[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81145.1

[Show Plain Result]


## Summary of Sequence Search
    1::263
   16::272     1e-68  44%  272 aa  ASRB_SALTY RecName: Full=Anaerobic sulfite reductase subunit B;
   20::228     2e-27  39%  233 aa  PYRK_PYRKO RecName: Full=Probable dihydroorotate dehydrogenase
   20::222     5e-27  42%  247 aa  PYRK_PYRHO RecName: Full=Probable dihydroorotate dehydrogenase
   21::240     8e-27  36%  246 aa  PYRK_CLOPE RecName: Full=Dihydroorotate dehydrogenase electron
    9::223     1e-26  35%  250 aa  PYRK_THEVO RecName: Full=Probable dihydroorotate dehydrogenase
    3::239     2e-25  32%  259 aa  PYRK_METMA RecName: Full=Probable dihydroorotate dehydrogenase
   20::222     2e-25  38%  247 aa  PYRK_PYRAB RecName: Full=Probable dihydroorotate dehydrogenase
    3::236     2e-24  31%  259 aa  PYRK_METBF RecName: Full=Probable dihydroorotate dehydrogenase
   20::230     5e-22  36%  247 aa  PYRK_PYRFU RecName: Full=Probable dihydroorotate dehydrogenase
    2::226     2e-21  31%  232 aa  PYRK_ARCFU RecName: Full=Probable dihydroorotate dehydrogenase
    3::235     3e-21  28%  258 aa  PYRK_UNCMA RecName: Full=Probable dihydroorotate dehydrogenase
    3::236     7e-21  32%  259 aa  PYRK_METAC RecName: Full=Probable dihydroorotate dehydrogenase
    4::232     1e-20  33%  257 aa  PYRK_METJA RecName: Full=Probable dihydroorotate dehydrogenase
   26::223     3e-20  32%  250 aa  PYRK_THEAC RecName: Full=Probable dihydroorotate dehydrogenase
   25::241     1e-19  32%  266 aa  PYRK_METTH RecName: Full=Probable dihydroorotate dehydrogenase
    1::237     1e-19  32%  246 aa  PYRK_CLOAB RecName: Full=Dihydroorotate dehydrogenase electron
    3::242     2e-18  31%  259 aa  PYRK_METBU RecName: Full=Probable dihydroorotate dehydrogenase
   20::258     3e-17  31%  258 aa  PYRK_STRMU RecName: Full=Dihydroorotate dehydrogenase electron
  104::264     2e-16  33%  296 aa  MCR1_KLULA RecName: Full=NADH-cytochrome b5 reductase 2;       
   26::247     8e-16  32%  254 aa  PYRK_LISIN RecName: Full=Dihydroorotate dehydrogenase electron
   26::247     1e-15  33%  254 aa  PYRK_LISMH RecName: Full=Dihydroorotate dehydrogenase electron
   31::254     1e-15  32%  254 aa  PYRK_LISMO RecName: Full=Dihydroorotate dehydrogenase electron
   16::249     7e-15  31%  256 aa  PYRK_BACLD RecName: Full=Dihydroorotate dehydrogenase electron
   26::247     1e-14  33%  254 aa  PYRK_LISMF RecName: Full=Dihydroorotate dehydrogenase electron
   19::249     1e-14  30%  256 aa  PYRK_BACSU RecName: Full=Dihydroorotate dehydrogenase electron
    6::249     1e-14  29%  256 aa  PYRK_BACA2 RecName: Full=Dihydroorotate dehydrogenase electron
    3::252     2e-14  31%  296 aa  YADH_CLOBE RecName: Full=Uncharacterized protein in adh 3'region;
   30::247     2e-14  33%  254 aa  PYRK_LISMC RecName: Full=Dihydroorotate dehydrogenase electron
   16::249     2e-14  33%  258 aa  PYRK_BACP2 RecName: Full=Dihydroorotate dehydrogenase electron
    4::255     3e-14  30%  262 aa  PYRK_LACLM RecName: Full=Dihydroorotate dehydrogenase electron
   21::255     3e-14  31%  262 aa  PYRK_LACLA RecName: Full=Dihydroorotate dehydrogenase electron
