAGLNFVGLHVPVGRLTTEDLYELARLADTYGQGEVRLTVEQNVILTHIPD
NIR_SPIOL       ------------------KQQGLSFVGLHIPVGRLQADEMEELARIADVYGSGELRLTVEQNIIIPNVE-
NIR_ARATH       ----VNKQWERRDYFGVNKQEGLSFVGLHVPVGRLQADDMDELARLADTYGSGELRLTVEQNIIIPNV--
Y1303_METJA     ----------------------------------------------------------------------
NASD_BACSU      ----------------------------RMYGGVTNSTDLRKIADVVDKYEIPLVKMTGGQRIDLIGVKK
NIR_PHOLA       --------------------------RMRIPNGILTSGQIRVLAEVVERYGDGNADITTRPNLQLRGIRL
NIR_EMENI       ------------------QRNGTFSVVPRVPGGEITADKLIAIGQVAKKY-NLYCKITGGQRIDMFGARK
NDHI_SYNSC      ----------------------------------------------------------------------
NDHI_SYNS9      ----------------------------------------------------------------------
NDHI_SYNPX      ----------------------------------------------------------------------
HDRA_METAC      ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
NDHI_SYNP6      ----------------------------------------------------------------------
NDHI_SYNE7      ----------------------------------------------------------------------
FER2_THEAC      ----------------------------------------------------------------------
NDHI_SYNS3      ----------------------------------------------------------------------
NDHI_SYNPW      ----------------------------------------------------------------------
NDHI_PROMS      ----------------------------------------------------------------------
NDHI_PROMP      ----------------------------------------------------------------------
NDHI_PROMA      ----------------------------------------------------------------------
NDHI_PROM9      ----------------------------------------------------------------------
NDHI_PROM5      ----------------------------------------------------------------------
NDHI_PROM4      ----------------------------------------------------------------------
NDHI_PROM2      ----------------------------------------------------------------------
NDHI_PROM0      ----------------------------------------------------------------------
NDHI_PROMM      ----------------------------------------------------------------------
NDHI_PROM3      ----------------------------------------------------------------------
NDHI_PROMT      ----------------------------------------------------------------------
NDHI_PROM1      ----------------------------------------------------------------------
NDHI_HUPLU      ----------------------------------------------------------------------
NDHI_ANAVT      ----------------------------------------------------------------------
NDHI_ANASP      ----------------------------------------------------------------------
FDHL_BACSU      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
NDHI_OENEH      ----------------------------------------------------------------------
NDHI_GLOVI      ----------------------------------------------------------------------
FWDE_METJA      ----------------------------------------------------------------------
NDHI_ANGEV      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
SIR_SYNY3       --------------------------RTRNPGGLIPAQLYTALDDLSKTHGNQTLRVTTRQGLQIHGIVK
NIR_NEUCR       ------------------QRNGTFSVVPRVAAGEITPEKLIVIGEVAKEYNLYT-KITGGQRIDMFGAKK
NDHI_SYNY3      ----------------------------------------------------------------------
NDHI_PHYPA      ----------------------------------------------------------------------
NDHI_CYAP8      ----------------------------------------------------------------------
NDHI_VITVI      ----------------------------------------------------------------------
NDHI_SPIOL      ----------------------------------------------------------------------
NDHI_CYAP7      ----------------------------------------------------------------------
HDRA_METMA      ----------------------------------------------------------------------
NDHI_PSINU      ----------------------------------------------------------------------
NDHI_NEPOL      ----------------------------------------------------------------------
NDHI_CHAGL      ----------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
MVHB_METFE      ----------------------------------------------------------------------
HYCF_ECOLI      ----------------------------------------------------------------------
FRHG_METTH      ----------------------------------------------------------------------
CYSI_SERP5      --------------------------------------LKTGVAEIARIH-KGDFRLTANQNLIVAGV--
NUOI_CARHZ      ----------------------------------------------------------------------
DSRB_ARCFU      --------------------------------------------DIADKYSDGYLRWTSRNNVEFFVTDE
NDHI_SYNP2      ----------------------------------------------------------------------
NDHI_MORIN      ----------------------------------------------------------------------
NDHI_EUCGG      ----------------------------------------------------------------------
NDHI_CITSI      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAR      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
CYSI_YERPS      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
CYSI_YERPB      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
NDHI_PLEBO      ----------------------------------------------------------------------
NDHI_GOSHI      ----------------------------------------------------------------------
NDHI_GOSBA      ----------------------------------------------------------------------
ACDA1_METKA     ----------------------------------------------------------------------
PHF1_CLOPA      ----------------------------------------------------------------------
NDHI_ZYGCR      ----------------------------------------------------------------------
NDHI_MARPO      ----------------------------------------------------------------------
NDHI_CHLSC      ----------------------------------------------------------------------
MAUN_METEA      ----------------------------------------------------------------------
FDHL_STAHJ      ----------------------------------------------------------------------
PORD_PYRAB      ----------------------------------------------------------------------
NDHI_PSIGN      ----------------------------------------------------------------------
NDHI_PSAAN      ----------------------------------------------------------------------
NDHI_PIPCE      ----------------------------------------------------------------------
NDHI_PHABO      ----------------------------------------------------------------------
NDHI_MELLU      ----------------------------------------------------------------------
NDHI_MARCE      ----------------------------------------------------------------------
NDHI_INUBR      ----------------------------------------------------------------------
NDHI_HYMLE      ----------------------------------------------------------------------
NDHI_HELBG      ----------------------------------------------------------------------
NDHI_ENYSE      ----------------------------------------------------------------------
NDHI_CYAA5      ----------------------------------------------------------------------
NDHI_BLEZA      ----------------------------------------------------------------------
NDHI_ATHGP      ----------------------------------------------------------------------
NDHI_AMBTR      ----------------------------------------------------------------------
FER_CLOPE       ----------------------------------------------------------------------
CYSI_ENT38      ------------------------------PGRPLKTGLL----EIAKIH-KGEFRITANQNLIIAGVPE
CYSI_ALISL      --------------------------------------LKTGVAEIAKIH-QGDFRMTANQNLIVAGVEQ
NDHI_ZINJU      ----------------------------------------------------------------------
NDHI_ZEXSE      ----------------------------------------------------------------------
NDHI_ZALME      ----------------------------------------------------------------------
NDHI_WEDTE      ----------------------------------------------------------------------
NDHI_VILAC      ----------------------------------------------------------------------
NDHI_VERJA      ----------------------------------------------------------------------
NDHI_VARMX      ----------------------------------------------------------------------
NDHI_TRIPN      ----------------------------------------------------------------------
NDHI_TRIME      ----------------------------------------------------------------------
NDHI_TILBA      ----------------------------------------------------------------------
NDHI_TETRE      ----------------------------------------------------------------------
NDHI_TETOR      ----------------------------------------------------------------------
NDHI_TARER      ----------------------------------------------------------------------
NDHI_SYNNO      ----------------------------------------------------------------------
NDHI_STESO      ----------------------------------------------------------------------
NDHI_STERE      ----------------------------------------------------------------------
NDHI_STAPU      ----------------------------------------------------------------------
NDHI_SQUKU      ----------------------------------------------------------------------
NDHI_SPIUR      ----------------------------------------------------------------------
NDHI_SPHTR      ----------------------------------------------------------------------
NDHI_SMAMI      ----------------------------------------------------------------------
NDHI_SIGBL      ----------------------------------------------------------------------
NDHI_RUMPE      ----------------------------------------------------------------------
NDHI_RUDHI      ----------------------------------------------------------------------
NDHI_ROJSU      ----------------------------------------------------------------------
NDHI_RATCO      ----------------------------------------------------------------------
NDHI_POPTR      ----------------------------------------------------------------------
NDHI_POPAL      ----------------------------------------------------------------------
NDHI_PODEM      ----------------------------------------------------------------------
NDHI_PEUSC      ----------------------------------------------------------------------
NDHI_PEROV      ----------------------------------------------------------------------
NDHI_PERMO      ----------------------------------------------------------------------
NDHI_PERLI      ----------------------------------------------------------------------
NDHI_PERCD      ----------------------------------------------------------------------
NDHI_PALAR      ----------------------------------------------------------------------
NDHI_OXYSB      ----------------------------------------------------------------------
NDHI_OBLMI      ----------------------------------------------------------------------
NDHI_NEULO      ----------------------------------------------------------------------
NDHI_MONRV      ----------------------------------------------------------------------
NDHI_MONPA      ----------------------------------------------------------------------
NDHI_MONGR      ----------------------------------------------------------------------
NDHI_MILQU      ----------------------------------------------------------------------
NDHI_MICAN      ----------------------------------------------------------------------
NDHI_MELNV      ----------------------------------------------------------------------
NDHI_MADSA      ----------------------------------------------------------------------
NDHI_LUNJA      ----------------------------------------------------------------------
NDHI_LIPIN      ----------------------------------------------------------------------
NDHI_LASMA      ----------------------------------------------------------------------
NDHI_LAGRA      ----------------------------------------------------------------------
NDHI_KINPA      ----------------------------------------------------------------------
NDHI_IDIQU      ----------------------------------------------------------------------
NDHI_ICHTE      ----------------------------------------------------------------------
NDHI_HULAL      ----------------------------------------------------------------------
NDHI_HELAN      ----------------------------------------------------------------------
NDHI_GRERE      ----------------------------------------------------------------------
NDHI_GALQU      ----------------------------------------------------------------------
NDHI_GALPT      ----------------------------------------------------------------------
NDHI_FLOPE      ----------------------------------------------------------------------
NDHI_FLARA      ----------------------------------------------------------------------
NDHI_EUTPA      ----------------------------------------------------------------------
NDHI_ENCCL      ----------------------------------------------------------------------
NDHI_ECLPR      ----------------------------------------------------------------------
NDHI_EATNI      ----------------------------------------------------------------------
NDHI_DYSTE      ----------------------------------------------------------------------
NDHI_DYSMI      ----------------------------------------------------------------------
NDHI_DUGME      ----------------------------------------------------------------------
NDHI_DIMVE      ----------------------------------------------------------------------
NDHI_DIMHO      ----------------------------------------------------------------------
NDHI_DESFU      ----------------------------------------------------------------------
NDHI_DELBI      ----------------------------------------------------------------------
NDHI_DAMCA      ----------------------------------------------------------------------
NDHI_DAHCO      ----------------------------------------------------------------------
NDHI_CYMVE      ----------------------------------------------------------------------
NDHI_CONNE      ----------------------------------------------------------------------
NDHI_COFAR      ----------------------------------------------------------------------
NDHI_COETI      ----------------------------------------------------------------------
NDHI_CLIAL      ----------------------------------------------------------------------
NDHI_CHRHE      ----------------------------------------------------------------------
NDHI_CHAVU      ----------------------------------------------------------------------
NDHI_CHAST      ----------------------------------------------------------------------
NDHI_CHASO      ----------------------------------------------------------------------
NDHI_CALVA      ----------------------------------------------------------------------
NDHI_BEBJU      ----------------------------------------------------------------------
NDHI_BAHTO      ----------------------------------------------------------------------
NDHI_BAHAB      ----------------------------------------------------------------------
NDHI_ARNMO      ----------------------------------------------------------------------
NDHI_ARNDE      ----------------------------------------------------------------------
NDHI_APHJA      ----------------------------------------------------------------------
NDHI_ACAAU      ----------------------------------------------------------------------
FER_CLOSM       ----------------------------------------------------------------------
CYSI_YERPY      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
CYSI_YERPP      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
CYSI_YERPN      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
CYSI_YERPE      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
CYSI_YERPA      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
CYSI_YERP3      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
CYSI_YERE8      --------------------------------------LKTGVAEIAKIH-QGDFRLTANQNLIVAGVPE
CYSI_VIBPA      --------------------------------------LKTGVAEIAKIH-KGDFRMTANQNLIVAGVPK
YDHY_SHIFL      ----------------------------------------------------------------------
YDHY_ECOLI      ----------------------------------------------------------------------
YDHY_ECO57      ----------------------------------------------------------------------
NDHI_TRIBB      ----------------------------------------------------------------------
NDHI_SORBI      ----------------------------------------------------------------------
NDHI_SACOF      ----------------------------------------------------------------------
NDHI_SACHY      ----------------------------------------------------------------------
NDHI_ORYSJ      ----------------------------------------------------------------------
NDHI_ORYSI      ----------------------------------------------------------------------
NDHI_ORYSA      ----------------------------------------------------------------------
NDHI_ORYNI      ----------------------------------------------------------------------
NDHI_OLIPU      ----------------------------------------------------------------------
NDHI_NASOF      ----------------------------------------------------------------------
NDHI_MAIZE      ----------------------------------------------------------------------
NDHI_LOBMA      ----------------------------------------------------------------------
NDHI_LEPVR      ----------------------------------------------------------------------
NDHI_HOFFA      ----------------------------------------------------------------------
NDHI_DRIGR      ----------------------------------------------------------------------
NDHI_CRUWA      ----------------------------------------------------------------------
NDHI_CHAPD      ----------------------------------------------------------------------
NDHI_BARVE      ----------------------------------------------------------------------
FER_CLOST       ----------------------------------------------------------------------
ECM17_YEAST     -------------------------ARARLPGGKTTPQQWLALDHLSDTSGNGTLKLTTRATFQIHGVLK
DSVA_DESVH      --------------------------RVAQPSGYYSADYLRQLCDIWDLRGSGLTNMHGSTG------DI
YJGC_BACSU      ----------------------------------------------------------------------
PORD_PYRFU      ----------------------------------------------------------------------
NDHI_SOYBN      ----------------------------------------------------------------------
NDHI_RANMC      ----------------------------------------------------------------------
NDHI_RAIAR      ----------------------------------------------------------------------
NDHI_PELHO      ----------------------------------------------------------------------
NDHI_NANDO      ----------------------------------------------------------------------
NDHI_JASNU      ----------------------------------------------------------------------
NDHI_DIOEL      ----------------------------------------------------------------------
NDHI_CYAP4      ----------------------------------------------------------------------
NDHI_CUCSA      ----------------------------------------------------------------------
NDHI_CAPBU      ----------------------------------------------------------------------
NDHI_AGRST      ----------------------------------------------------------------------
FER_MEGEL       ----------------------------------------------------------------------
FER_CLOPA       ----------------------------------------------------------------------
FER_CLOBU       ----------------------------------------------------------------------
FER_CLOAC       ----------------------------------------------------------------------
CYSI_VIBHB      --------------------------------------LKTGVAEIAKIH-KGDFRMTANQNLIVAGVP-
CYSI_VIBFM      --------------------------------------LKTGVAEIAKVH-QGDFRMTANQNLIVAGVEQ
CYSI_VIBF1      --------------------------------------LKTGVAEIAKVH-QGDFRMTANQNLIVAGVEQ
Y51B_METJA      ----------------------------------------------------------------------
NDHI_VENCA      ----------------------------------------------------------------------
NDHI_TOBAC      ----------------------------------------------------------------------
NDHI_SOLTU      ----------------------------------------------------------------------
NDHI_SOLLC      ----------------------------------------------------------------------
NDHI_SOLBU      ----------------------------------------------------------------------
NDHI_SILPE      ----------------------------------------------------------------------
NDHI_RIEOB      ----------------------------------------------------------------------
NDHI_RENSL      ----------------------------------------------------------------------
NDHI_PSEAR      ----------------------------------------------------------------------
NDHI_POLCN      ----------------------------------------------------------------------
NDHI_PHIZI      ----------------------------------------------------------------------
NDHI_PARHY      ----------------------------------------------------------------------
NDHI_OTESC      ----------------------------------------------------------------------
NDHI_NICTO      ----------------------------------------------------------------------
NDHI_NICSY      ----------------------------------------------------------------------
NDHI_MONCO      ----------------------------------------------------------------------
NDHI_LOXSI      ----------------------------------------------------------------------
NDHI_LOTJA      ----------------------------------------------------------------------
NDHI_LAYHE      ----------------------------------------------------------------------
NDHI_LACSA      ----------------------------------------------------------------------
NDHI_JAUCA      ----------------------------------------------------------------------
NDHI_JAEHI      ----------------------------------------------------------------------
NDHI_HYMFF      ----------------------------------------------------------------------
NDHI_GUATU      ----------------------------------------------------------------------