   94::256     4e-14  31%  284 aa  NCB5R_YEAST RecName: Full=NADH-cytochrome b5 reductase 1;       
   32::246     5e-14  30%  282 aa  PYRK_THEMA RecName: Full=Probable dihydroorotate dehydrogenase
  147::299     5e-14  31%  331 aa  MCR1_MAGGR RecName: Full=NADH-cytochrome b5 reductase 2;       
   34::252     6e-14  35%  259 aa  PYRK_BACCQ RecName: Full=Dihydroorotate dehydrogenase electron
   18::251     8e-14  30%  259 aa  PYRK_FUSNN RecName: Full=Dihydroorotate dehydrogenase electron
   30::247     1e-13  32%  254 aa  PYRK_LISW6 RecName: Full=Dihydroorotate dehydrogenase electron
    4::255     1e-13  30%  262 aa  PYRK_LACLS RecName: Full=Dihydroorotate dehydrogenase electron
  138::290     1e-13  29%  322 aa  MCR1_EMENI RecName: Full=NADH-cytochrome b5 reductase 2;       
   35::240     2e-13  29%  262 aa  PYRK_METKA RecName: Full=Probable dihydroorotate dehydrogenase
  128::269     3e-13  33%  301 aa  MCR1_CANAL RecName: Full=NADH-cytochrome b5 reductase 2;       
   84::280     4e-13  34%  308 aa  NCB5R_LACBS RecName: Full=NADH-cytochrome b5 reductase 1;       
  126::268     4e-13  30%  300 aa  MCR1_LODEL RecName: Full=NADH-cytochrome b5 reductase 2;       
   94::256     9e-13  30%  284 aa  NCB5R_YEAS7 RecName: Full=NADH-cytochrome b5 reductase 1;       
  106::256     9e-13  30%  284 aa  NCB5R_PICST RecName: Full=NADH-cytochrome b5 reductase 1;       
  113::272     1e-12  30%  300 aa  NCB5R_LODEL RecName: Full=NADH-cytochrome b5 reductase 1;       
  177::314     1e-12  31%  350 aa  MCR1_USTMA RecName: Full=NADH-cytochrome b5 reductase 2;       
  169::296     1e-12  31%  328 aa  NCB5R_ARATH RecName: Full=NADH-cytochrome b5 reductase-like
  128::292     1e-12  27%  324 aa  MCR1_AJECN RecName: Full=NADH-cytochrome b5 reductase 2;       
  162::304     2e-12  31%  336 aa  MCR1_PHANO RecName: Full=NADH-cytochrome b5 reductase 2;       
  113::267     2e-12  29%  299 aa  MCR1_DEBHA RecName: Full=NADH-cytochrome b5 reductase 2;       
  145::307     3e-12  35%  309 aa  NB5R2_DANRE RecName: Full=NADH-cytochrome b5 reductase 2;       
  157::310     3e-12  25%  343 aa  MCR1_NEUCR RecName: Full=NADH-cytochrome b5 reductase 2;       
  118::259     3e-12  29%  291 aa  MCR1_YARLI RecName: Full=NADH-cytochrome b5 reductase 2;       
  141::293     7e-12  27%  325 aa  MCR1_COCIM RecName: Full=NADH-cytochrome b5 reductase 2;       
  757::913     1e-11  32%  917 aa  NIA2_ARATH RecName: Full=Nitrate reductase [NADH] 2;       
  126::266     1e-11  28%  298 aa  MCR1_PICST RecName: Full=NADH-cytochrome b5 reductase 2;       
    7::240     1e-11  30%  247 aa  PYRK_THETN RecName: Full=Dihydroorotate dehydrogenase electron
   35::250     1e-11  31%  257 aa  PYRK_GEOSW RecName: Full=Dihydroorotate dehydrogenase electron
  755::922     2e-11  26%  926 aa  NIA_SPIOL RecName: Full=Nitrate reductase [NADH];         Short=NR;
  164::315     2e-11  31%  348 aa  MCR1_CHAGB RecName: Full=NADH-cytochrome b5 reductase 2;       
  160::314     2e-11  26%  346 aa  MCR1_BOTFB RecName: Full=NADH-cytochrome b5 reductase 2;       
  138::290     2e-11  26%  322 aa  MCR1_ASPCL RecName: Full=NADH-cytochrome b5 reductase 2;       