NDHI_ERIST      ----------------------------------------------------------------------
NDHI_ERICN      ----------------------------------------------------------------------
NDHI_ENGPE      ----------------------------------------------------------------------
NDHI_DRANE      ----------------------------------------------------------------------
NDHI_DAUCA      ----------------------------------------------------------------------
NDHI_CALME      ----------------------------------------------------------------------
NDHI_ATRBE      ----------------------------------------------------------------------
NDHI_ARATH      ----------------------------------------------------------------------
NDHI_ARAHI      ----------------------------------------------------------------------
NDHI_AETGR      ----------------------------------------------------------------------
NDHI_AETCO      ----------------------------------------------------------------------
NDHI_ACOCL      ----------------------------------------------------------------------
NDHI_ACMRA      ----------------------------------------------------------------------
HMC2_DESVH      ----------------------------------------------------------------------
DSRA_CHRVI      --------------------------RVQPPAGHYTTAMLRQLADTWEKYGSGLITFHGQTG-NIMFIGV
CYSI_VIBCM      --------------------------------------LKTGVAEIAKVH-QGDFRMTANQNLIVAGVPA
CYSI_VIBCH      --------------------------------------LKTGVAEIAKVH-QGDFRMTANQNLIVAGVPA
CYSI_SALTI      ----------------------------------------------------------------------
CYSI_SALSV      ----------------------------------------------------------------------
CYSI_SALPC      ----------------------------------------------------------------------
CYSI_SALPB      ----------------------------------------------------------------------
CYSI_SALNS      ----------------------------------------------------------------------
CYSI_SALHS      ----------------------------------------------------------------------
CYSI_SALG2      ----------------------------------------------------------------------
CYSI_SALEP      ----------------------------------------------------------------------
CYSI_SALDC      ----------------------------------------------------------------------
CYSI_SALCH      ----------------------------------------------------------------------
CYSI_PHOLL      ------------------------------------------VAEIAKIH-KGDFRLTANQNLIIAGI--
CYSI_ENTS8      -----------------------------------DKPLKTGLKEIARIH-KGDFRLTANQNLIVAGV--
PORD_METJA      ----------------------------------------------------------------------
NIRB_ECOLI      ----------------------------RSPGGEITPEGLMAVGRIAREFNLYT-KITGSQRLAMFGAQK
NDHI_PLAOC      ----------------------------------------------------------------------
NDHI_PHODC      ----------------------------------------------------------------------
NDHI_PHAVU      ----------------------------------------------------------------------
FER_METTE       ----------------------------------------------------------------------
FER_ENTHI       ----------------------------------------------------------------------
FER6_METJA      ----------------------------------------------------------------------
CYSI_COLP3      -------------------------------GANSDSKALTGMREIAKIH-KGDFRLTANQNLIVAGVSA
SIR2_MYCPA      ----------------------YFMMRVRCDGGAISAAALRTLGQISVDFARDTADITDRENIQYHWIEV
PORD_PYRHO      ----------------------------------------------------------------------
NQO9_RHOMR      ----------------------------------------------------------------------
NDHI_MESVI      ----------------------------------------------------------------------
NDHI_CORPT      ----------------------------------------------------------------------
NDHI_CHLAT      ----------------------------------------------------------------------
NDHI_CALFG      ----------------------------------------------------------------------
NDHI_BUXMI      ----------------------------------------------------------------------
NDHI_ADICA      ----------------------------------------------------------------------
NDHI_ACAM1      ----------------------------------------------------------------------
IORA_ARCFU      ----------------------------------------------------------------------
FER_CLOTS       ----------------------------------------------------------------------
CYSI_SALTY      ----------------------------------------------------------------------
CYSI_SALPK      ----------------------------------------------------------------------
CYSI_SALPA      ----------------------------------------------------------------------
CYSI_SALA4      ----------------------------------------------------------------------
CYSI_PROMH      -----------------------------------NAPLKTGVAEIAKVHL-GDFRLTANQNLIVAGV--
CYSI_CITK8      ------------------------------PGRPLKTGLL----EIAKIH-KGEFRITANQNLIIAGVPE
VORD_PYRHO      ----------------------------------------------------------------------
VORD_PYRAB      ----------------------------------------------------------------------
NDHI_WHEAT      ----------------------------------------------------------------------
NDHI_THEEB      ----------------------------------------------------------------------
NDHI_PANGI      ----------------------------------------------------------------------
NDHI_NYMAL      ----------------------------------------------------------------------
NDHI_NUPAD      ----------------------------------------------------------------------
NDHI_LIRTU      ----------------------------------------------------------------------
NDHI_ILLOL      ----------------------------------------------------------------------
NDHI_HORVU      ----------------------------------------------------------------------
FERA_METJA      ----------------------------------------------------------------------
CYSI_VIBC3      --------------------------------------LKTGVAEIAKVH-QGDFRMTANQNLIVAGVP-
CYSI_SALAR      ----------------------------------------------------------------------
NDHI_AMBTC      ----------------------------------------------------------------------
NASB_BACSU      -------------------------------GGRTNAEQLRTIANIIEAYSIPDVSITHGQRLKLSGIKP
FER2_DESNO      ----------------------------------------------------------------------
FDNH_SHIFL      ----------------------------------------------------------------------
FDNH_ECOLI      ----------------------------------------------------------------------
RNFB_HAEDU      ----------------------------------------------------------------------
PHFL_DESVO      ----------------------------------------------------------------------
NUOI_SHEWM      ----------------------------------------------------------------------
NUOI_RHOSR      ----------------------------------------------------------------------
NUOI_RHOOB      ----------------------------------------------------------------------
NUOI_ENTS8      ----------------------------------------------------------------------
NUOI_BLOPB      ----------------------------------------------------------------------
NUOI1_SOLUE     ----------------------------------------------------------------------
CYSI_ZYMMO      ------------------------------------------IAEIAKVH-KGDFRLTANQNLIVAGVSE
CYSI_ECOSM      ----------------------------------------------------------------------
VORD_PYRFU      ----------------------------------------------------------------------
RNFB_SODGM      ----------------------------------------------------------------------
PSAC_EUGGR      ----------------------------------------------------------------------
PSAC_ANTFO      ----------------------------------------------------------------------
NUOI_RHOE4      ----------------------------------------------------------------------
NUOI2_ACIBL     ----------------------------------------------------------------------
NUOI1_SYNFM     ----------------------------------------------------------------------
NIRB_KLEOX      ----------------------------RMAAGEVTPDGLIAIGQIAKRYQLYS-KVTGGQRIDLFGARL
NDHI_TRIEI      ----------------------------------------------------------------------
CYSI_SODGM      -----------------------------------DRTLKTGLAEIARRH-KGDFRLTANQNLIIAGVDK
CYSI_KLEP7      ----------------------------------------------------------------------
CYSI_ERWCT      ----------------------------------------------------------------------
CYSI_BAUCH      -------------------------------------KLKTGMLEIARIH-QGDFRITANQNIIIAGVE-
VHCB_METVO      ----------------------------------------------------------------------
SIR_DESVH       ----------------------------RTPCGLLTPDVLDAVSRVCRKYEVPIIKITSGQRLALVGMKK
RNFB_TOLAT      ----------------------------------------------------------------------
PSAC_PINKO      ----------------------------------------------------------------------
PSAC_DIOEL      ----------------------------------------------------------------------
PSAC_CYCTA      ----------------------------------------------------------------------
NUOI_MYCA1      ----------------------------------------------------------------------
NUOI2_MYCPA     ----------------------------------------------------------------------
NUOI1_MYCPA     ----------------------------------------------------------------------
NDHI_ANTFO      ----------------------------------------------------------------------
MAUN_PARDP      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
FDXH_HAEIN      ----------------------------------------------------------------------
CYSI_SHESR      --------------------------RARVPGGVCTPKQWLGVDEIASTLSSNSIRLTTRQTFQYHGIP-
CYSI_SHESM      --------------------------RARVPGGVCTPKQWLGVDEIASTLSSNSIRLTTRQTFQYHGIP-
CYSI_SHESA      --------------------------RARVPGGVCTPKQWLGVDEIASTLSSNSIRLTTRQTFQYHGIP-
CYSI_SHEON      --------------------------RARVPGGVCTPKQWLGVDEIASTLSSNSIRLTTRQTFQYHGIP-
CYSI_PSEHT      -----------------------------------DKPLKTGCRKIAEVH-QGDMRMTANQNLIIAGV--
CYSI_KLEP3      ----------------------------------------------------------------------
CYSI_BLOFL      ------------------------------------------LSEIAKVHS-GFFRITTNQNLIIS----
Y934_METJA      ----------------------------------------------------------------------
Y51A_METJA      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
RNFC_RHOCA      ----------------------------------------------------------------------
RNFB_SHISS      ----------------------------------------------------------------------
RNFB_SHIDS      ----------------------------------------------------------------------
RNFB_SHIB3      ----------------------------------------------------------------------
RNFB_SALTY      ----------------------------------------------------------------------
RNFB_SALTI      ----------------------------------------------------------------------
RNFB_SALSV      ----------------------------------------------------------------------
RNFB_SALPK      ----------------------------------------------------------------------
RNFB_SALPC      ----------------------------------------------------------------------
RNFB_SALPB      ----------------------------------------------------------------------
RNFB_SALPA      ----------------------------------------------------------------------
RNFB_SALNS      ----------------------------------------------------------------------
RNFB_SALHS      ----------------------------------------------------------------------
RNFB_SALG2      ----------------------------------------------------------------------
RNFB_SALEP      ----------------------------------------------------------------------
RNFB_SALDC      ----------------------------------------------------------------------
RNFB_SALCH      ----------------------------------------------------------------------
RNFB_SALAR      ----------------------------------------------------------------------
RNFB_SALA4      ----------------------------------------------------------------------
RNFB_ECOUT      ----------------------------------------------------------------------
RNFB_ECOSM      ----------------------------------------------------------------------
RNFB_ECOSE      ----------------------------------------------------------------------
RNFB_ECOLU      ----------------------------------------------------------------------
RNFB_ECOLI      ----------------------------------------------------------------------
RNFB_ECOLC      ----------------------------------------------------------------------
RNFB_ECOL6      ----------------------------------------------------------------------
RNFB_ECOL5      ----------------------------------------------------------------------
RNFB_ECOK1      ----------------------------------------------------------------------
RNFB_ECOHS      ----------------------------------------------------------------------
RNFB_ECODH      ----------------------------------------------------------------------
RNFB_ECOBW      ----------------------------------------------------------------------
RNFB_ECO8A      ----------------------------------------------------------------------
RNFB_ECO81      ----------------------------------------------------------------------
RNFB_ECO7I      ----------------------------------------------------------------------
RNFB_ECO5E      ----------------------------------------------------------------------
RNFB_ECO57      ----------------------------------------------------------------------
RNFB_ECO55      ----------------------------------------------------------------------
RNFB_ECO45      ----------------------------------------------------------------------
RNFB_ECO27      ----------------------------------------------------------------------
RNFB_ECO24      ----------------------------------------------------------------------
RNFB_BUCAT      ----------------------------------------------------------------------
RNFB_BUCAI      ----------------------------------------------------------------------
RNFB_BUCA5      ----------------------------------------------------------------------
PSAC_RHDSA      ----------------------------------------------------------------------
PSAC_NOSS9      ----------------------------------------------------------------------
PSAC_NOSS8      ----------------------------------------------------------------------
PSAC_NOSP7      ----------------------------------------------------------------------
PSAC_MICAN      ----------------------------------------------------------------------
PSAC_FREDI      ----------------------------------------------------------------------
PSAC_ANAVT      ----------------------------------------------------------------------
PSAC_ANASP      ----------------------------------------------------------------------
NUOI_COXBU      ----------------------------------------------------------------------
NUOI_COXBR      ----------------------------------------------------------------------
NUOI_COXBN      ----------------------------------------------------------------------
NUOI_ACIAD      ----------------------------------------------------------------------
NDHI_SYNJA      ----------------------------------------------------------------------
FER_CLOTM       ----------------------------------------------------------------------
FER7_METJA      ----------------------------------------------------------------------
FER3_RHISN      ----------------------------------------------------------------------
FER2_METJA      ----------------------------------------------------------------------
CYSI_VIBVU      --------------------------------------LKTGVAEIAKIH-KGDFRMTANQNLIVAG---
ACDA_METJA      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
SIR_MYCTU       ----------------------YFMMRVRCDGGALSAAALRTLGQISTEFARDTADISDRQNVQYHWIEV
SIR_MYCBO       ----------------------YFMMRVRCDGGALSAAALRTLGQISTEFARDTADISDRQNVQYHWIEV
RNFB_VIBHB      ----------------------------------------------------------------------
RNFB_SHIFL      ----------------------------------------------------------------------
RNFB_SHIBS      ----------------------------------------------------------------------
RNFB_RHOCA      ----------------------------------------------------------------------
RNFB_ESCF3      ----------------------------------------------------------------------
RNFB_CITK8      ----------------------------------------------------------------------
RNFB_BUCBP      ----------------------------------------------------------------------
PSAC_SYNY3      ----------------------------------------------------------------------
PSAC_PROM9      ----------------------------------------------------------------------
PSAC_PROM4      ----------------------------------------------------------------------
PSAC_MARPO      ----------------------------------------------------------------------
PSAC_CYAP8      ----------------------------------------------------------------------
PSAC_CYAP7      ----------------------------------------------------------------------
NUOI_SHISS      ----------------------------------------------------------------------
NUOI_SHIFL      ----------------------------------------------------------------------
NUOI_SHIF8      ----------------------------------------------------------------------
NUOI_SHIDS      ----------------------------------------------------------------------
NUOI_SHIBS      ----------------------------------------------------------------------
NUOI_SHEON      ----------------------------------------------------------------------
NUOI_SALTY      ----------------------------------------------------------------------
NUOI_SALTI      ----------------------------------------------------------------------
NUOI_SALPA      ----------------------------------------------------------------------
NUOI_SALCH      ----------------------------------------------------------------------
NUOI_MYCGI      ----------------------------------------------------------------------
NUOI_ERWT9      ----------------------------------------------------------------------
NUOI_ERWCT      ----------------------------------------------------------------------
NUOI_ECOUT      ----------------------------------------------------------------------
NUOI_ECOLI      ----------------------------------------------------------------------
NUOI_ECOL6      ----------------------------------------------------------------------
NUOI_ECOL5      ----------------------------------------------------------------------
NUOI_ECOK1      ----------------------------------------------------------------------
NUOI_ECO57      ----------------------------------------------------------------------
NUOI_ACIBY      ----------------------------------------------------------------------
NUOI_ACIBT      ----------------------------------------------------------------------
NUOI_ACIBS      ----------------------------------------------------------------------
NUOI_ACIBC      ----------------------------------------------------------------------
NUOI2_RHOS4     ----------------------------------------------------------------------
NUOI2_RHOS1     ----------------------------------------------------------------------
NDHI_SYNJB      ----------------------------------------------------------------------
FER1_RHORU      ----------------------------------------------------------------------
CYSI_SHIFL      ----------------------------------------------------------------------
CYSI_SHIF8      ----------------------------------------------------------------------
Y1684_METTH     ----------------------------------------------------------------------
RNFB_VIBSL      ----------------------------------------------------------------------
RNFB_VIBPA      ----------------------------------------------------------------------
RNFB_RHOS4      ----------------------------------------------------------------------
RNFB_RHOS1      ----------------------------------------------------------------------
RNFB_HAEIN      ----------------------------------------------------------------------
RNFB_HAEIE      ----------------------------------------------------------------------
RNFB_HAEI8      ----------------------------------------------------------------------
RNFB_AERS4      ----------------------------------------------------------------------
RNFB_AERHH      ----------------------------------------------------------------------
PSAC_ZYGCR      ----------------------------------------------------------------------
PSAC_WHEAT      ----------------------------------------------------------------------
PSAC_VITVI      ----------------------------------------------------------------------
PSAC_TOBAC      ----------------------------------------------------------------------
PSAC_STAPU      ----------------------------------------------------------------------
PSAC_SPIOL      ----------------------------------------------------------------------
PSAC_SOYBN      ----------------------------------------------------------------------
PSAC_SORBI      ----------------------------------------------------------------------
PSAC_SOLTU      ----------------------------------------------------------------------
PSAC_SOLLC      ----------------------------------------------------------------------
PSAC_SOLBU      ----------------------------------------------------------------------
PSAC_SECCE      ----------------------------------------------------------------------
PSAC_SACOF      ----------------------------------------------------------------------
PSAC_SACHY      ----------------------------------------------------------------------
PSAC_PSEPI      ----------------------------------------------------------------------
PSAC_POPTR      ----------------------------------------------------------------------
PSAC_POPAL      ----------------------------------------------------------------------
PSAC_PLAOC      ----------------------------------------------------------------------
PSAC_PIPCE      ----------------------------------------------------------------------