  134::273     2e-11  28%  306 aa  MCR1_ASHGO RecName: Full=NADH-cytochrome b5 reductase 2;       
   21::256     2e-11  32%  263 aa  PYRK_ENTFA RecName: Full=Dihydroorotate dehydrogenase electron
  138::290     3e-11  26%  322 aa  MCR1_ASPNC RecName: Full=NADH-cytochrome b5 reductase 2;       
  781::907     4e-11  31%  911 aa  NIA_SOLLC RecName: Full=Nitrate reductase [NADH];         Short=NR;
  161::313     4e-11  25%  345 aa  MCR1_SCLS1 RecName: Full=NADH-cytochrome b5 reductase 2;       
   93::253     5e-11  28%  281 aa  NCB5R_KLULA RecName: Full=NADH-cytochrome b5 reductase 1;       
   97::236     5e-11  32%  287 aa  NCB5R_ASHGO RecName: Full=NADH-cytochrome b5 reductase 1;       
  243::403     6e-11  25%  408 aa  NQRF_IDILO RecName: Full=Na(+)-translocating NADH-quinone reductase
  747::906     6e-11  26%  918 aa  NIA_CUCMA RecName: Full=Nitrate reductase [NADH];         Short=NR;
  103::262     6e-11  29%  290 aa  NCB5R_YARLI RecName: Full=NADH-cytochrome b5 reductase 1;       
   97::257     1e-10  31%  285 aa  NCB5R_VANPO RecName: Full=NADH-cytochrome b5 reductase 1;       
  242::402     1e-10  25%  407 aa  NQRF_METCA RecName: Full=Na(+)-translocating NADH-quinone reductase
  139::291     1e-10  26%  323 aa  MCR1_NEOFI RecName: Full=NADH-cytochrome b5 reductase 2;       
  779::891     2e-10  29%  909 aa  NIA_PETHY RecName: Full=Nitrate reductase [NADH];         Short=NR;
  757::913     2e-10  32%  917 aa  NIA1_ARATH RecName: Full=Nitrate reductase [NADH] 1;       
  106::256     2e-10  29%  284 aa  NCB5R_PICGU RecName: Full=NADH-cytochrome b5 reductase 1;       
   32::249     2e-10  28%  256 aa  PYRK_STRR6 RecName: Full=Dihydroorotate dehydrogenase electron
  243::403     2e-10  24%  408 aa  NQRF_PSEA6 RecName: Full=Na(+)-translocating NADH-quinone reductase
  744::886     2e-10  29%  904 aa  NIA2_TOBAC RecName: Full=Nitrate reductase [NADH] 2;       
  731::878     2e-10  27%  890 aa  NIA2_PHAVU RecName: Full=Nitrate reductase [NADH] 2;       
   35::252     3e-10  31%  259 aa  PYRK_BACHD RecName: Full=Dihydroorotate dehydrogenase electron
  117::257     3e-10  32%  285 aa  NCB5R_CANGA RecName: Full=NADH-cytochrome b5 reductase 1;       
   26::243     4e-10  28%  250 aa  PYRK_STRPN RecName: Full=Dihydroorotate dehydrogenase electron
   21::250     4e-10  31%  257 aa  PYRK_LYSSC RecName: Full=Dihydroorotate dehydrogenase electron
  741::882     5e-10  27%  900 aa  NIA_LOTJA RecName: Full=Nitrate reductase [NADH];         Short=NR;
  117::284     5e-10  25%  286 aa  NCB5R_DICDI RecName: Full=NADH-cytochrome b5 reductase 1;       
  242::402     7e-10  23%  407 aa  NQRF_SERP5 RecName: Full=Na(+)-translocating NADH-quinone reductase
  243::401     7e-10  29%  408 aa  NQRF_MARMS RecName: Full=Na(+)-translocating NADH-quinone reductase
  744::886     7e-10  28%  904 aa  NIA1_TOBAC RecName: Full=Nitrate reductase [NADH] 1;       
   21::257     9e-10  29%  257 aa  PYRK_STRTD RecName: Full=Dihydroorotate dehydrogenase electron