PSAC_PHAAO      ----------------------------------------------------------------------
PSAC_PELHO      ----------------------------------------------------------------------
PSAC_PANGI      ----------------------------------------------------------------------
PSAC_ORYSJ      ----------------------------------------------------------------------
PSAC_ORYSI      ----------------------------------------------------------------------
PSAC_ORYSA      ----------------------------------------------------------------------
PSAC_ORYNI      ----------------------------------------------------------------------
PSAC_OLIPU      ----------------------------------------------------------------------
PSAC_OENEH      ----------------------------------------------------------------------
PSAC_NYMAL      ----------------------------------------------------------------------
PSAC_NICTO      ----------------------------------------------------------------------
PSAC_NICSY      ----------------------------------------------------------------------
PSAC_NASOF      ----------------------------------------------------------------------
PSAC_NANDO      ----------------------------------------------------------------------
PSAC_MORIN      ----------------------------------------------------------------------
PSAC_MASLA      ----------------------------------------------------------------------
PSAC_LOTJA      ----------------------------------------------------------------------
PSAC_LOLPR      ----------------------------------------------------------------------
PSAC_LOBMA      ----------------------------------------------------------------------
PSAC_LEPVR      ----------------------------------------------------------------------
PSAC_LACSA      ----------------------------------------------------------------------
PSAC_JASNU      ----------------------------------------------------------------------
PSAC_IPOPU      ----------------------------------------------------------------------
PSAC_HORVU      ----------------------------------------------------------------------
PSAC_HELAN      ----------------------------------------------------------------------
PSAC_GOSHI      ----------------------------------------------------------------------
PSAC_GOSBA      ----------------------------------------------------------------------
PSAC_EUCGG      ----------------------------------------------------------------------
PSAC_DRANE      ----------------------------------------------------------------------
PSAC_DAUCA      ----------------------------------------------------------------------
PSAC_CUSRE      ----------------------------------------------------------------------
PSAC_CUSOB      ----------------------------------------------------------------------
PSAC_CUSGR      ----------------------------------------------------------------------
PSAC_CUSEX      ----------------------------------------------------------------------
PSAC_CRUWA      ----------------------------------------------------------------------
PSAC_COFAR      ----------------------------------------------------------------------
PSAC_CITSI      ----------------------------------------------------------------------
PSAC_CHAVU      ----------------------------------------------------------------------
PSAC_CHAGL      ----------------------------------------------------------------------
PSAC_CAPBU      ----------------------------------------------------------------------
PSAC_CALFG      ----------------------------------------------------------------------
PSAC_BUXMI      ----------------------------------------------------------------------
PSAC_BARVE      ----------------------------------------------------------------------
PSAC_ATRBE      ----------------------------------------------------------------------
PSAC_ARATH      ----------------------------------------------------------------------
PSAC_ARAHI      ----------------------------------------------------------------------
PSAC_AMBTC      ----------------------------------------------------------------------
PSAC_AGRST      ----------------------------------------------------------------------
PSAC_AETGR      ----------------------------------------------------------------------
PSAC_AETCO      ----------------------------------------------------------------------
PSAC_AEGTA      ----------------------------------------------------------------------
PSAC_ACOCL      ----------------------------------------------------------------------
PHFL_DESVH      ----------------------------------------------------------------------
NUOI_AERHH      ----------------------------------------------------------------------
NUOI2_AQUAE     ----------------------------------------------------------------------
FER_PYRIL       ----------------------------------------------------------------------
CYSI_VIBVY      --------------------------------------LKTGVAEIAKIH-KGDFRMTANQNLIVAG---
CYSI_SHISS      ----------------------------------------------------------------------
CYSI_SHIDS      ----------------------------------------------------------------------
CYSI_SHIBS      ----------------------------------------------------------------------
CYSI_SHIB3      ----------------------------------------------------------------------
CYSI_NEIMA      -------------------------------------QLLTGVLEIAKIH-KGDFRITANQNLIVA----
CYSI_ESCF3      ----------------------------------------------------------------------
CYSI_ECOUT      ----------------------------------------------------------------------
CYSI_ECOSE      ----------------------------------------------------------------------
CYSI_ECOLU      ----------------------------------------------------------------------
CYSI_ECOLI      ----------------------------------------------------------------------
CYSI_ECOLC      ----------------------------------------------------------------------
CYSI_ECOL6      ----------------------------------------------------------------------
CYSI_ECOL5      ----------------------------------------------------------------------
CYSI_ECOK1      ----------------------------------------------------------------------
CYSI_ECOHS      ----------------------------------------------------------------------
CYSI_ECOBW      ----------------------------------------------------------------------
CYSI_ECO8A      ----------------------------------------------------------------------
CYSI_ECO81      ----------------------------------------------------------------------
CYSI_ECO7I      ----------------------------------------------------------------------
CYSI_ECO5E      ----------------------------------------------------------------------
CYSI_ECO57      ----------------------------------------------------------------------
CYSI_ECO55      ----------------------------------------------------------------------
CYSI_ECO45      ----------------------------------------------------------------------
CYSI_ECO27      ----------------------------------------------------------------------
CYSI_ECO24      ----------------------------------------------------------------------
CYSI_BLOPB      --------------------------RCRLPGGVIMPQQWLAIDDFSEKYTYGTIRLTTRQTFQLHGLLK
RNFC_SERP5      ----------------------------------------------------------------------
RNFB_VIBVY      ----------------------------------------------------------------------
RNFB_VIBVU      ----------------------------------------------------------------------
PSAC_TRIEI      ----------------------------------------------------------------------
PSAC_THEVL      ----------------------------------------------------------------------
PSAC_THEEB      ----------------------------------------------------------------------
PSAC_SYNEN      ----------------------------------------------------------------------
PSAC_PROMT      ----------------------------------------------------------------------
PSAC_PROM1      ----------------------------------------------------------------------
PSAC_PINTH      ----------------------------------------------------------------------
PSAC_PHYPA      ----------------------------------------------------------------------
PSAC_PHATR      ----------------------------------------------------------------------
PSAC_OLTVI      ----------------------------------------------------------------------
PSAC_MAIZE      ----------------------------------------------------------------------
PSAC_LEPTE      ----------------------------------------------------------------------
PSAC_HUPLU      ----------------------------------------------------------------------
PSAC_GUITH      ----------------------------------------------------------------------
PSAC_CYAP4      ----------------------------------------------------------------------
PSAC_CYACA      ----------------------------------------------------------------------
PSAC_CYAA5      ----------------------------------------------------------------------
PSAC_CHLVU      ----------------------------------------------------------------------
PSAC_ANGEV      ----------------------------------------------------------------------
PSAC_ADICA      ----------------------------------------------------------------------
PSAC_ACAM1      ----------------------------------------------------------------------
NUOI_YERPY      ----------------------------------------------------------------------
NUOI_YERPS      ----------------------------------------------------------------------
NUOI_YERPP      ----------------------------------------------------------------------
NUOI_YERPN      ----------------------------------------------------------------------
NUOI_YERPG      ----------------------------------------------------------------------
NUOI_YERPE      ----------------------------------------------------------------------
NUOI_YERPB      ----------------------------------------------------------------------
NUOI_YERPA      ----------------------------------------------------------------------
NUOI_YERP3      ----------------------------------------------------------------------
NUOI_PSEU2      ----------------------------------------------------------------------
NUOI_PSESM      ----------------------------------------------------------------------
NUOI_PSEPK      ----------------------------------------------------------------------
NUOI_PSEPF      ----------------------------------------------------------------------
NUOI_PSEFL      ----------------------------------------------------------------------
NUOI_PSEF5      ----------------------------------------------------------------------
NUOI_PSEE4      ----------------------------------------------------------------------
NUOI_PSEAE      ----------------------------------------------------------------------
NUOI_PSEAB      ----------------------------------------------------------------------
NUOI_PSEA8      ----------------------------------------------------------------------
NUOI_PSEA7      ----------------------------------------------------------------------
NUOI_PSE14      ----------------------------------------------------------------------
NUOI_PELPD      ----------------------------------------------------------------------
NUOI_MYCVP      ----------------------------------------------------------------------
NUOI_MYCUA      ----------------------------------------------------------------------
NUOI_MYCTU      ----------------------------------------------------------------------
NUOI_MYCTA      ----------------------------------------------------------------------
NUOI_MYCMM      ----------------------------------------------------------------------
NUOI_MYCBT      ----------------------------------------------------------------------
NUOI_MYCBP      ----------------------------------------------------------------------
NUOI_MYCBO      ----------------------------------------------------------------------
NUOI_EDWI9      ----------------------------------------------------------------------
NUOI_ANADF      ----------------------------------------------------------------------
NUOI_AERS4      ----------------------------------------------------------------------
NUOI_ACIC1      ----------------------------------------------------------------------
IORA_PYRAB      ----------------------------------------------------------------------
FER3_PLEBO      ----------------------------------------------------------------------
DSVB_DESVH      --------------------------------------------DIADKYCGGHLRFTTRNNVEFMVAD-
RNFB_PECCP      ----------------------------------------------------------------------
PSAC_SYNSC      ----------------------------------------------------------------------
PSAC_SYNS9      ----------------------------------------------------------------------
PSAC_SYNS3      ----------------------------------------------------------------------
PSAC_SYNR3      ----------------------------------------------------------------------
PSAC_SYNPZ      ----------------------------------------------------------------------
PSAC_SYNPX      ----------------------------------------------------------------------
PSAC_SYNPW      ----------------------------------------------------------------------
PSAC_SYNP2      ----------------------------------------------------------------------
PSAC_STIHE      ----------------------------------------------------------------------
PSAC_PROMS      ----------------------------------------------------------------------
PSAC_PROMP      ----------------------------------------------------------------------
PSAC_PROMA      ----------------------------------------------------------------------
PSAC_PROM5      ----------------------------------------------------------------------
PSAC_PROM2      ----------------------------------------------------------------------
PSAC_PROM0      ----------------------------------------------------------------------
PSAC_PORYE      ----------------------------------------------------------------------
PSAC_PORPU      ----------------------------------------------------------------------
PSAC_OSTTA      ----------------------------------------------------------------------
PSAC_MESVI      ----------------------------------------------------------------------
PSAC_CYAME      ----------------------------------------------------------------------
PSAC_CHLRE      ----------------------------------------------------------------------
NUOI_YERE8      ----------------------------------------------------------------------
NUOI_TOLAT      ----------------------------------------------------------------------
NUOI_MYCS2      ----------------------------------------------------------------------
NUOI_CHRSD      ----------------------------------------------------------------------
NUOHI_NOCFA     ----------------------------------------------------------------------
NUOG2_RHIME     ----------------------------------------------------------------------
NDUS8_NEUCR     ----------------------------------------------------------------------
HDRA_METTM      ----------------------------------------------------------------------
HDRA_METTH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
FER3_ANASP      ----------------------------------------------------------------------
FDOH_SHIFL      ----------------------------------------------------------------------
FDOH_ECOLI      ----------------------------------------------------------------------
FDOH_ECOL6      ----------------------------------------------------------------------
CYSI_SHEDO      --------------------------------------LQTGLREIAKIH-KGDFRMTSNQNMIIAGVAA
CYSI_MANSM      -----------------------------------DLPLMTGMLELAKVH-KGDFRITANQNIIIANVDK
YJJW_ECOLI      ----------------------------------------------------------------------
Y726_METJA      ----------------------------------------------------------------------
RNFB_THIDA      ----------------------------------------------------------------------
RNFB_SERP5      ----------------------------------------------------------------------
RNFB_ERWCT      ----------------------------------------------------------------------
RNFB_BUCAP      ----------------------------------------------------------------------
RNFB_ALHEH      ----------------------------------------------------------------------
PSAC_THAPS      ----------------------------------------------------------------------
PSAC_SKECO      ----------------------------------------------------------------------
PSAC_PSINU      ----------------------------------------------------------------------
PSAC_ODOSI      ----------------------------------------------------------------------
PSAC_NEPOL      ----------------------------------------------------------------------
PSAC_GRATL      ----------------------------------------------------------------------
PSAC_EMIHU      ----------------------------------------------------------------------
PHSB_SALTY      ----------------------------------------------------------------------
PHSB_SALTI      ----------------------------------------------------------------------
NUOI_NEIMF      ----------------------------------------------------------------------
NUOI_NEIMB      ----------------------------------------------------------------------
NUOI_NEIMA      ----------------------------------------------------------------------
NUOI_NEIG1      ----------------------------------------------------------------------
NUOI_FRASC      ----------------------------------------------------------------------
NUOI_FRAAA      ----------------------------------------------------------------------
NUOI_BLOFL      ----------------------------------------------------------------------
NUOI1_STRAW     ----------------------------------------------------------------------
RNFC_YERPY      ----------------------------------------------------------------------
RNFC_YERPN      ----------------------------------------------------------------------
RNFC_YERPG      ----------------------------------------------------------------------
RNFC_YERPB      ----------------------------------------------------------------------
RNFC_YERPA      ----------------------------------------------------------------------
RNFC_YERP3      ----------------------------------------------------------------------
RNFC_YERE8      ----------------------------------------------------------------------
RNFC_ECOSM      ----------------------------------------------------------------------
RNFB_KLEP3      ----------------------------------------------------------------------
PSAC_PSEAK      ----------------------------------------------------------------------
PSAC_PHAVU      ----------------------------------------------------------------------
PSAC_PEA        ----------------------------------------------------------------------
PSAC_LIRTU      ----------------------------------------------------------------------
PSAC_ILLOL      ----------------------------------------------------------------------
PSAC_DRIGR      ----------------------------------------------------------------------
PSAC_CUCSA      ----------------------------------------------------------------------
PSAC_CHLSC      ----------------------------------------------------------------------
PSAC_CERDE      ----------------------------------------------------------------------
NUOI_BUCBP      ----------------------------------------------------------------------
NUOI2_RHOPB     ----------------------------------------------------------------------
NUOI2_ANADE     ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
CYSI_PSEA6      --------------------------------------------EIAKIH-DGDFRLTANQNLIVAGVS-
CYSI_NEIM0      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDIPEVNKKLQPIIEALEINQENPGDGYNAAGTRNVSACIGNNVCPFANYNTTNFAKKIEKAIFPNDLHF
ASRC_SALTY      EDIDNVNAALEPFLREIEIELEDTKAGYLAIGGRNIVACQGNRICQKANTDTTGLSRRLEKLVYPSPYHL
ASRC_SALTI      EDIDNVNAALEPFLREIEIELEDTKAGYLAIGGRNIVACQGNRICQKANTDTTGLSRRLEKLVYPSPYHL
Y870_METJA      FDVEDI---------VLRLREKGLLTGSEGPLVRATLACPGGGNCSSGLVDTTELARIIEDNFKPAPYKF
Y551_METJA      KISPEHLEEVEKILNNVGLNLGSTGNR-----VRQVVSCIGLE-CYNAIGDSVSLARRIHEEFVPRKV--
DSRA_ARCFU      IFLGTRSEYLQPCFEDLG-NLEIPFDGGSGSDLRTPSACMGPALCEFACYDTLELCYDLTMT-YQDELHF
NIR_MAIZE       ------NERLDALL-AEPLLQEQRLSPRPSMLLRGLVACTGNQFCGQAIIETLQVAREVEKRVAPVRMHW
Y514_METJA      ------------------------------------NTCIKCGIC--ARFCPTNAIKAVRRKSIEVNLDL
SIR_SYNE7       RDLKTVIRRI----------VENLGSTISACGNRNVMA--------------------------------
NIR_ORYSJ       ------NEKVEALLSEPLLQKFSPQPSLLLKG---LVACTGNQFCGQAIIETKQRASQVEKLVVPRAV--
NIR_BETVE       ------NSKLEALLEPLLKDRFSPEPPILMKG---LVACTGNQFCGQAIIETKARALKVTEEVRPVRMHW
NIR_SYNE7       AQLPTL--LAEPLLTRFSPQP--------APLSRGTVSCTGSQYCNFALIETKQRAIAIAQSLEAEDLPV
NIR_SPIOL       ------NSKIDSLLEPLLKERYSPEPPILMKG---LVACTGSQFCGQAIIETKARALKVTEEVRPVRMHW
NIR_ARATH       ----ETSKTEALLQEPFLKNRFSPEPSILMKG---LVACTGSQFCGQAIIETKLRALKVTEEVVPRPI--
Y1303_METJA     ----------------------------------------------------------------------
NASD_BACSU      EDLPKVWEDL------------DMPSGYAYGKTRTVKTCVGEQFCRFGTQDSMALGIALEKKFEGNTPHV
NIR_PHOLA       EDIPDIFRRFQAGLTSIQSGMDN---------VRNITGSPVAGIDADELIDTRGLVRKVQDMITNNPRKF
NIR_EMENI       QDLLDIWTEL------VDAGMES-GHAY-AKSLRTVKSCVGTTWCRFGVGDSVGMAIRLEQRYIRAPHKF
NDHI_SYNSC      ----------------------------------------------------------------------
NDHI_SYNS9      ----------------------------------------------------------------------
NDHI_SYNPX      ----------------------------------------------------------------------
HDRA_METAC      ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
NDHI_SYNP6      ----------------------------------------------------------------------
NDHI_SYNE7      ----------------------------------------------------------------------
FER2_THEAC      ----------------------------------------------------------------------