  242::402     1e-09  21%  407 aa  NQRF_YERPS RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::402     1e-09  21%  407 aa  NQRF_YERPP RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::402     1e-09  21%  407 aa  NQRF_YERPN RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::402     1e-09  21%  407 aa  NQRF_YERPE RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::402     1e-09  21%  407 aa  NQRF_YERPA RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::402     1e-09  21%  407 aa  NQRF_YERP3 RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::400     1e-09  24%  407 aa  NQRF_VIBAN RecName: Full=Na(+)-translocating NADH-quinone reductase
  127::266     1e-09  26%  294 aa  NCB5R_CANAL RecName: Full=NADH-cytochrome b5 reductase 1;       
   83::283     2e-09  29%  312 aa  YMM5_YEAST RecName: Full=Uncharacterized oxidoreductase YML125C;   
   35::252     2e-09  32%  259 aa  PYRK_BACWK RecName: Full=Dihydroorotate dehydrogenase electron
  782::907     2e-09  30%  911 aa  NIA1_BRANA RecName: Full=Nitrate reductase [NADH], clone PBNBR1405;
  198::340     2e-09  29%  350 aa  XYLA_PSEPU RecName: Full=Xylene monooxygenase electron transfer
   60::307     2e-09  26%  308 aa  NCB5R_COCIM RecName: Full=NADH-cytochrome b5 reductase 1;       
  131::346     2e-09  30%  353 aa  DMPP_ACICA RecName: Full=Phenol hydroxylase P5 protein;       
   20::252     3e-09  31%  259 aa  PYRK_BACCN RecName: Full=Dihydroorotate dehydrogenase electron
  242::400     3e-09  24%  407 aa  NQRF_VIBVY RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::400     3e-09  24%  407 aa  NQRF_VIBVU RecName: Full=Na(+)-translocating NADH-quinone reductase
  253::406     3e-09  27%  411 aa  NQRF_PSYCK RecName: Full=Na(+)-translocating NADH-quinone reductase
  686::838     3e-09  29%  859 aa  NIA_PICAN RecName: Full=Nitrate reductase [NADPH];       
  744::870     3e-09  28%  873 aa  NIA_EMENI RecName: Full=Nitrate reductase [NADPH];       
  132::270     3e-09  28%  298 aa  NCB5R_MORAP RecName: Full=NADH-cytochrome b5 reductase 1;       
  106::256     3e-09  26%  284 aa  NCB5R_DEBHA RecName: Full=NADH-cytochrome b5 reductase 1;       
   34::252     3e-09  31%  259 aa  PYRK_BACC2 RecName: Full=Dihydroorotate dehydrogenase electron
  242::400     3e-09  23%  407 aa  NQRF_VIBAL RecName: Full=Na(+)-translocating NADH-quinone reductase
  723::901     3e-09  28%  905 aa  NIA_FUSOX RecName: Full=Nitrate reductase [NADPH];       
  133::262     3e-09  30%  294 aa  MCR1_PICGU RecName: Full=NADH-cytochrome b5 reductase 2;       
   34::252     5e-09  31%  259 aa  PYRK_BACHK RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     5e-09  31%  259 aa  PYRK_BACCZ RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     5e-09  31%  259 aa  PYRK_BACCR RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     5e-09  31%  259 aa  PYRK_BACC7 RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     5e-09  31%  259 aa  PYRK_BACC1 RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     5e-09  31%  259 aa  PYRK_BACC0 RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     5e-09  31%  259 aa  PYRK_BACAN RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     5e-09  31%  259 aa  PYRK_BACAC RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     5e-09  31%  259 aa  PYRK_BACAA RecName: Full=Dihydroorotate dehydrogenase electron
  751::907     5e-09  29%  911 aa  NIA2_BRANA RecName: Full=Nitrate reductase [NADH], clone PBNBR1412;
  139::265     5e-09  32%  340 aa  MMOC_METTR RecName: Full=Methane monooxygenase component C;        
  242::402     6e-09  20%  407 aa  NQRF_YERE8 RecName: Full=Na(+)-translocating NADH-quinone reductase
  243::401     6e-09  23%  408 aa  NQRF_SHEDO RecName: Full=Na(+)-translocating NADH-quinone reductase
   71::273     6e-09  27%  301 aa  NCB5R_SCHPO RecName: Full=NADH-cytochrome b5 reductase 1;       
  155::321     6e-09  28%  329 aa  ASCD_YERPS RecName:
  155::321     6e-09  28%  329 aa  ASCD_YERPE RecName:
   34::252     8e-09  31%  259 aa  PYRK_BACC3 RecName: Full=Dihydroorotate dehydrogenase electron
   34::252     8e-09  31%  259 aa  PYRK_BACAH RecName: Full=Dihydroorotate dehydrogenase electron
  243::401     8e-09  24%  408 aa  NQRF_VIBCH RecName: Full=Na(+)-translocating NADH-quinone reductase
  243::401     8e-09  24%  408 aa  NQRF_VIBC3 RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::400     8e-09  23%  407 aa  NQRF_HAES1 RecName: Full=Na(+)-translocating NADH-quinone reductase
  125::319     8e-09  29%  328 aa  NDOR_PSEPU RecName: Full=Naphthalene 1,2-dioxygenase system
  140::293     8e-09  32%  304 aa  NB5R2_XENTR RecName: Full=NADH-cytochrome b5 reductase 2;       
  139::287     8e-09  23%  323 aa  MCR1_ASPOR RecName: Full=NADH-cytochrome b5 reductase 2;       
   34::252     1e-08  31%  259 aa  PYRK_BACC4 RecName: Full=Dihydroorotate dehydrogenase electron
  242::400     1e-08  23%  407 aa  NQRF_VIBPA RecName: Full=Na(+)-translocating NADH-quinone reductase
  244::402     1e-08  23%  409 aa  NQRF_ACTP2 RecName: Full=Na(+)-translocating NADH-quinone reductase
  151::309     1e-08  28%  310 aa  NCB5R_AJECN RecName: Full=NADH-cytochrome b5 reductase 1;       
   77::292     1e-08  26%  312 aa  YMI7_YEAST RecName: Full=Uncharacterized oxidoreductase YML087C;   
  242::400     1e-08  23%  407 aa  NQRF_PASMU RecName: Full=Na(+)-translocating NADH-quinone reductase
  240::398     1e-08  21%  405 aa  NQRF_NEIMF RecName: Full=Na(+)-translocating NADH-quinone reductase
  240::398     1e-08  21%  405 aa  NQRF_NEIMB RecName: Full=Na(+)-translocating NADH-quinone reductase
  240::398     1e-08  21%  405 aa  NQRF_NEIMA RecName: Full=Na(+)-translocating NADH-quinone reductase
  240::398     1e-08  21%  405 aa  NQRF_NEIM0 RecName: Full=Na(+)-translocating NADH-quinone reductase
  246::404     1e-08  23%  411 aa  NQRF_HAEI8 RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::400     2e-08  23%  407 aa  NQRF_VIBHB RecName: Full=Na(+)-translocating NADH-quinone reductase
  240::398     2e-08  21%  405 aa  NQRF_NEIG1 RecName: Full=Na(+)-translocating NADH-quinone reductase
  246::404     2e-08  23%  411 aa  NQRF_HAEIN RecName: Full=Na(+)-translocating NADH-quinone reductase
  246::404     2e-08  23%  411 aa  NQRF_HAEIE RecName: Full=Na(+)-translocating NADH-quinone reductase
  132::285     2e-08  32%  296 aa  NB5R2_XENLA RecName: Full=NADH-cytochrome b5 reductase 2;       
  242::400     2e-08  19%  407 aa  NQRF_KLEP7 RecName: Full=Na(+)-translocating NADH-quinone reductase