NDHI_SYNS3      ----------------------------------------------------------------------
NDHI_SYNPW      ----------------------------------------------------------------------
NDHI_PROMS      ----------------------------------------------------------------------
NDHI_PROMP      ----------------------------------------------------------------------
NDHI_PROMA      ----------------------------------------------------------------------
NDHI_PROM9      ----------------------------------------------------------------------
NDHI_PROM5      ----------------------------------------------------------------------
NDHI_PROM4      ----------------------------------------------------------------------
NDHI_PROM2      ----------------------------------------------------------------------
NDHI_PROM0      ----------------------------------------------------------------------
NDHI_PROMM      ----------------------------------------------------------------------
NDHI_PROM3      ----------------------------------------------------------------------
NDHI_PROMT      ----------------------------------------------------------------------
NDHI_PROM1      ----------------------------------------------------------------------
NDHI_HUPLU      ----------------------------------------------------------------------
NDHI_ANAVT      ----------------------------------------------------------------------
NDHI_ANASP      ----------------------------------------------------------------------
FDHL_BACSU      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
NDHI_OENEH      ----------------------------------------------------------------------
NDHI_GLOVI      ----------------------------------------------------------------------
FWDE_METJA      ----------------------------------------------------------------------
NDHI_ANGEV      ----------------------------------------------------------------------
FDHL_STAS1      ----------------------------------------------------------------------
SIR_SYNY3       KDL-------------------------------------------------------------------
NIR_NEUCR       QDLLKIWKKL------VDAGMES-GHAY-AKSLRTVKSCVGTTWCRYGVGDSVGMAVRLEERYLRGPHKI
NDHI_SYNY3      ----------------------------------------------------------------------
NDHI_PHYPA      ----------------------------------------------------------------------
NDHI_CYAP8      ----------------------------------------------------------------------
NDHI_VITVI      ----------------------------------------------------------------------
NDHI_SPIOL      ----------------------------------------------------------------------
NDHI_CYAP7      ----------------------------------------------------------------------
HDRA_METMA      ----------------------------------------------------------------------
NDHI_PSINU      ----------------------------------------------------------------------
NDHI_NEPOL      ----------------------------------------------------------------------
NDHI_CHAGL      ----------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
MVHB_METFE      ---------------------------------------------------------------------F
HYCF_ECOLI      ----------------------------------------------------------------------
FRHG_METTH      ----------------------------------------------------------------------
CYSI_SERP5      ---PESEKAK---IEALARDHGLIDDGVSVQ-RQNSMACVSFPTCPLAMAEAERFVTKVEGILHRHDEHI
NUOI_CARHZ      ----------------------------------------------------------------------
DSRB_ARCFU      SKIDDLINEVQ---ERVGFPCGGTWDAVKGEGLSNIVHTQGWIHCHTPAIDASGIVKAVMDELYEYFTDH
NDHI_SYNP2      ----------------------------------------------------------------------
NDHI_MORIN      ----------------------------------------------------------------------
NDHI_EUCGG      ----------------------------------------------------------------------
NDHI_CITSI      ----------------------------------------------------------------------
FDHL_STAAW      ----------------------------------------------------------------------
FDHL_STAAS      ----------------------------------------------------------------------
FDHL_STAAR      ----------------------------------------------------------------------
FDHL_STAAN      ----------------------------------------------------------------------
FDHL_STAAM      ----------------------------------------------------------------------
FDHL_STAAC      ----------------------------------------------------------------------
FDHL_STAAB      ----------------------------------------------------------------------
FDHL_STAA8      ----------------------------------------------------------------------
FDHL_STAA3      ----------------------------------------------------------------------
CYSI_YERPS      KD--------KARIEALA-REHGLMDDHVTSQRENSMACVSFPTCPLAMAEAERFVTRVEGILQQHGLHI
CYSI_YERPB      KD--------KARIEALA-REHGLMDDHVTSQRENSMACVSFPTCPLAMAEAERFVTRVEGILQQHGLHI
NDHI_PLEBO      ----------------------------------------------------------------------
NDHI_GOSHI      ----------------------------------------------------------------------
NDHI_GOSBA      ----------------------------------------------------------------------
ACDA1_METKA     ----------------------------------------------------------------------
PHF1_CLOPA      ----------------------------------------------------------------------
NDHI_ZYGCR      ----------------------------------------------------------------------
NDHI_MARPO      ----------------------------------------------------------------------
NDHI_CHLSC      ----------------------------------------------------------------------
MAUN_METEA      ----------------------------------------------------------------------
FDHL_STAHJ      ----------------------------------------------------------------------
PORD_PYRAB      ----------------------------------------------------------------------
NDHI_PSIGN      ----------------------------------------------------------------------
NDHI_PSAAN      ----------------------------------------------------------------------
NDHI_PIPCE      ----------------------------------------------------------------------
NDHI_PHABO      ----------------------------------------------------------------------
NDHI_MELLU      ----------------------------------------------------------------------
NDHI_MARCE      ----------------------------------------------------------------------
NDHI_INUBR      ----------------------------------------------------------------------
NDHI_HYMLE      ----------------------------------------------------------------------
NDHI_HELBG      ----------------------------------------------------------------------
NDHI_ENYSE      ----------------------------------------------------------------------
NDHI_CYAA5      ----------------------------------------------------------------------
NDHI_BLEZA      ----------------------------------------------------------------------
NDHI_ATHGP      ----------------------------------------------------------------------
NDHI_AMBTR      ----------------------------------------------------------------------
FER_CLOPE       ----------------------------------------------------------------------
CYSI_ENT38      SQKAKIEKREHTLMDGVKPQRENS------------MACVSFPTCPLAMAEAESFTDKVEAVLAKHDEHI
CYSI_ALISL      KDQIEQIAREHGLID----------DGHSEQ-RKNSMACVAFPTCPLAMAEAERFLPELKKHNLPEDDNI
NDHI_ZINJU      ----------------------------------------------------------------------
NDHI_ZEXSE      ----------------------------------------------------------------------
NDHI_ZALME      ----------------------------------------------------------------------
NDHI_WEDTE      ----------------------------------------------------------------------
NDHI_VILAC      ----------------------------------------------------------------------
NDHI_VERJA      ----------------------------------------------------------------------
NDHI_VARMX      ----------------------------------------------------------------------
NDHI_TRIPN      ----------------------------------------------------------------------
NDHI_TRIME      ----------------------------------------------------------------------
NDHI_TILBA      ----------------------------------------------------------------------
NDHI_TETRE      ----------------------------------------------------------------------
NDHI_TETOR      ----------------------------------------------------------------------
NDHI_TARER      ----------------------------------------------------------------------
NDHI_SYNNO      ----------------------------------------------------------------------
NDHI_STESO      ----------------------------------------------------------------------
NDHI_STERE      ----------------------------------------------------------------------
NDHI_STAPU      ----------------------------------------------------------------------
NDHI_SQUKU      ----------------------------------------------------------------------
NDHI_SPIUR      ----------------------------------------------------------------------
NDHI_SPHTR      ----------------------------------------------------------------------
NDHI_SMAMI      ----------------------------------------------------------------------
NDHI_SIGBL      ----------------------------------------------------------------------
NDHI_RUMPE      ----------------------------------------------------------------------
NDHI_RUDHI      ----------------------------------------------------------------------
NDHI_ROJSU      ----------------------------------------------------------------------
NDHI_RATCO      ----------------------------------------------------------------------
NDHI_POPTR      ----------------------------------------------------------------------
NDHI_POPAL      ----------------------------------------------------------------------
NDHI_PODEM      ----------------------------------------------------------------------
NDHI_PEUSC      ----------------------------------------------------------------------
NDHI_PEROV      ----------------------------------------------------------------------
NDHI_PERMO      ----------------------------------------------------------------------
NDHI_PERLI      ----------------------------------------------------------------------
NDHI_PERCD      ----------------------------------------------------------------------
NDHI_PALAR      ----------------------------------------------------------------------
NDHI_OXYSB      ----------------------------------------------------------------------
NDHI_OBLMI      ----------------------------------------------------------------------
NDHI_NEULO      ----------------------------------------------------------------------
NDHI_MONRV      ----------------------------------------------------------------------
NDHI_MONPA      ----------------------------------------------------------------------
NDHI_MONGR      ----------------------------------------------------------------------
NDHI_MILQU      ----------------------------------------------------------------------
NDHI_MICAN      ----------------------------------------------------------------------
NDHI_MELNV      ----------------------------------------------------------------------
NDHI_MADSA      ----------------------------------------------------------------------
NDHI_LUNJA      ----------------------------------------------------------------------
NDHI_LIPIN      ----------------------------------------------------------------------
NDHI_LASMA      ----------------------------------------------------------------------
NDHI_LAGRA      ----------------------------------------------------------------------
NDHI_KINPA      ----------------------------------------------------------------------
NDHI_IDIQU      ----------------------------------------------------------------------
NDHI_ICHTE      ----------------------------------------------------------------------
NDHI_HULAL      ----------------------------------------------------------------------
NDHI_HELAN      ----------------------------------------------------------------------
NDHI_GRERE      ----------------------------------------------------------------------
NDHI_GALQU      ----------------------------------------------------------------------
NDHI_GALPT      ----------------------------------------------------------------------
NDHI_FLOPE      ----------------------------------------------------------------------
NDHI_FLARA      ----------------------------------------------------------------------
NDHI_EUTPA      ----------------------------------------------------------------------
NDHI_ENCCL      ----------------------------------------------------------------------
NDHI_ECLPR      ----------------------------------------------------------------------
NDHI_EATNI      ----------------------------------------------------------------------
NDHI_DYSTE      ----------------------------------------------------------------------
NDHI_DYSMI      ----------------------------------------------------------------------
NDHI_DUGME      ----------------------------------------------------------------------
NDHI_DIMVE      ----------------------------------------------------------------------
NDHI_DIMHO      ----------------------------------------------------------------------
NDHI_DESFU      ----------------------------------------------------------------------
NDHI_DELBI      ----------------------------------------------------------------------
NDHI_DAMCA      ----------------------------------------------------------------------
NDHI_DAHCO      ----------------------------------------------------------------------
NDHI_CYMVE      ----------------------------------------------------------------------
NDHI_CONNE      ----------------------------------------------------------------------
NDHI_COFAR      ----------------------------------------------------------------------
NDHI_COETI      ----------------------------------------------------------------------
NDHI_CLIAL      ----------------------------------------------------------------------
NDHI_CHRHE      ----------------------------------------------------------------------
NDHI_CHAVU      ----------------------------------------------------------------------
NDHI_CHAST      ----------------------------------------------------------------------
NDHI_CHASO      ----------------------------------------------------------------------
NDHI_CALVA      ----------------------------------------------------------------------
NDHI_BEBJU      ----------------------------------------------------------------------
NDHI_BAHTO      ----------------------------------------------------------------------
NDHI_BAHAB      ----------------------------------------------------------------------
NDHI_ARNMO      ----------------------------------------------------------------------
NDHI_ARNDE      ----------------------------------------------------------------------
NDHI_APHJA      ----------------------------------------------------------------------
NDHI_ACAAU      ----------------------------------------------------------------------
FER_CLOSM       ----------------------------------------------------------------------
CYSI_YERPY      KD--------KARIEALA-REHGLMDDNVTSQRENSMACVSFPTCPLAMAEAERFVTRVEGILQQHGLHI
CYSI_YERPP      KD--------KARIEALA-REHGLMDDNVTSQRENSMACVSFPTCPLAMAEAERFVTRVEGILQQHGLHI
CYSI_YERPN      KD--------KARIEALA-REHGLMDDNVTSQRENSMACVSFPTCPLAMAEAERFVTRVEGILQQHGLHI
CYSI_YERPE      KD--------KARIEALA-REHGLMDDNVTSQRENSMACVSFPTCPLAMAEAERFVTRVEGILQQHGLHI
CYSI_YERPA      KD--------KARIEALA-REHGLMDDNVTSQRENSMACVSFPTCPLAMAEAERFVTRVEGILQQHGLHI
CYSI_YERP3      KD--------KARIEALA-REHGLMDDNVTSQRENSMACVSFPTCPLAMAEAERFVTRVEGILQQHGLHI
CYSI_YERE8      KD--------KARIEALA-REHGLMDDSVSPQRENSMACVSFPTCPLAMAEAERFVTRIEGILQQHGLHI
CYSI_VIBPA      SE----KAKIEKIAREHGLMDDNVSEQ-----RKNSMACVAFPTCPLAMAEAERFLPQLEKHGLPENDNI
YDHY_SHIFL      ----------------------------------------------------------------------
YDHY_ECOLI      ----------------------------------------------------------------------
YDHY_ECO57      ----------------------------------------------------------------------
NDHI_TRIBB      ----------------------------------------------------------------------
NDHI_SORBI      ----------------------------------------------------------------------
NDHI_SACOF      ----------------------------------------------------------------------
NDHI_SACHY      ----------------------------------------------------------------------
NDHI_ORYSJ      ----------------------------------------------------------------------
NDHI_ORYSI      ----------------------------------------------------------------------
NDHI_ORYSA      ----------------------------------------------------------------------
NDHI_ORYNI      ----------------------------------------------------------------------
NDHI_OLIPU      ----------------------------------------------------------------------
NDHI_NASOF      ----------------------------------------------------------------------
NDHI_MAIZE      ----------------------------------------------------------------------
NDHI_LOBMA      ----------------------------------------------------------------------
NDHI_LEPVR      ----------------------------------------------------------------------
NDHI_HOFFA      ----------------------------------------------------------------------
NDHI_DRIGR      ----------------------------------------------------------------------
NDHI_CRUWA      ----------------------------------------------------------------------
NDHI_CHAPD      ----------------------------------------------------------------------
NDHI_BARVE      ----------------------------------------------------------------------
FER_CLOST       ----------------------------------------------------------------------
ECM17_YEAST     KNLKHTLRGMNAVL--------------------------------------------------------
DSVA_DESVH      VLLGTQTPQLEEIFFELTHNL-NTDLGGSGSNLRTPESCLGKSRCEFACYDTMEYQDELHRPAFP--YKF
YJGC_BACSU      ----------------------------------------------------------------------
PORD_PYRFU      ----------------------------------------------------------------------
NDHI_SOYBN      ----------------------------------------------------------------------
NDHI_RANMC      ----------------------------------------------------------------------
NDHI_RAIAR      ----------------------------------------------------------------------
NDHI_PELHO      ----------------------------------------------------------------------
NDHI_NANDO      ----------------------------------------------------------------------
NDHI_JASNU      ----------------------------------------------------------------------
NDHI_DIOEL      ----------------------------------------------------------------------
NDHI_CYAP4      ----------------------------------------------------------------------
NDHI_CUCSA      ----------------------------------------------------------------------
NDHI_CAPBU      ----------------------------------------------------------------------
NDHI_AGRST      ----------------------------------------------------------------------
FER_MEGEL       ----------------------------------------------------------------------
FER_CLOPA       ----------------------------------------------------------------------
FER_CLOBU       ----------------------------------------------------------------------
FER_CLOAC       ----------------------------------------------------------------------
CYSI_VIBHB      -------KSQKAKIEKIAREHGLMDDGVSEQ-RKNSMACVAFPTCPLAMAEAERFLPQLEKHGIPEEDNI
CYSI_VIBFM      KDHIEQIARAHGLIDDTHSEQR-----------KNSMACVAFPTCPLAMAEAERFLPELKKHNLPEEDNI
CYSI_VIBF1      KDHIEQIARAHGLIDDTHSEQR-----------KNSMACVAFPTCPLAMAEAERFLPELKKHNLPEEDNI
Y51B_METJA      ----------------------------------------------------------------------
NDHI_VENCA      ----------------------------------------------------------------------
NDHI_TOBAC      ----------------------------------------------------------------------
NDHI_SOLTU      ----------------------------------------------------------------------
NDHI_SOLLC      ----------------------------------------------------------------------
NDHI_SOLBU      ----------------------------------------------------------------------
NDHI_SILPE      ----------------------------------------------------------------------
NDHI_RIEOB      ----------------------------------------------------------------------
NDHI_RENSL      ----------------------------------------------------------------------
NDHI_PSEAR      ----------------------------------------------------------------------
NDHI_POLCN      ----------------------------------------------------------------------
NDHI_PHIZI      ----------------------------------------------------------------------
NDHI_PARHY      ----------------------------------------------------------------------
NDHI_OTESC      ----------------------------------------------------------------------
NDHI_NICTO      ----------------------------------------------------------------------
NDHI_NICSY      ----------------------------------------------------------------------
NDHI_MONCO      ----------------------------------------------------------------------
NDHI_LOXSI      ----------------------------------------------------------------------
NDHI_LOTJA      ----------------------------------------------------------------------
NDHI_LAYHE      ----------------------------------------------------------------------
NDHI_LACSA      ----------------------------------------------------------------------
NDHI_JAUCA      ----------------------------------------------------------------------
NDHI_JAEHI      ----------------------------------------------------------------------
NDHI_HYMFF      ----------------------------------------------------------------------
NDHI_GUATU      ----------------------------------------------------------------------
NDHI_ERIST      ----------------------------------------------------------------------
NDHI_ERICN      ----------------------------------------------------------------------