  246::404     2e-08  23%  411 aa  NQRF_HAEIG RecName: Full=Na(+)-translocating NADH-quinone reductase
  244::402     3e-08  21%  409 aa  NQRF_HAEDU RecName: Full=Na(+)-translocating NADH-quinone reductase
  146::277     3e-08  30%  305 aa  NCB5R_ASPNC RecName: Full=NADH-cytochrome b5 reductase 1;       
  253::406     4e-08  26%  411 aa  NQRF_PSYA2 RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::400     4e-08  23%  407 aa  NQRF_PSEAE RecName: Full=Na(+)-translocating NADH-quinone reductase
  242::400     4e-08  23%  407 aa  NQRF_PSEAB RecName: Full=Na(+)-translocating NADH-quinone reductase
  100::256     4e-08  28%  276 aa  NB5R2_HUMAN RecName: Full=NADH-cytochrome b5 reductase 2;       
  140::285     4e-08  32%  304 aa  NB5R2_CHICK RecName: Full=NADH-cytochrome b5 reductase 2;       
  242::400     5e-08  22%  407 aa  NQRF_PSEA7 RecName: Full=Na(+)-translocating NADH-quinone reductase
  690::864     5e-08  27%  867 aa  NIA_ASPNG RecName: Full=Nitrate reductase [NADPH];       
  132::266     5e-08  28%  294 aa  NCB5R_CRYNE RecName: Full=NADH-cytochrome b5 reductase 1;       
  150::281     5e-08  29%  309 aa  NCB5R_ASPFU RecName: Full=NADH-cytochrome b5 reductase 1;       
  186::386     5e-08  24%  397 aa  FHBA_DICDI RecName: Full=Flavohemoprotein A;       
  128::269     7e-08  25%  302 aa  MCR1_YEAS7 RecName: Full=NADH-cytochrome b5 reductase 2;       
  100::256     9e-08  26%  276 aa  NB5R2_RAT RecName: Full=NADH-cytochrome b5 reductase 2;       
  141::285     9e-08  29%  305 aa  NB5R1_MOUSE RecName: Full=NADH-cytochrome b5 reductase 1;       
  128::316     1e-07  23%  330 aa  RFBI_SALTY RecName: Full=Protein rfbI;
  131::282     1e-07  27%  310 aa  NCB5R_NEUCR RecName: Full=NADH-cytochrome b5 reductase 1;       
  184::381     1e-07  29%  394 aa  HMP_VIBPA RecName: Full=Flavohemoprotein;AltName:
  103::302     2e-07  26%  326 aa  TMOF_PSEME RecName: Full=Toluene-4-monooxygenase electron transfer
  244::402     2e-07  21%  409 aa  NQRF_ACTSZ RecName: Full=Na(+)-translocating NADH-quinone reductase
   25::129     2e-07  26%  160 aa  NIA_LOTTE RecName: Full=Nitrate reductase [NADH];         Short=NR;
  176::287     2e-07  24%  319 aa  MCR1_ASPTN RecName: Full=NADH-cytochrome b5 reductase 2;       
  202::327     2e-07  25%  414 aa  BOXA_AZOEV RecName: Full=Benzoyl-CoA oxygenase component A;        
  244::402     2e-07  20%  409 aa  NQRF_MANSM RecName: Full=Na(+)-translocating NADH-quinone reductase
  748::902     2e-07  21%  920 aa  NIA_CICIN RecName: Full=Nitrate reductase [NADH];         Short=NR;
   83::241     2e-07  29%  316 aa  NB5R5_MOUSE RecName: Full=NADH-cytochrome b5 reductase-like;       
  139::291     2e-07  23%  323 aa  MCR1_ASPFU RecName: Full=NADH-cytochrome b5 reductase 2;       
  875::998     2e-07  28% 1061 aa  CYPD_BACSU RecName: Full=Probable bifunctional P-450/NADPH-P450
  109::294     3e-07  24%  303 aa  NQRF_ALTMA RecName: Full=Na(+)-translocating NADH-quinone reductase
  141::285     3e-07  30%  305 aa  NB5R1_HUMAN RecName: Full=NADH-cytochrome b5 reductase 1;       