NDHI_ENGPE      ----------------------------------------------------------------------
NDHI_DRANE      ----------------------------------------------------------------------
NDHI_DAUCA      ----------------------------------------------------------------------
NDHI_CALME      ----------------------------------------------------------------------
NDHI_ATRBE      ----------------------------------------------------------------------
NDHI_ARATH      ----------------------------------------------------------------------
NDHI_ARAHI      ----------------------------------------------------------------------
NDHI_AETGR      ----------------------------------------------------------------------
NDHI_AETCO      ----------------------------------------------------------------------
NDHI_ACOCL      ----------------------------------------------------------------------
NDHI_ACMRA      ----------------------------------------------------------------------
HMC2_DESVH      ----------------------------------------------------------------------
DSRA_CHRVI      -DTPNTQNFFD------EINDYGWDLGGAGPCVRTAMSCVGSARCEMSCTNVNNFTDDVHRPALPYKFKF
CYSI_VIBCM      DQ--------KPHIEQLAREHGLIDDGVSEQRI-NSMACVAFPTCPLAMAEAERFLPSLAKHALPKEENI
CYSI_VIBCH      DQ--------KPHIEQLAREHGLIDDGVSEQRI-NSMACVAFPTCPLAMAEAERFLPSLAKHALPKEENI
CYSI_SALTI      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALSV      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALPC      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALPB      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALNS      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALHS      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALG2      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALEP      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALDC      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALCH      -----------------------------SAQRENSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_PHOLL      ---PESEKQRIETIAC----RHGLIDDKTTVQRKNSMACVSFPTCPLAMAEAERFLPEVEQLMNKHDEHI
CYSI_ENTS8      ---PEGDKA--------KIEQIARAHGLMAGVTENSMACVSFPTCPLAMAEAERFLPKVDGIMAKHGLHI
PORD_METJA      ----------------------------------------------------------------------
NIRB_ECOLI      DDLPEIWRQL------IEAGFET-GHAY-AKALRMAKTCVGSTWCRYGVGDSVGLGVELENRYIRTPHKM
NDHI_PLAOC      ----------------------------------------------------------------------
NDHI_PHODC      ----------------------------------------------------------------------
NDHI_PHAVU      ----------------------------------------------------------------------
FER_METTE       ----------------------------------------------------------------------
FER_ENTHI       ----------------------------------------------------------------------
FER6_METJA      ----------------------------------------------------------------------
CYSI_COLP3      ED--------KTIIEQLAREHGLINDGVSNQ-RKSSMACVAFPTCPLAMAEAERYVDDVEAILEKNGLKI
SIR2_MYCPA      ENVPEIWRRL------------------DAVGLRTTEAC---GDCPRVILGSPLAGESLEEVIDPSWAIA
PORD_PYRHO      ----------------------------------------------------------------------
NQO9_RHOMR      ----------------------------------------------------------------------
NDHI_MESVI      ----------------------------------------------------------------------
NDHI_CORPT      ----------------------------------------------------------------------
NDHI_CHLAT      ----------------------------------------------------------------------
NDHI_CALFG      ----------------------------------------------------------------------
NDHI_BUXMI      ----------------------------------------------------------------------
NDHI_ADICA      ----------------------------------------------------------------------
NDHI_ACAM1      ----------------------------------------------------------------------
IORA_ARCFU      -------------------HQPHPGTGFRGCGEAGVRGCGVEFVEVVNPYNVRKMVDVLRRALNHDGVAV
FER_CLOTS       ----------------------------------------------------------------------
CYSI_SALTY      ----------------------------------NSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALPK      ----------------------------------NSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALPA      ----------------------------------NSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_SALA4      ----------------------------------NSMACVSFPTCPLAMAEAESFTDKVEAILEKHDEHI
CYSI_PROMH      ---PEAQKEQ---IEAIARQYGLINDEVTPL-RKHAMACVSFPTCPLAMAEAERFLPAFTDTLDNSDEHI
CYSI_CITK8      SQKAKIEKRNHGLMNAVTSQRENS------------MACVSFPTCPLAMAEAERFVDKVDALMTHHDEHI
VORD_PYRHO      ----------------------------------------------------------------------
VORD_PYRAB      ----------------------------------------------------------------------
NDHI_WHEAT      ----------------------------------------------------------------------
NDHI_THEEB      ----------------------------------------------------------------------
NDHI_PANGI      ----------------------------------------------------------------------
NDHI_NYMAL      ----------------------------------------------------------------------
NDHI_NUPAD      ----------------------------------------------------------------------
NDHI_LIRTU      ----------------------------------------------------------------------
NDHI_ILLOL      ----------------------------------------------------------------------
NDHI_HORVU      ----------------------------------------------------------------------
FERA_METJA      ----------------------------------------------------------------------
CYSI_VIBC3      -----ADQKQQ--IEQLARSHGLIDDGVSEQRI-NSMACVAFPTCPLAMAEAERFLPSLAKHALPKEENI
CYSI_SALAR      ----------------------------------NSMACVSFPTCPLAMAEAESFVDKVEAVMAKHGVHI
NDHI_AMBTC      ----------------------------------------------------------------------
NASB_BACSU      ADLPNMKKDLKMPVYTNE----------HRHALQSIKACTCGQ-----NRSIQQLAAQIERQLEMLPLPA
FER2_DESNO      ----------------------------------------------------------------------
FDNH_SHIFL      ----------------------------------DVSTCIGCKACQVACSEWNDIRDEVGHCVGPADLSA
FDNH_ECOLI      ----------------------------------DVSTCIGCKACQVACSEWNDIRDEVGHCVGPADLSA
RNFB_HAEDU      ----------------------------------------------------------------------
PHFL_DESVO      ----------------------------------------------------------------------
NUOI_SHEWM      ----------------------------------------------------------------------
NUOI_RHOSR      ----------------------------------------------------------------------
NUOI_RHOOB      ----------------------------------------------------------------------
NUOI_ENTS8      ----------------------------------------------------------------------
NUOI_BLOPB      ----------------------------------------------------------------------
NUOI1_SOLUE     ----------------------------------------------------------------------
CYSI_ZYMMO      EDKDTIEKIARDHGLLENISELR----------KNSMACVSFPTCPLAMAEAENFLTKVEAVMTKYDIYI
CYSI_ECOSM      ----------------------------------NSMACVSFPTCPLAMAEAESFIDKIDNLMAKHDEHI
VORD_PYRFU      ----------------------------------------------------------------------
RNFB_SODGM      ----------------------------------------------------------------------
PSAC_EUGGR      ----------------------------------------------------------------------
PSAC_ANTFO      ----------------------------------------------------------------------
NUOI_RHOE4      ----------------------------------------------------------------------
NUOI2_ACIBL     ----------------------------------------------------------------------
NUOI1_SYNFM     ----------------------------------------------------------------------
NIRB_KLEOX      EQLPAIWRELA------EAGFET-GHAYGKS-LRTVKSCVGSTWCRYGVQDSTGLAVTLEHRYAPHKI--
NDHI_TRIEI      ----------------------------------------------------------------------
CYSI_SODGM      KD--------KAAIEALARRHGLIND--DATPQRKASACVAFPTCPLAMAEAERFVSNVETIMSGHGLEI
CYSI_KLEP7      ----------------------------------NSMACVSFPTCPLAMAEAESFIDKVEGVMSKHDEHI
CYSI_ERWCT      ---------------------------------KNSMACVSFPTCPLAMAEAERFVTKVEGIMQQHDEHI
CYSI_BAUCH      -------KKHKATIELLA--RQYGLINNNITLQRKASACVAFPTCPLAMAEAERFVTKVENIMSRHGLGQ
VHCB_METVO      ----------------------------------------------------------------------
SIR_DESVH       EAV-------EPMWEELRLDVGRAVE----LCVHYVQACPGTAVCRFGLQDSLGIGVAIEEEYVGHDFPA
RNFB_TOLAT      ----------------------------------------------------------------------
PSAC_PINKO      ----------------------------------------------------------------------
PSAC_DIOEL      ----------------------------------------------------------------------
PSAC_CYCTA      ----------------------------------------------------------------------
NUOI_MYCA1      ----------------------------------------------------------------------
NUOI2_MYCPA     ----------------------------------------------------------------------
NUOI1_MYCPA     ----------------------------------------------------------------------
NDHI_ANTFO      ----------------------------------------------------------------------
MAUN_PARDP      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
FDXH_HAEIN      ----------------------------------------------------------------------
CYSI_SHESR      ------KRNLKTIIQGLD---REALDSIAACGNRNV-MCNPNPVESKLHAQAYEVAKKLSDHLLPH----
CYSI_SHESM      ------KRNLKTIIQGLD---REALDSIAACGNRNV-MCNPNPVESKLHAQAYEVAKKLSDHLLPH----
CYSI_SHESA      ------KRNLKTIIQGLD---REALDSIAACGNRNV-MCNPNPVESKLHAQAYEVAKKLSDHLLPH----
CYSI_SHEON      ------KRNLKTIIQGLD---REALDSIAACGNRNV-MCNPNPVESKLHAQAYEVAKKLSDHLLPH----
CYSI_PSEHT      ----AANQKA--VIEEIARNH-GLIDDKDTEQRKNSMACVALPTCPLAMAEAERYVEKIEALLVPND-SI
CYSI_KLEP3      ----------------------------------NSMACVSFPTCPLAMAEAESFIDKVEGVMNKHDEHI
CYSI_BLOFL      ----EIHQDKKDIIEDLLKQYGLLGD-FVTSQRKSSMACVAFPTCPLAMAEAERFVTKVEHVMSKYNLQI
Y934_METJA      ----------------------------------------------------------------------
Y51A_METJA      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
RNFC_RHOCA      ----------------------------------------------------------------------
RNFB_SHISS      ----------------------------------------------------------------------
RNFB_SHIDS      ----------------------------------------------------------------------
RNFB_SHIB3      ----------------------------------------------------------------------
RNFB_SALTY      ----------------------------------------------------------------------
RNFB_SALTI      ----------------------------------------------------------------------
RNFB_SALSV      ----------------------------------------------------------------------
RNFB_SALPK      ----------------------------------------------------------------------
RNFB_SALPC      ----------------------------------------------------------------------
RNFB_SALPB      ----------------------------------------------------------------------
RNFB_SALPA      ----------------------------------------------------------------------
RNFB_SALNS      ----------------------------------------------------------------------
RNFB_SALHS      ----------------------------------------------------------------------
RNFB_SALG2      ----------------------------------------------------------------------
RNFB_SALEP      ----------------------------------------------------------------------
RNFB_SALDC      ----------------------------------------------------------------------
RNFB_SALCH      ----------------------------------------------------------------------
RNFB_SALAR      ----------------------------------------------------------------------
RNFB_SALA4      ----------------------------------------------------------------------
RNFB_ECOUT      ----------------------------------------------------------------------
RNFB_ECOSM      ----------------------------------------------------------------------
RNFB_ECOSE      ----------------------------------------------------------------------
RNFB_ECOLU      ----------------------------------------------------------------------
RNFB_ECOLI      ----------------------------------------------------------------------
RNFB_ECOLC      ----------------------------------------------------------------------
RNFB_ECOL6      ----------------------------------------------------------------------
RNFB_ECOL5      ----------------------------------------------------------------------
RNFB_ECOK1      ----------------------------------------------------------------------
RNFB_ECOHS      ----------------------------------------------------------------------
RNFB_ECODH      ----------------------------------------------------------------------
RNFB_ECOBW      ----------------------------------------------------------------------
RNFB_ECO8A      ----------------------------------------------------------------------
RNFB_ECO81      ----------------------------------------------------------------------
RNFB_ECO7I      ----------------------------------------------------------------------
RNFB_ECO5E      ----------------------------------------------------------------------
RNFB_ECO57      ----------------------------------------------------------------------
RNFB_ECO55      ----------------------------------------------------------------------
RNFB_ECO45      ----------------------------------------------------------------------
RNFB_ECO27      ----------------------------------------------------------------------
RNFB_ECO24      ----------------------------------------------------------------------
RNFB_BUCAT      ----------------------------------------------------------------------
RNFB_BUCAI      ----------------------------------------------------------------------
RNFB_BUCA5      ----------------------------------------------------------------------
PSAC_RHDSA      ----------------------------------------------------------------------
PSAC_NOSS9      ----------------------------------------------------------------------
PSAC_NOSS8      ----------------------------------------------------------------------
PSAC_NOSP7      ----------------------------------------------------------------------
PSAC_MICAN      ----------------------------------------------------------------------
PSAC_FREDI      ----------------------------------------------------------------------
PSAC_ANAVT      ----------------------------------------------------------------------
PSAC_ANASP      ----------------------------------------------------------------------
NUOI_COXBU      ----------------------------------------------------------------------
NUOI_COXBR      ----------------------------------------------------------------------
NUOI_COXBN      ----------------------------------------------------------------------
NUOI_ACIAD      ----------------------------------------------------------------------
NDHI_SYNJA      ----------------------------------------------------------------------
FER_CLOTM       ----------------------------------------------------------------------
FER7_METJA      ----------------------------------------------------------------------
FER3_RHISN      ----------------------------------------------------------------------
FER2_METJA      ----------------------------------------------------------------------
CYSI_VIBVU      -----VSKSNKAKIEKLAREHGLMDEGVSEQ-RKNAMACVAFPTCPLAMAEAERFLPQLDKHGLDKEDNI
ACDA_METJA      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
SIR_MYCTU       ENVPEIWRRLDDV---------------------------------------------------------
SIR_MYCBO       ENVPEIWRRLDDV---------------------------------------------------------
RNFB_VIBHB      ----------------------------------------------------------------------
RNFB_SHIFL      ----------------------------------------------------------------------
RNFB_SHIBS      ----------------------------------------------------------------------
RNFB_RHOCA      ----------------------------------------------------------------------
RNFB_ESCF3      ----------------------------------------------------------------------
RNFB_CITK8      ----------------------------------------------------------------------
RNFB_BUCBP      ----------------------------------------------------------------------
PSAC_SYNY3      ----------------------------------------------------------------------
PSAC_PROM9      ----------------------------------------------------------------------
PSAC_PROM4      ----------------------------------------------------------------------
PSAC_MARPO      ----------------------------------------------------------------------
PSAC_CYAP8      ----------------------------------------------------------------------
PSAC_CYAP7      ----------------------------------------------------------------------
NUOI_SHISS      ----------------------------------------------------------------------
NUOI_SHIFL      ----------------------------------------------------------------------
NUOI_SHIF8      ----------------------------------------------------------------------
NUOI_SHIDS      ----------------------------------------------------------------------
NUOI_SHIBS      ----------------------------------------------------------------------
NUOI_SHEON      ----------------------------------------------------------------------
NUOI_SALTY      ----------------------------------------------------------------------
NUOI_SALTI      ----------------------------------------------------------------------
NUOI_SALPA      ----------------------------------------------------------------------
NUOI_SALCH      ----------------------------------------------------------------------
NUOI_MYCGI      ----------------------------------------------------------------------
NUOI_ERWT9      ----------------------------------------------------------------------
NUOI_ERWCT      ----------------------------------------------------------------------
NUOI_ECOUT      ----------------------------------------------------------------------
NUOI_ECOLI      ----------------------------------------------------------------------
NUOI_ECOL6      ----------------------------------------------------------------------
NUOI_ECOL5      ----------------------------------------------------------------------
NUOI_ECOK1      ----------------------------------------------------------------------
NUOI_ECO57      ----------------------------------------------------------------------
NUOI_ACIBY      ----------------------------------------------------------------------
NUOI_ACIBT      ----------------------------------------------------------------------
NUOI_ACIBS      ----------------------------------------------------------------------
NUOI_ACIBC      ----------------------------------------------------------------------
NUOI2_RHOS4     ----------------------------------------------------------------------
NUOI2_RHOS1     ----------------------------------------------------------------------
NDHI_SYNJB      ----------------------------------------------------------------------
FER1_RHORU      ----------------------------------------------------------------------
CYSI_SHIFL      ----------------------------------NSMACVSFPTCPLAMAEAESFIDNIDNLMVKHDEHI
CYSI_SHIF8      ----------------------------------NSMACVSFPTCPLAMAEAESFIDNIDNLMVKHDEHI
Y1684_METTH     ----------------------------------------------------------------------
RNFB_VIBSL      ----------------------------------------------------------------------
RNFB_VIBPA      ----------------------------------------------------------------------
RNFB_RHOS4      ----------------------------------------------------------------------
RNFB_RHOS1      ----------------------------------------------------------------------
RNFB_HAEIN      ----------------------------------------------------------------------
RNFB_HAEIE      ----------------------------------------------------------------------
RNFB_HAEI8      ----------------------------------------------------------------------
RNFB_AERS4      ----------------------------------------------------------------------
RNFB_AERHH      ----------------------------------------------------------------------
PSAC_ZYGCR      ----------------------------------------------------------------------
PSAC_WHEAT      ----------------------------------------------------------------------
PSAC_VITVI      ----------------------------------------------------------------------
PSAC_TOBAC      ----------------------------------------------------------------------
PSAC_STAPU      ----------------------------------------------------------------------
PSAC_SPIOL      ----------------------------------------------------------------------
PSAC_SOYBN      ----------------------------------------------------------------------
PSAC_SORBI      ----------------------------------------------------------------------
PSAC_SOLTU      ----------------------------------------------------------------------
PSAC_SOLLC      ----------------------------------------------------------------------
PSAC_SOLBU      ----------------------------------------------------------------------
PSAC_SECCE      ----------------------------------------------------------------------
PSAC_SACOF      ----------------------------------------------------------------------
PSAC_SACHY      ----------------------------------------------------------------------
PSAC_PSEPI      ----------------------------------------------------------------------
PSAC_POPTR      ----------------------------------------------------------------------
PSAC_POPAL      ----------------------------------------------------------------------
PSAC_PLAOC      ----------------------------------------------------------------------
PSAC_PIPCE      ----------------------------------------------------------------------
PSAC_PHAAO      ----------------------------------------------------------------------
PSAC_PELHO      ----------------------------------------------------------------------
PSAC_PANGI      ----------------------------------------------------------------------
PSAC_ORYSJ      ----------------------------------------------------------------------
PSAC_ORYSI      ----------------------------------------------------------------------
PSAC_ORYSA      ----------------------------------------------------------------------
PSAC_ORYNI      ----------------------------------------------------------------------
PSAC_OLIPU      ----------------------------------------------------------------------
PSAC_OENEH      ----------------------------------------------------------------------
PSAC_NYMAL      ----------------------------------------------------------------------
PSAC_NICTO      ----------------------------------------------------------------------
PSAC_NICSY      ----------------------------------------------------------------------
PSAC_NASOF      ----------------------------------------------------------------------
PSAC_NANDO      ----------------------------------------------------------------------
PSAC_MORIN      ----------------------------------------------------------------------
PSAC_MASLA      ----------------------------------------------------------------------
PSAC_LOTJA      ----------------------------------------------------------------------
PSAC_LOLPR      ----------------------------------------------------------------------
PSAC_LOBMA      ----------------------------------------------------------------------
PSAC_LEPVR      ----------------------------------------------------------------------
PSAC_LACSA      ----------------------------------------------------------------------
PSAC_JASNU      ----------------------------------------------------------------------
PSAC_IPOPU      ----------------------------------------------------------------------
PSAC_HORVU      ----------------------------------------------------------------------
PSAC_HELAN      ----------------------------------------------------------------------
PSAC_GOSHI      ----------------------------------------------------------------------
PSAC_GOSBA      ----------------------------------------------------------------------
PSAC_EUCGG      ----------------------------------------------------------------------
PSAC_DRANE      ----------------------------------------------------------------------
PSAC_DAUCA      ----------------------------------------------------------------------
PSAC_CUSRE      ----------------------------------------------------------------------
PSAC_CUSOB      ----------------------------------------------------------------------
PSAC_CUSGR      ----------------------------------------------------------------------
PSAC_CUSEX      ----------------------------------------------------------------------
PSAC_CRUWA      ----------------------------------------------------------------------
PSAC_COFAR      ----------------------------------------------------------------------
PSAC_CITSI      ----------------------------------------------------------------------
PSAC_CHAVU      ----------------------------------------------------------------------
PSAC_CHAGL      ----------------------------------------------------------------------
PSAC_CAPBU      ----------------------------------------------------------------------
PSAC_CALFG      ----------------------------------------------------------------------
PSAC_BUXMI      ----------------------------------------------------------------------
PSAC_BARVE      ----------------------------------------------------------------------
PSAC_ATRBE      ----------------------------------------------------------------------
PSAC_ARATH      ----------------------------------------------------------------------
PSAC_ARAHI      ----------------------------------------------------------------------
PSAC_AMBTC      ----------------------------------------------------------------------
PSAC_AGRST      ----------------------------------------------------------------------
PSAC_AETGR      ----------------------------------------------------------------------
PSAC_AETCO      ----------------------------------------------------------------------
PSAC_AEGTA      ----------------------------------------------------------------------
PSAC_ACOCL      ----------------------------------------------------------------------
PHFL_DESVH      ----------------------------------------------------------------------
NUOI_AERHH      ----------------------------------------------------------------------
NUOI2_AQUAE     ----------------------------------------------------------------------
FER_PYRIL       ----------------------------------------------------------------------
CYSI_VIBVY      -----VSKSNKAKIEKLAREHGLMDEGVSEQ-RKNSMACVAFPTCPLAMAEAERFLPQLDKHGLDKEDNI
CYSI_SHISS      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_SHIDS      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_SHIBS      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_SHIB3      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_NEIMA      -NVPEGGKAR---IEQLARSYGLIHDGVSKL-RENAMSCVSFPTCPLAMAEAEDFIGELDKIMAKHDDYI
CYSI_ESCF3      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOUT      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOSE      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOLU      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOLI      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOLC      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOL6      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOL5      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOK1      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOHS      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECOBW      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO8A      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO81      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO7I      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO5E      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO57      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO55      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO45      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO27      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_ECO24      ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
CYSI_BLOPB      PNLKNVHRLLNKL----------GLDSIATAGNRNV-ICTANPMESTLHYQVWELAKSISSYLLP-----
RNFC_SERP5      ----------------------------------------------------------------------
RNFB_VIBVY      ----------------------------------------------------------------------
RNFB_VIBVU      ----------------------------------------------------------------------
PSAC_TRIEI      ----------------------------------------------------------------------
PSAC_THEVL      ----------------------------------------------------------------------
PSAC_THEEB      ----------------------------------------------------------------------
PSAC_SYNEN      ----------------------------------------------------------------------
PSAC_PROMT      ----------------------------------------------------------------------
PSAC_PROM1      ----------------------------------------------------------------------
PSAC_PINTH      ----------------------------------------------------------------------
PSAC_PHYPA      ----------------------------------------------------------------------
PSAC_PHATR      ----------------------------------------------------------------------
PSAC_OLTVI      ----------------------------------------------------------------------
PSAC_MAIZE      ----------------------------------------------------------------------
PSAC_LEPTE      ----------------------------------------------------------------------
PSAC_HUPLU      ----------------------------------------------------------------------
PSAC_GUITH      ----------------------------------------------------------------------
PSAC_CYAP4      ----------------------------------------------------------------------
PSAC_CYACA      ----------------------------------------------------------------------
PSAC_CYAA5      ----------------------------------------------------------------------
PSAC_CHLVU      ----------------------------------------------------------------------
PSAC_ANGEV      ----------------------------------------------------------------------
PSAC_ADICA      ----------------------------------------------------------------------
PSAC_ACAM1      ----------------------------------------------------------------------
NUOI_YERPY      ----------------------------------------------------------------------
NUOI_YERPS      ----------------------------------------------------------------------
NUOI_YERPP      ----------------------------------------------------------------------
NUOI_YERPN      ----------------------------------------------------------------------
NUOI_YERPG      ----------------------------------------------------------------------
NUOI_YERPE      ----------------------------------------------------------------------
NUOI_YERPB      ----------------------------------------------------------------------
NUOI_YERPA      ----------------------------------------------------------------------
NUOI_YERP3      ----------------------------------------------------------------------
NUOI_PSEU2      ----------------------------------------------------------------------
NUOI_PSESM      ----------------------------------------------------------------------
NUOI_PSEPK      ----------------------------------------------------------------------
NUOI_PSEPF      ----------------------------------------------------------------------
NUOI_PSEFL      ----------------------------------------------------------------------
NUOI_PSEF5      ----------------------------------------------------------------------
NUOI_PSEE4      ----------------------------------------------------------------------
NUOI_PSEAE      ----------------------------------------------------------------------
NUOI_PSEAB      ----------------------------------------------------------------------
NUOI_PSEA8      ----------------------------------------------------------------------
NUOI_PSEA7      ----------------------------------------------------------------------
NUOI_PSE14      ----------------------------------------------------------------------
NUOI_PELPD      ----------------------------------------------------------------------
NUOI_MYCVP      ----------------------------------------------------------------------
NUOI_MYCUA      ----------------------------------------------------------------------
NUOI_MYCTU      ----------------------------------------------------------------------
NUOI_MYCTA      ----------------------------------------------------------------------
NUOI_MYCMM      ----------------------------------------------------------------------
NUOI_MYCBT      ----------------------------------------------------------------------
NUOI_MYCBP      ----------------------------------------------------------------------
NUOI_MYCBO      ----------------------------------------------------------------------
NUOI_EDWI9      ----------------------------------------------------------------------
NUOI_ANADF      ----------------------------------------------------------------------
NUOI_AERS4      ----------------------------------------------------------------------
NUOI_ACIC1      ----------------------------------------------------------------------
IORA_PYRAB      ---------LDNLVTAMTGDQPNPGTGETPHGPEEVAKAMGADFVAVVDYDIKETYETFKKALEVEGVSV
FER3_PLEBO      ----------------------------------------------------------------------
DSVB_DESVH      ------EASLKALKEDLASRKFDGGSGGTGAGVSNIVHTQGWVHCHTPATDASGPVKAIMDEVFEDPAPV
RNFB_PECCP      ----------------------------------------------------------------------
PSAC_SYNSC      ----------------------------------------------------------------------
PSAC_SYNS9      ----------------------------------------------------------------------
PSAC_SYNS3      ----------------------------------------------------------------------
PSAC_SYNR3      ----------------------------------------------------------------------
PSAC_SYNPZ      ----------------------------------------------------------------------
PSAC_SYNPX      ----------------------------------------------------------------------
PSAC_SYNPW      ----------------------------------------------------------------------
PSAC_SYNP2      ----------------------------------------------------------------------
PSAC_STIHE      ----------------------------------------------------------------------
PSAC_PROMS      ----------------------------------------------------------------------
PSAC_PROMP      ----------------------------------------------------------------------
PSAC_PROMA      ----------------------------------------------------------------------
PSAC_PROM5      ----------------------------------------------------------------------
PSAC_PROM2      ----------------------------------------------------------------------
PSAC_PROM0      ----------------------------------------------------------------------
PSAC_PORYE      ----------------------------------------------------------------------
PSAC_PORPU      ----------------------------------------------------------------------
PSAC_OSTTA      ----------------------------------------------------------------------
PSAC_MESVI      ----------------------------------------------------------------------
PSAC_CYAME      ----------------------------------------------------------------------
PSAC_CHLRE      ----------------------------------------------------------------------
NUOI_YERE8      ----------------------------------------------------------------------
NUOI_TOLAT      ----------------------------------------------------------------------
NUOI_MYCS2      ----------------------------------------------------------------------
NUOI_CHRSD      ----------------------------------------------------------------------
NUOHI_NOCFA     ----------------------------------------------------------------------
NUOG2_RHIME     ----------------------------------------------------------------------
NDUS8_NEUCR     ----------------------------------------------------------------------
HDRA_METTM      ----------------------------------------------------------------------
HDRA_METTH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
FER3_ANASP      ----------------------------------------------------------------------
FDOH_SHIFL      ----------------------------------DVTTCIGCKACQVACSEWNDIRDTVGNNIGPNDLSA
FDOH_ECOLI      ----------------------------------DVTTCIGCKACQVACSEWNDIRDTVGNNIGPNDLSA
FDOH_ECOL6      ----------------------------------DVTTCIGCKACQVACSEWNDIRDTVGNNIGPNDLSA
CYSI_SHEDO      EDKAEIEG----------LARKHGLMGQVLTGTRGHSACVALPTCPLAMAEAERYFPEFIDHIDASDQSI
CYSI_MANSM      RQIEDIARQYGLIRKITKLRE-------------NAMSCVSFPTCPLAMAESERFIDELDKIMAKHHVYI
YJJW_ECOLI      ----------------------------------------------------------------------
Y726_METJA      ----------------------------------------------------------------------
RNFB_THIDA      ----------------------------------------------------------------------
RNFB_SERP5      ----------------------------------------------------------------------
RNFB_ERWCT      ----------------------------------------------------------------------
RNFB_BUCAP      ----------------------------------------------------------------------
RNFB_ALHEH      ----------------------------------------------------------------------
PSAC_THAPS      ----------------------------------------------------------------------
PSAC_SKECO      ----------------------------------------------------------------------
PSAC_PSINU      ----------------------------------------------------------------------
PSAC_ODOSI      ----------------------------------------------------------------------
PSAC_NEPOL      ----------------------------------------------------------------------
PSAC_GRATL      ----------------------------------------------------------------------
PSAC_EMIHU      ----------------------------------------------------------------------
PHSB_SALTY      ----------------------------------------------------------------------
PHSB_SALTI      ----------------------------------------------------------------------
NUOI_NEIMF      ----------------------------------------------------------------------
NUOI_NEIMB      ----------------------------------------------------------------------
NUOI_NEIMA      ----------------------------------------------------------------------
NUOI_NEIG1      ----------------------------------------------------------------------
NUOI_FRASC      ----------------------------------------------------------------------
NUOI_FRAAA      ----------------------------------------------------------------------
NUOI_BLOFL      ----------------------------------------------------------------------
NUOI1_STRAW     ----------------------------------------------------------------------
RNFC_YERPY      ----------------------------------------------------------------------
RNFC_YERPN      ----------------------------------------------------------------------
RNFC_YERPG      ----------------------------------------------------------------------
RNFC_YERPB      ----------------------------------------------------------------------
RNFC_YERPA      ----------------------------------------------------------------------
RNFC_YERP3      ----------------------------------------------------------------------
RNFC_YERE8      ----------------------------------------------------------------------
RNFC_ECOSM      ----------------------------------------------------------------------
RNFB_KLEP3      ----------------------------------------------------------------------
PSAC_PSEAK      ----------------------------------------------------------------------
PSAC_PHAVU      ----------------------------------------------------------------------
PSAC_PEA        ----------------------------------------------------------------------
PSAC_LIRTU      ----------------------------------------------------------------------
PSAC_ILLOL      ----------------------------------------------------------------------
PSAC_DRIGR      ----------------------------------------------------------------------
PSAC_CUCSA      ----------------------------------------------------------------------
PSAC_CHLSC      ----------------------------------------------------------------------
PSAC_CERDE      ----------------------------------------------------------------------
NUOI_BUCBP      ----------------------------------------------------------------------
NUOI2_RHOPB     ----------------------------------------------------------------------
NUOI2_ANADE     ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
CYSI_PSEA6      ----EQNKKVEEIARAHGLIEDDL-----SAQRKDSMACVALPTCPLAMAEAERYLPEAKHAIAQKSIIY
CYSI_NEIM0      ----------------------------------NAMSCVSFPTCPLAMAEAEDFIDELDKIMAKHDDYI


                         +         .         .         .         .         *         .:210
query           KIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGACVRACKKKATGALSFENFKVVRDGSKCIGCG
ASRC_SALTY      KTVIVGCPNDCAKASMADLGIIGVAKMRFTADRCIGCGACVKACSHHAVGCLALKNGKAVKEESACIGCG
ASRC_SALTI      KTVIVGCPNDCAKASMADLGIIGVAKMRFTADRCIGCGACVKACSHHAVGCLALKNGKAVKEESACIGCG
Y870_METJA      KIAISGCPNGCVRPQVHDIGIAGVKYPKVNEEKCNGCGRCAEVCKVEARGETSYTNYNV------CVGCG
Y551_METJA      KINVSGCPNSCTFHRFCDIGICYRYKITINKEICTNCGKCKDFCD---LNAIDWER-KIIKD--NCTGEG
DSRA_ARCFU      KIKCAGCPNDCVASKARDFAIIGKVDQEAVKEYASWMDIENEVVKLCPTGAIKWDGKELTIDNRECVRCM
NIR_MAIZE       ----TGCPNSCGQVQVADIGFMG-----------------------------------------------
Y514_METJA      CMGCGACPKKCIKVERELGEVIKTRDIEVDKNLCVGCLVCIEECP---INAIDQDGDKVKINKDKCILCG
SIR_SYNE7       ----------------------------------------------------------------------
NIR_ORYSJ       RMHWTGCPNSCGQVQVADIGFMG-----------------------------------------------
NIR_BETVE       ----TGCPNSCGQVQVADIGFMG-----------------------------------------------
NIR_SYNE7       RIHWTGCPNSCGQPQVADIGLMG-----------------------------------------------
NIR_SPIOL       ----TGCPNSCGQVQVADIGFMG-----------------------------------------------
NIR_ARATH       RMHWTGCPNTCGQVQVADIGFMG-----------------------------------------------
Y1303_METJA     ------CPNDALK--VENFKVIKVKEDKTSQSYCINCGLCAEHCP---SGALRFENGHLYYSPDVCWKCM
NASD_BACSU      KMAVSACPRNCAESGIKDLGVVGI----------------------------------------------
NIR_PHOLA       NIAIAGCRDNSVHAEINDIAFV------------------------------------------------
NIR_EMENI       KGAVSGCVRECAEAQNKDFGLI------------------------------------------------
NDHI_SYNSC      ----------------------------YEFDKCIACEVCVRVCPNKATKKKELRNYSI--DFGVCIFCG
NDHI_SYNS9      ----------------------------YEFDKCIACEVCVRVCPNKATKKKELRNYSI--DFGVCIFCG
NDHI_SYNPX      ----------------------------YEFDKCIACEVCVRVCPNKATKKKELRNYSI--DFGVCIFCG
HDRA_METAC      -------------------------------DKCIGCRTCVEVCK---FGKISIENKKAVVDEVSCYGCG
VHUB_METJA      ---------------------------------CVGCGICVPECP---VNAITLENNKAVIDKSKCIYCS
NDHI_SYNP6      ----------------------------YEFDKCIACEVCVRVCPNKETKKKDLKNYSI--DFGACIFCG
NDHI_SYNE7      ----------------------------YEFDKCIACEVCVRVCPNKETKKKDLKNYSI--DFGACIFCG
FER2_THEAC      ------------------------TEMDVDRNLCNYCGACVGMCP---TDAIWLDETVIKIHEEKCIECG
NDHI_SYNS3      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_SYNPW      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROMS      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROMP      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROMA      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROM9      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROM5      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROM4      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROM2      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROM0      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROMM      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROM3      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGVCIFCG
NDHI_PROMT      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGACIFCG
NDHI_PROM1      ----------------------------YEFDKCIACEVCVRVCPNKETKKKELRNYSI--DFGACIFCG
NDHI_HUPLU      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPINLP-VVDWEFEKNIRDFGVCIFCG
NDHI_ANAVT      ----------------------------YEFDKCIACEVCVRVCPDKATKKKKLNHYSI--DFGVCIFCG
NDHI_ANASP      ----------------------------YEFDKCIACEVCVRVCPDKATKKKKLNHYSI--DFGVCIFCG
FDHL_BACSU      ---------------------VDMSHPRYDPNQCIACGQCVEVCQNQVNETLSIERPRVIWDESSCVSCG
VHUB_METVO      ---------------------------------CTLCFSCASACP---TGALVENNGKLIYNSSKCIKCG
NDHI_OENEH      ----------------------------FEFDKCIACEVCVRVCPKLETGVRKKRLLNYSIDFGVCIFCG
NDHI_GLOVI      -------PSERFRGRIH-----------FERPKCISCEVCVRVCPNKETKKKELNSYSI--DFGVCIFCG
FWDE_METJA      ----------------------------WDENSCIACGSCL------GCAALTLDNFTVGIDEDTCHLCA
NDHI_ANGEV      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPKESVRKKQLKNYSI--DFAVCIFCG
FDHL_STAS1      ---------------------------RYDPNQCILCGRCVEVCQERQQPRVIWDNDTSINDSS-CVGCG
SIR_SYNY3       ----------------------------------------------------------------------
NIR_NEUCR       KGGVSGCTRECAEAGNKDFGLI------------------------------------------------
NDHI_SYNY3      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPNKAVKKKELKHYSI--DFGVCIFCG
NDHI_PHYPA      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPELXXXXXXXXXXSYSIDFGVCIFCG
NDHI_CYAP8      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPNKAVKKKELKHYSI--DFGVCIFCG
NDHI_VITVI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKQLLNYSIDFGICIFCG
NDHI_SPIOL      ----------------------------FEFDKCIACEVCVRACPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CYAP7      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPNKAVKKKELKHYSI--DFGVCIFCG
HDRA_METMA      -------------------------------DKCIGCRTCVEVCK---FGKISIVDKKAVVDEVSCYGCG
NDHI_PSINU      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPINLP-VVDWELIKSMRDFGVCIFCG
NDHI_NEPOL      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPQKSVKKKQLRSYSI--DFGVCIFCG
NDHI_CHAGL      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPQKSIKKKQLKSYSI--DFGVCIFCG
MVHB_METTH      ------CPNDAIRVVTKE----GMKVPDNEKAMCTRCGACTVACPK---GALSLVDMDKVVDGALCDQCG
MVHB_METFE      CVLCQQCVNVC---PIEVIGIEGVKEPARVEIKCVGCGLCVPECPVNAITLPKYESIEI--DEEKCIKCG
HYCF_ECOLI      -------------------------KPEQNPQQCIGCAACVNACPSNATGELAWE-FNL----GHCIFCG
FRHG_METTH      ---------------------------------CTGCGTCAMACQ---TRALDMTNGRPELNSDRCIKCG
CYSI_SERP5      VLRITGCPNGCGRALLAEIGLVGKAVGRY-----------------------------------------
NUOI_CARHZ      --------------------------------KCIACGLCQQACPNKVVGSIKDENNKYEMEMKYCLFCG
DSRB_ARCFU      KISLACCANMCGAVHASDIAIVGITPPEAIRKTC-EIPSTVAACP---TGALKMKNKTIKVDVEKCMYCG
NDHI_SYNP2      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPDKSIKKKTLKHYSI--DFGVCIFCG
NDHI_MORIN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKQLLNYSIDFGICIFCG
NDHI_EUCGG      ----------------------------FEFDKCIACEVCVRVCPKLETGIRKKRLLNYSIDFGICIFCG
NDHI_CITSI      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPKFETDIRKKRLLNYSIDFGICIFCG
FDHL_STAAW      ---------------------------RYDPNQCILCGRCVEACQDIEVNETDREHPRVIWDNSSCVSCG
FDHL_STAAS      ---------------------------RYDPNQCILCGRCVEACQDIEVNETDREHPRVIWDNSSCVSCG
FDHL_STAAR      ---------------------------RYDPNQCILCGRCVEACQDNETIRIDWEHPRVIWDNSSCVSCG
FDHL_STAAN      ---------------------------RYDPNQCILCGRCVEACQDIEVNETDREHPRVIWDNSSCVSCG
FDHL_STAAM      ---------------------------RYDPNQCILCGRCVEACQDIEVNETDREHPRVIWDNSSCVSCG
FDHL_STAAC      ---------------------------RYDPNQCILCGRCVEACQDIEVNETDREHPRVIWDNSSCVSCG
FDHL_STAAB      ---------------------------RYDPNQCILCGRCVEACQDIEVNETDREHPRVIWDNSSCVSCG
FDHL_STAA8      ---------------------------RYDPNQCILCGRCVEACQDIEVNETDREHPRVIWDNSSCVSCG
FDHL_STAA3      ---------------------------RYDPNQCILCGRCVEACQDIEVNETDREHPRVIWDNSSCVSCG
CYSI_YERPS      VLRVTGCPNGCGRALLAEVGLVGKAVGRY-----------------------------------------
CYSI_YERPB      VLRVTGCPNGCGRALLAEVGLVGKAVGRY-----------------------------------------
NDHI_PLEBO      ----------------------------FEFDKCIACEVCVRVCPNKETKKKKLNHYSI--DFGVCIFCG
NDHI_GOSHI      ----------------------------FEFDKCIACEVCVRVCPKFETDIRKKRLLNYSIDFGICIFCG
NDHI_GOSBA      ----------------------------FEFDKCIACEVCVRVCPKFETDIRKKRLLNYSIDFGICIFCG
ACDA1_METKA     ---------------------------QKEAKRCLGCGDCERVCERAANG--DFEGLADLFD--RCVGCA
PHF1_CLOPA      -----------------------------DRTKCLLCGRCVNACKNTETYAMKFKNGKTIFDDTNCLLCG
NDHI_ZYGCR      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPQKSMKKKQLKSYSI--DFGVCIFCG
NDHI_MARPO      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPXXXXXXXXXXNYSI--DFGVCIFCG
NDHI_CHLSC      ----------------------------FELDKCIACEVCVRVCPRLETDIRKKRLLNYSIDFGICIFCG
MAUN_METEA      ------------------YGIVGKTSAAARREGCTNCGACFQICTEPITPALKGTGSTLILSGD-CVNCG
FDHL_STAHJ      ---------------------------RYDPDQCILCGRCVEACQDEVNETISIEHPRVIWDNSSCVSCG
PORD_PYRAB      --------------------------PEFKKDKCVRCFLCYIYCPEPAI-YLDEEGYPVF-DYDYCKGCG
NDHI_PSIGN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PSAAN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PIPCE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PHABO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MELLU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MARCE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_INUBR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_HYMLE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_HELBG      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ENYSE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGVCIFCG
NDHI_CYAA5      ----------------------------FEFDKCIACEVCVRVCPNKDAKKKELKHYSI--DFGVCIFCG
NDHI_BLEZA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ATHGP      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_AMBTR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
FER_CLOPE       ---------------------------------CVSCGACAAECP---VDAISQGDTQFVIDADTCIDCG
CYSI_ENT38      VMRVTGCPNGCGRALLAELGLVGKAPGRY-----------------------------------------
CYSI_ALISL      IFRVTGCPNGCGRAMLAEIGLIGKAPGRY-----------------------------------------
NDHI_ZINJU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ZEXSE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ZALME      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_WEDTE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_VILAC      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_VERJA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_VARMX      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_TRIPN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_TRIME      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_TILBA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_TETRE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_TETOR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_TARER      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SYNNO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_STESO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_STERE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_STAPU      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPQKSMKKKQLKSYSI--DFGVCIFCG
NDHI_SQUKU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SPIUR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SPHTR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SMAMI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SIGBL      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_RUMPE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_RUDHI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ROJSU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_RATCO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_POPTR      ----------------------------FEFDKCIACEVCVRVCPELETNIRKKRLLNYSIDFGICIFCG
NDHI_POPAL      ----------------------------FEFDKCIACEVCVRVCPELETNIRKKRLLNYSIDFGICIFCG
NDHI_PODEM      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PEUSC      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PEROV      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PERMO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PERLI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PERCD      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PALAR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_OXYSB      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_OBLMI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_NEULO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MONRV      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MONPA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MONGR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MILQU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MICAN      ----------------------------FEFDKCIACEVCVRVCPNKEIKKKELKHYSI--DFGVCIFCG
NDHI_MELNV      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MADSA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_LUNJA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_LIPIN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_LASMA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_LAGRA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_KINPA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_IDIQU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ICHTE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_HULAL      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_HELAN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_GRERE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_GALQU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_GALPT      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_FLOPE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_FLARA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_EUTPA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ENCCL      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ECLPR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_EATNI      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_DYSTE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DYSMI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DUGME      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DIMVE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DIMHO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DESFU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DELBI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DAMCA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DAHCO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CYMVE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CONNE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_COFAR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKQLLNYSIDFGVCIFCG
NDHI_COETI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CLIAL      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CHRHE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CHAVU      ----------------------------FEFDKCIVCEVCVRVCPQQDIRKKKLKNYSI--DFGVCIFCG
NDHI_CHAST      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CHASO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CALVA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_BEBJU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_BAHTO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_BAHAB      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ARNMO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ARNDE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_APHJA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ACAAU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
FER_CLOSM       ---------------------------------CINCGACEPECPVEA---ISESDAVRVIDADKCIDCG
CYSI_YERPY      VLRVTGCPNGCGRALLAEVGLVGKAVGRY-----------------------------------------
CYSI_YERPP      VLRVTGCPNGCGRALLAEVGLVGKAVGRY-----------------------------------------
CYSI_YERPN      VLRVTGCPNGCGRALLAEVGLVGKAVGRY-----------------------------------------
CYSI_YERPE      VLRVTGCPNGCGRALLAEVGLVGKAVGRY-----------------------------------------
CYSI_YERPA      VLRVTGCPNGCGRALLAEVGLVGKAVGRY-----------------------------------------
CYSI_YERP3      VLRVTGCPNGCGRALLAEVGLVGKAVGRY-----------------------------------------
CYSI_YERE8      VMRVTGCPNGCGRALLAEMGLVGKAVGRY-----------------------------------------
CYSI_VIBPA      ILRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
YDHY_SHIFL      -----------------------------DHKRCIGCSACTTACPWMMA-TVNTESKK----SSKCVLCG
YDHY_ECOLI      -----------------------------DHKRCIGCSACTTACPWMMA-TVNTESKK----SSKCVLCG
YDHY_ECO57      -----------------------------DHKRCIGCSACTTACPWMMA-TVNTESKK----SSKCVLCG
NDHI_TRIBB      ----------------------------FEFDKCIACEVCVRVCPKLETHIRKKRLLNYSIDFGICIFCG
NDHI_SORBI      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_SACOF      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_SACHY      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_ORYSJ      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_ORYSI      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_ORYSA      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_ORYNI      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_OLIPU      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_NASOF      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_MAIZE      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_LOBMA      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_LEPVR      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_HOFFA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DRIGR      ----------------------------FEFDKCIACEVCVRVCPRLETDIRKKRLLNYSIDFGICIFCG
NDHI_CRUWA      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_CHAPD      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_BARVE      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
FER_CLOST       ---------------------------------CISCGACEPECP---VNAITAGDDKYVIDAATCIDCG
ECM17_YEAST     ----------------------------------------------------------------------
DSVA_DESVH      KFKFDACPNGCVASARSDFSVIGTWKDEFKPNAGAHSGEVVNRCPSK---CMKWDGSKLSIDNKECVRCM
YJGC_BACSU      ---------------------------RYDPDQCILCGRCVEACQDQVTETLTIDRPRVIWDNSSCVSCG
PORD_PYRFU      -------------------------KPEFNRDKCVRCYLCYIYCPEPAI-YLDEEGYPVF-DYDYCKGCG
NDHI_SOYBN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKQLLNYSIDFGICIFCG
NDHI_RANMC      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_RAIAR      ----------------------------FEFDKCIACEVCVRVCPID----LPVVDWKLENDIRKCIFCG
NDHI_PELHO      ----------------------------FEFDKCIACEVCVRVCPID----LPVVDWKFERDIRKCIFCG
NDHI_NANDO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_JASNU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DIOEL      ----------------------------FEFDKCIACEVCVRVCPEKNIKKKQLLNYSI--DFGFCIFCG
NDHI_CYAP4      -------PSERFRGRIH-----------FEFDKCISCEVCVRVCPNKELKKKQLKHYSI--DFGVCIFCA
NDHI_CUCSA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_CAPBU      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_AGRST      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
FER_MEGEL       -------------------------------DECVKCGACASTCP---TGAIEEGETKYVVTDS-CIDCG
FER_CLOPA       ---------------------------------CVSCGACASECP---VNAISQGDSIFVIDADTCIDCG
FER_CLOBU       ---------------------------------CVSCGACAGECP---VSAITQGDTQFVIDADTCIDCG
FER_CLOAC       ---------------------------------CISCGACEPECP---VNAISSGDDRYVIDADTCIDCG
CYSI_VIBHB      ILRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_VIBFM      IFRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_VIBF1      IFRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
Y51B_METJA      --------------------------PVIDEGSCVACANCIEVCP---TGVLEMDKHRVETEGEVCVRCG
NDHI_VENCA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_TOBAC      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SOLTU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SOLLC      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SOLBU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_SILPE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_RIEOB      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_RENSL      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PSEAR      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_POLCN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PHIZI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_PARHY      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_OTESC      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_NICTO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_NICSY      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_MONCO      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_LOXSI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_LOTJA      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_LAYHE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_LACSA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_JAUCA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_JAEHI      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_HYMFF      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_GUATU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ERIST      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ERICN      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ENGPE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_DRANE      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_DAUCA      ----------------------------FEFDKCIACEVCVRVCPID----LPVVDWKLEKDIRKCIFCG
NDHI_CALME      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ATRBE      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
NDHI_ARATH      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_ARAHI      ----------------------------FEFDKCIACEVCVRVCPKLETNIRKKRLLNYSIDFGICIFCG
NDHI_AETGR      ----------------------------FEFDKCIACEVCVRVCPKLETHIRKKRLLNYSIDFGICIFCG
NDHI_AETCO      ----------------------------FEFDKCIACEVCVRVCPKLETPIRKKRLLNYSIDFGICIFCG
NDHI_ACOCL      ----------------------------FEFDKCIACEVCVRVCPRLDTDVRKKQLLNYSIDFGVCIFCG
NDHI_ACMRA      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
HMC2_DESVH      ------------------YNAAGLDHPVFRKQQCNHCPACASACFVKAF--TKNPDGSVTYDGSLCVGCR
DSRA_CHRVI      KVS--GCPNDCQNAERSDFAVLGMKVDQAEKGRQYYIDNVITRCPTKALSLNDDDTLDV--NNRDCVRCM
CYSI_VIBCM      ILRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_VIBCH      ILRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALTI      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALSV      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALPC      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALPB      VMRVTGCPNGCGRAMLAELGLVGKAPGRY-----------------------------------------
CYSI_SALNS      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALHS      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALG2      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALEP      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALDC      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALCH      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_PHOLL      VLRVTGCPNGCARAMLAEVGLVGKALDRY-----------------------------------------
CYSI_ENTS8      VLRVTGCPNGCGRAMLAELGLVGKAPGRY-----------------------------------------
PORD_METJA      --------------------------PILDNEKCVKCENCYIFCPEGAIQEDENGNFKI--DYDYCKGCL
NIRB_ECOLI      KFGVSGCTRECSEAQGKDVGII------------------------------------------------
NDHI_PLAOC      ----------------------------FEFDKCIACEVCVRVCPID----LPVVNWRLETDIRKCIFCG
NDHI_PHODC      ----------------------------FEFDKCIACEVCVRVCPID----LPVVDWRFERDIKKCIFCG
NDHI_PHAVU      ----------------------------FEFDKCIACEVCVRVCPKLETDIRKKRLLNYSIDFGICIFCG
FER_METTE       ---------------------------------CTGCGSCVDECPAAAI-SLNDDGIATV-DESECLDCG
FER_ENTHI       ---------------------------------CVACGACSGTCPQSV---LEVNDHVEIKNPDDCIGCG
FER6_METJA      --------------------------------KCVGCGNCVVFCPRRAIKTYGV----AIVDENKCSNCG
CYSI_COLP3      ILRVTGCPNGCGRAMLAEIGLVGKGPGKY-----------------------------------------
SIR2_MYCPA      EIAYIGQPDFADLPRKYKTAISGLQDVAHEVN--------------------------------------
PORD_PYRHO      -------------------------KPEFHKDKCVRCFLCYIYCPEPAI-YLDEEGYPVF-DYDYCKGCG
NQO9_RHOMR      ------------------------------RPRCVACGLCARACPPLAISMQAKEVDDVKENMLRCIYCG
NDHI_MESVI      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPIN----LPVVNWEFXXDFGVCIFCG
NDHI_CORPT      ----------------------------FEFDKCIACEVCVRVCPETDIRKKRLVNYSI--DFGICIFCG
NDHI_CHLAT      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPIN----LPVVNWEFXXDFGVCIFCG
NDHI_CALFG      ----------------------------FEFDKCIACEVCVRVCPRLETDIRKKRLLNYSIDFGICIFCG
NDHI_BUXMI      ----------------------------FEFDKCIACEVCVRVCPKLETYIRKKRLLNYSIDFGICIFCG
NDHI_ADICA      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPXXXXXXXXXXNYSI--DFGVCIFCG
NDHI_ACAM1      -------PSERFRGRIH-----------FEFDKCISCEVCVRVCPINLP-VVDWEFNKEIKDFGVCIFCA
IORA_ARCFU      VIARQPCAILWSRARRREGKIVTYKVTE-------DCTLCMECVNTFACPALIFDGEKVSIDQSLCVGCA
FER_CLOTS       -------------------------------DECISCGACAAECPVEA---IHEGTGKYEVDADTCIDCG
CYSI_SALTY      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALPK      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALPA      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALA4      VMRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_PROMH      VVRVTGCPNGCGRAMLAEVGLVGKAPDRY-----------------------------------------
CYSI_CITK8      VLRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
VORD_PYRHO      --------------------------PVIDESKCVKCYICWKYCPEPAIYIK--EDGFVAIDYDYCKGCG
VORD_PYRAB      --------------------------PVIDESKCVKCYICWKFCPEPAIYIK--EDGFVAIDYDYCKGCG
NDHI_WHEAT      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
NDHI_THEEB      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPNKELKKKELKHYSI--DFGVCIFCA
NDHI_PANGI      ----------------------------FEFDKCIACEVCVRVCPID----LPVVDWKLEMDIRKCIFCG
NDHI_NYMAL      ----------------------------FEFDKCIACEVCVRVCPRLETDIRKKRLLNYSIDFGICIFCG
NDHI_NUPAD      ----------------------------FEFDKCIACEVCVRVCPRLETDIRKKRLLNYSIDFGICIFCG
NDHI_LIRTU      ----------------------------FEFDKCIACEVCVRVCPRLETDIRKKRLLNYSIDFGICIFCG
NDHI_ILLOL      ----------------------------FEFDKCIACEVCVRVCPRLETDIRKKRLLNYSIDFGICIFCG
NDHI_HORVU      ----------------------------FEFDKCIACEVCVRVCPEKDIKRKQLLNYSI--DFGVCIFCG
FERA_METJA      --------------------------------KCGYCGACVGVCEKLAINLIEHI---IVIDEKKCNNCK
CYSI_VIBC3      ILRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SALAR      VLRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
NDHI_AMBTC      ----------------------------FEFDKCIACEVCVRVCPRFETDIRKKRLLNYSIDFGICIFCG
NASB_BACSU      PISISSCETDCTEAALQDVGAI------------------------------------------------
FER2_DESNO      -----------------------------DSDKCIGCGECVDVCPVEV---YELQNGKAVPNEEECLGCE
FDNH_SHIFL      K--------SWTVMRFSETEQNGKLEWLIRKDGCMHCEGCLKACPS-AGAIIQYANGIVDFQSENCIGCG
FDNH_ECOLI      K--------SWTVMRFSETEQNGKLEWLIRKDGCMHCEGCLKACPS-AGAIIQYANGIVDFQSENCIGCG
RNFB_HAEDU      ---------------------------------CIGCTKCIQACPVDAIIGTNKAMHTVVAD--LCTGCE
PHFL_DESVO      ---------------------------QIDESKCIGCDSCQQYCPTGAIFGDTGDAHKIPHE-ELCINCG
NUOI_SHEWM      -------------------GRIVLTRDPDGEERCVACNLCSVACPEKEDGRWEAESFTI--NFSRCIMCG
NUOI_RHOSR      --------------------------------KCIGCELCAWACPADAIYVEGADNTDEERFSPRCIGCG
NUOI_RHOOB      --------------------------------KCIGCELCAWACPADAIFVEGADNTDEERYSPRCIGCG
NUOI_ENTS8      -------------------GRIVLTRDPDGQERCVACNLCAVACP---VGCISLQKAETV-DGSRCIFCG
NUOI_BLOPB      -------------------GRIVLTRDSSGRERCVACNLCAVACKGESTDGRWYPKFFRI-NFSRCIFCG
NUOI1_SOLUE     --------------------------------KCVACFLCAAACPSNCIYIEAAENTDKIRDYNRCIFCG
CYSI_ZYMMO      VFRTTGCPNNCGRSLLAEIGLVGRAIGRY-----------------------------------------
CYSI_ECOSM      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
VORD_PYRFU      -------------------------KPVVNEEKCVKCYICWKYCPEPAI-YIKPDGYVAI-DYDYCKGCG
RNFB_SODGM      -----------------------------DEGNCIGCTKCIQACPVDAIVGATRAVHTVVSD--LCTGCD
PSAC_EUGGR      -------------------------------NTCIGCTQCVRACPTDVLEMVPWDGCKAGQIASSCVGCK
PSAC_ANTFO      ---------------------------------CIGCTQCVRACPTDVLEMISWDGCKANQIASDCVGCK
NUOI_RHOE4      --------------------------------KCIGCELCAWACPADAIYVEGADNTEEERFSPRCIGCG
NUOI2_ACIBL     ----------------------GMHVLQRDENKCVACFLCAAACPSNCIYIEAAENTETNRDYNRCIFCG
NUOI1_SYNFM     -------------------------------HKCIACGTCERMCKAQPKGAKVATHYVI--DFTRCSLCG
NIRB_KLEOX      KMAVSGCTRECAEAQGKDIGVI------------------------------------------------
NDHI_TRIEI      -------PSERFRGRIH-----------FEYDKCIACEVCVRVCPNXXXXXXXXXHYSI--DFGVCIFCG
CYSI_SODGM      ILRVTGCSNGCGRAMLAEIGLVGKAIGRY-----------------------------------------
CYSI_KLEP7      VTRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ERWCT      VLRVTGCPNGCGRSMLAEIGLVGKAMGRY-----------------------------------------
CYSI_BAUCH      ELRVTGCPNGCGRAMLAEIGLVGKTIGRY-----------------------------------------
VHCB_METVO      ------CPNDAIMVKGLELPSRAKTERANEFKMCDLCGTCVSACPTEAMGKIEKEYDRIEFTPSLCDSCG
SIR_DESVH       KVGISGCPFCCGESYLRDVGLVG-----------------------------------------------
RNFB_TOLAT      -------------------------------NLCIGCTKCIQACPVDAIIGAPKLMHTILR--SECTGCD
PSAC_PINKO      ---------------------------------CIGCTQCVRACPTDVLEMIPWEGCKAKQIASDCVGCK
PSAC_DIOEL      ---------------------------------CIGCTQCVRACPTDVLEMIPWNGCKAKQIASACVGCK
PSAC_CYCTA      ---------------------------------CIGCTQCVRACPTDVLEMIPWEGCKAKQIASDCVGCK
NUOI_MYCA1      --------------------------------KCIGCELCAWACPADAIYVEGADNTEELRYSPRCIGCG
NUOI2_MYCPA     --------------------------------KCIGCELCAWACPADAIYVEGADNTEELRYSPRCIGCG
NUOI1_MYCPA     --------------------------------KCIGCELCAWACPADAIFVESADNTEAERFSPRCIGCG
NDHI_ANTFO      -------PSERFRGRIH-----------FEFDKCIACEVCVRVCPXXXXXXXXXXSYSI--DFGVCIFCG
MAUN_PARDP      ------------------------------RDACDNCGACFSTCPEPIVPALKGEGSPLILSGD-CINCG
FWDF_METJA      -----------------------------DKDACVTCGWCAFICPAEAIEVEKPFKGELIIDVNACNACG
FDXH_HAEIN      ------------------------------KDGCMHCTGCLKACP--APGAIQYANGIVDFQSDKCIGCG
CYSI_SHESR      ----------------------------------------------------------------------
CYSI_SHESM      ----------------------------------------------------------------------
CYSI_SHESA      ----------------------------------------------------------------------
CYSI_SHEON      ----------------------------------------------------------------------
CYSI_PSEHT      IMRVVGCPNGCGRAMLAEAGLVGKGPGKY-----------------------------------------
CYSI_KLEP3      VTRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_BLOFL      ILRVTGCPNGCARAMLAEIGLTG-----------------------------------------------
Y934_METJA      ---------------------------------CIGCGLCVDVCPTNAIKIFSFRE-------TICSVCG
Y51A_METJA      ----------------------------YISERCASCLVCLRNCP---FNAIEEYGSKIRIDINKCELCG
Y264_METJA      --------------------------------KCMHCNPCLYACPENAIERI---NNKVVVIKDKCVGCG
RNFC_RHOCA      -------------------GILALTAPEAKTMPCIRCGRCVQGCP---VGLTPFELNARIHAGDDCLACG
RNFB_SHISS      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SHIDS      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SHIB3      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALTY      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALTI      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALSV      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALPK      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALPC      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALPB      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALPA      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALNS      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALHS      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALG2      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALEP      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALDC      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALCH      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALAR      -----------------------------DENHCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_SALA4      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOUT      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOSM      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOSE      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOLU      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOLI      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOLC      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOL6      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOL5      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOK1      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOHS      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECODH      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECOBW      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO8A      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO81      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO7I      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO5E      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO57      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO55      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO45      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO27      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_ECO24      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_BUCAT      -------------------------------SNCVGCSKCASFCPVDAVGAPNFIH-TVLQEF--CTGCN
RNFB_BUCAI      -------------------------------SNCVGCSKCASFCPVDAVGAPNFIH-TVLQEF--CTGCN
RNFB_BUCA5      -------------------------------SNCVGCSKCASFCPVDAVGAPNFIH-TVLQEF--CTGCN
PSAC_RHDSA      ---------------------------------CIGCTQCVRACPCDVLEMVSWDGCKAGQIASACIGCK
PSAC_NOSS9      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAAQIASSCVGCK
PSAC_NOSS8      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAAQIASSCVGCK
PSAC_NOSP7      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAAQIASSCVGCK
PSAC_MICAN      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKAAQIASSCIGCK
PSAC_FREDI      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAAQIASSCVGCK
PSAC_ANAVT      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAAQVASSCVGCK
PSAC_ANASP      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAAQVASSCVGCK
NUOI_COXBU      -------PDEEVPSSFRFRGMLALRRYPNGEERCIACKLCEAVCPREADGSRRTTLYDI--DAFKCINCG
NUOI_COXBR      -------PDEEVPSSFRFRGMLALRRYPNGEERCIACKLCEAVCPREADGSRRTTLYDI--DAFKCINCG
NUOI_COXBN      -------PDEEVPSSFRFRGMLALRRYPNGEERCIACKLCEAVCPREADGSRRTTLYDI--DAFKCINCG
NUOI_ACIAD      -------------------GRIVLTRDPDGEERCVACNLCAVACPEKEDGRWYPEFFRI--NFSRCIFCG
NDHI_SYNJA      -------PSERFRGRIH-----------FEFDKCIACEICVRVCPIDLTELKKKELYSYSIDFGVCIFCA
FER_CLOTM       ---------------------------------CISCGACESECP---VSPISPGDSVYVIDADACIECG
FER7_METJA      -----------------------------DREKCIGCGRCYDVCPKGPLIWTKDENGKYAYDVEYCHNCK
FER3_RHISN      --------------------------PQYDAMTCIGCGRCFKVCSREVMGACDGEDIMVVDHAGRCIGCG
FER2_METJA      --------------------------------KCVHCGCCITQCPINVI--YMDEDYNVVFKEEDCVGCK
CYSI_VIBVU      ILRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
ACDA_METJA      --------------------------------QCTECGWCNRNCPKEAMALAKQGNFKGFIDLYKCYGCG
YGFT_ECOLI      ---------------------------------------CVTACP---VNALTFQSDSVQLDEQKCIGCK
SIR_MYCTU       ----------------------------------------------------------------------
SIR_MYCBO       ----------------------------------------------------------------------
RNFB_VIBHB      ----------------HDLDSKVKTVAFIHEDMCIGCTKCIQACPVDAIVGGTKALHTVIKD--ECTGCD
RNFB_SHIFL      -----------------------------DENNCIGCTKCIQACPVDAIVGATRVMHTVMSD--LCTGCN
RNFB_SHIBS      -----------------------------DENNCIGCTKCIQACPVDAIVGATRVMHTVMSD--LCTGCN
RNFB_RHOCA      -----------------DAGPIAEIEPMVAEDHCTGCQKCFKRCPTDAIVGGAKQIHTVVMDA--CIGCD
RNFB_ESCF3      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_CITK8      -----------------------------DENNCIGCTKCIQACPVDAIVGATRAMHTVMSD--LCTGCN
RNFB_BUCBP      ---------------------------EIDENNCVGCSKCRLVCPVDAVGTYNFRHTVLI---DSCTGCN
PSAC_SYNY3      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKAAQIASSCVGCK
PSAC_PROM9      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKAAQIASSCVGCK
PSAC_PROM4      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKAAQIASSCVGCK
PSAC_MARPO      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKANQIASACVGCK
PSAC_CYAP8      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKAAQIASSCVGCK
PSAC_CYAP7      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKAAQIASSCVGCK
NUOI_SHISS      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_SHIFL      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_SHIF8      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_SHIDS      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKTET-KDGSRCIFCG
NUOI_SHIBS      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_SHEON      -------PEEAVYAAPRYRGRIVLTRDPDGDERCVACNLCAVACSERDDGRWYPEFFRI--NFSRCIFCG
NUOI_SALTY      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_SALTI      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_SALPA      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_SALCH      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_MYCGI      --------------------------------KCIGCELCAWACPADAIFVEGADNTEAERYSPRCIGCG
NUOI_ERWT9      -------------------GRIVLTRDPDGQERCVACNLCAVACPETADGRWYPEFFRI--NFSRCIFCG
NUOI_ERWCT      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_ECOUT      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_ECOLI      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_ECOL6      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_ECOL5      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_ECOK1      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_ECO57      -------------------GRIVLTRDPDGEERCVACNLCAVACP---VGCISLQKAET-KDGSRCIFCG
NUOI_ACIBY      -------------------GRIILTRDPDGEERCVACNLCAVACPEKEDGRWYPEFFRI--NFSRCIFCG
NUOI_ACIBT      -------------------GRIILTRDPDGEERCVACNLCAVACPEKEDGRWYPEFFRI--NFSRCIFCG
NUOI_ACIBS      -------------------GRIILTRDPDGEERCVACNLCAVACPEKEDGRWYPEFFRI--NFSRCIFCG
NUOI_ACIBC      -------------------GRIILTRDPDGEERCVACNLCAVACPEKEDGRWYPEFFRI--NFSRCIFCG
NUOI2_RHOS4     -------------------GRIVLTRDPDGQERCVACNLCAAACPETPDGRWYPESFRI--NFARCIFCG
NUOI2_RHOS1     -------------------GRIVLTRDPDGQERCVACNLCAAACPETPDGRWYPESFRI--NFARCIFCG
NDHI_SYNJB      -------PSERFRGRIH-----------FEFDKCIACEICVRVCKKKELYSYSI-------DFGVCIFCA
FER1_RHORU      ---------------------------------CISCGACAAECP---VNAIEQGDTIFVVNADTCIDCG
CYSI_SHIFL      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_SHIF8      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
Y1684_METTH     ----------------------GDVRPVHHPERCTDCAVCL-AARRCPTHAIDNG-----LDLDRCFGCG
RNFB_VIBSL      ----------------HDLDNKVKTVAFIHEDMCIGCTKCIQACPVDAIVGGTKALHTVIKD--ECTGCD
RNFB_VIBPA      ----------------HDLDSKVPTVAFIHEDMCIGCTKCIQACPVDAIVGGTKAVHTVIKD--ECTGCD
RNFB_RHOS4      -------------------------------DHCTGCMRCFKRCPTDAIIGANRQIHTVVTDA--CIGCN
RNFB_RHOS1      -------------------------------DHCTGCMRCFKRCPTDAIIGANRQIHTVVTDA--CIGCN
RNFB_HAEIN      -----------------------------DENMCIGCTKCIQACPVDAIIGTNKAMHTIIPD--LCTGCE
RNFB_HAEIE      -----------------------------DENMCIGCTKCIQACPVDAIIGTNKAMHTIIPD--LCTGCE
RNFB_HAEI8      -----------------------------DENMCIGCTKCIQACPVDAIIGTNKAMHTIIPD--LCTGCE
RNFB_AERS4      -------------------------------DQCIGCTKCIQACPVDAIVGATKAMHTVITD--ECTGCD
RNFB_AERHH      -------------------------------DQCIGCTKCIQACPVDAIVGATKAMHTVIAD--ECTGCD
PSAC_ZYGCR      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKASQIASACVGCK
PSAC_WHEAT      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_VITVI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_TOBAC      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_STAPU      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKASQIASACVGCK
PSAC_SPIOL      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_SOYBN      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_SORBI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_SOLTU      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_SOLLC      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_SOLBU      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_SECCE      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_SACOF      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_SACHY      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_PSEPI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_POPTR      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_POPAL      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_PLAOC      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_PIPCE      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_PHAAO      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_PELHO      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_PANGI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_ORYSJ      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_ORYSI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_ORYSA      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_ORYNI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_OLIPU      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_OENEH      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_NYMAL      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_NICTO      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_NICSY      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_NASOF      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_NANDO      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_MORIN      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_MASLA      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAQQIASSCVGCK
PSAC_LOTJA      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_LOLPR      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_LOBMA      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_LEPVR      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_LACSA      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_JASNU      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_IPOPU      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_HORVU      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_HELAN      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_GOSHI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_GOSBA      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_EUCGG      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_DRANE      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_DAUCA      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_CUSRE      ---------------------------------CIGCTQCVRACPTDVLEMIPWDRCKAKQIASACVGCK
PSAC_CUSOB      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_CUSGR      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_CUSEX      ---------------------------------CIGCTQCVRACPTDVLEMIPWDRCKAKQIASACVGCK
PSAC_CRUWA      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_COFAR      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_CITSI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_CHAVU      ---------------------------------CIGCTQCVRACPTDVLEMIPWQGCKAKQIASACVGCK
PSAC_CHAGL      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKANQIASSCVGCK
PSAC_CAPBU      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_CALFG      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_BUXMI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_BARVE      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_ATRBE      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_ARATH      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_ARAHI      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_AMBTC      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_AGRST      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_AETGR      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_AETCO      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_AEGTA      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PSAC_ACOCL      ---------------------------------CIGCTQCVRACPTDVLEMIPWDGCKAKQIASACVGCK
PHFL_DESVH      ---------------------------QIDEAKCIGCDTCSQYCPTAAIFGEMGEPHSIPHIEA-CINCG
NUOI_AERHH      -------PEQAVYAAPRYRGRIVLTRDPDGDERCVACNLCAVACSEREDGRWYPEFFRI--NFSRCIFCG
NUOI2_AQUAE     ---------------------------EYGKSRCVVCLRCKRACKKLPNGKRVVSVFNM--NMLLCTYCG
FER_PYRIL       -----------------------------DQDICISCGACVAACPYQALEL--DENGKSRLIWEKCKDDF
CYSI_VIBVY      ILRVTGCPNGCGRAMLAEIGLVGKAPGRY-----------------------------------------
CYSI_SHISS      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_SHIDS      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_SHIBS      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_SHIB3      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_NEIMA      VTRITGCPNGCGRAMLAEIGLVGKAVGRY-----------------------------------------
CYSI_ESCF3      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOUT      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOSE      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOLU      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOLI      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOLC      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOL6      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOL5      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOK1      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOHS      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECOBW      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO8A      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO81      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO7I      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO5E      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO57      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO55      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO45      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO27      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_ECO24      VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
CYSI_BLOPB      ----------------------------------------------------------------------
RNFC_SERP5      --------------------------PQEQEQSCIRCGLCVDACPAGLLPQQLYEEHEKARNHNDCIECG
RNFB_VIBVY      ---------------------------------CIGCTKCIQACPVDAIVGGTKALHTVIKD--ECTGCD
RNFB_VIBVU      ---------------------------------CIGCTKCIQACPVDAIVGGTKALHTVIKD--ECTGCD
PSAC_TRIEI      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKAGQIASSCIGCK
PSAC_THEVL      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAGQIASSCVGCK
PSAC_THEEB      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAGQIASSCVGCK
PSAC_SYNEN      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAGQIASSCVGCK
PSAC_PROMT      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKASQIASSCVGCK
PSAC_PROM1      ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKASQIASSCVGCK
PSAC_PINTH      ---------------------------------CIGCTQCVRACPTDVLEMIPWEGCKAKQIASDCAGCK
PSAC_PHYPA      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKASQIASACVGCK
PSAC_PHATR      ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAGQIASSCVGCK
PSAC_OLTVI      ---------------------------------C