  128::269     3e-07  24%  302 aa  MCR1_YEAST RecName: Full=NADH-cytochrome b5 reductase 2;       
  141::285     4e-07  29%  305 aa  NB5R1_RAT RecName: Full=NADH-cytochrome b5 reductase 1;       
  135::343     4e-07  27%  353 aa  DMPP_PSEUF RecName: Full=Phenol hydroxylase P5 protein;       
  171::294     6e-07  23%  303 aa  NQRF_COLPS RecName: Full=Na(+)-translocating NADH-quinone reductase
  141::285     6e-07  28%  305 aa  NB5R1_BOVIN RecName: Full=NADH-cytochrome b5 reductase 1;       
  124::263     6e-07  25%  296 aa  MCR1A_VANPO RecName: Full=NADH-cytochrome b5 reductase 2-A;        
  132::312     6e-07  30%  339 aa  CBDC_BURCE RecName: Full=2-halobenzoate 1,2-dioxygenase electron
  171::294     7e-07  30%  303 aa  NQRF_PSEHA RecName: Full=Na(+)-translocating NADH-quinone reductase
  157::297     9e-07  27%  324 aa  NCB5R_USTMA RecName: Full=NADH-cytochrome b5 reductase 1;       
  100::256     9e-07  25%  276 aa  NB5R2_MOUSE RecName: Full=NADH-cytochrome b5 reductase 2;       
  137::285     1e-06  30%  301 aa  NB5R3_HUMAN RecName: Full=NADH-cytochrome b5 reductase 3;       
    2::182     2e-06  27%  233 aa  FRE_SALTY RecName: Full=NAD(P)H-flavin reductase;       
  716::869     2e-06  23%  893 aa  NIA_LEPMC RecName: Full=Nitrate reductase [NADPH];       
  715::874     2e-06  24%  886 aa  NIA1_SOYBN RecName: Full=Inducible nitrate reductase [NADH] 1;     
  184::391     2e-06  27%  403 aa  HMP_RHIME RecName: Full=Flavohemoprotein;AltName:
  171::294     3e-06  23%  303 aa  NQRF_SHEHA RecName: Full=Na(+)-translocating NADH-quinone reductase
  727::879     3e-06  26%  891 aa  NIA7_HORVU RecName: Full=Nitrate reductase [NAD(P)H];       
  137::290     4e-06  31%  301 aa  NB5R3_RAT RecName: Full=NADH-cytochrome b5 reductase 3;       
  222::396     6e-06  26%  423 aa  FHBB_DICDI RecName: Full=Flavohemoprotein B;       
  259::378     8e-06  28%  431 aa  NQRF_CHLTA RecName: Full=Na(+)-translocating NADH-quinone reductase
  137::290     8e-06  31%  301 aa  NB5R3_MOUSE RecName: Full=NADH-cytochrome b5 reductase 3;       
  109::289     1e-05  30%  303 aa  NQRF_VIBMA RecName: Full=Na(+)-translocating NADH-quinone reductase
  171::294     1e-05  24%  303 aa  NQRF_PHOPO RecName: Full=Na(+)-translocating NADH-quinone reductase
  171::294     1e-05  21%  303 aa  NQRF_COLMA RecName: Full=Na(+)-translocating NADH-quinone reductase
  259::378     1e-05  28%  431 aa  NQRF_CHLTR RecName: Full=Probable Na(+)-translocating NADH-quinone
  259::347     1e-05  27%  431 aa  NQRF_CHLCV RecName: Full=Na(+)-translocating NADH-quinone reductase
  849::981     1e-05  29%  982 aa  NIA_NEUCR RecName: Full=Nitrate reductase [NADPH];       
  739::880     1e-05  25%  898 aa  NIA_BETVE RecName: Full=Nitrate reductase [NAD(P)H];       
  727::877     1e-05  25%  889 aa  NIA3_MAIZE RecName: Full=Nitrate reductase [NADH] 3;       
  719::878     1e-05  23%  890 aa  NIA2_SOYBN RecName: Full=Inducible nitrate reductase [NADH] 2;     
  108::261     1e-05  30%  272 aa  NB5R3_PIG RecName: Full=NADH-cytochrome b5 reductase 3;       
  120::274     1e-05  26%  306 aa  MCR1B_VANPO RecName: Full=NADH-cytochrome b5 reductase 2-B;        
  377::562     1e-05  28%  589 aa  TAH18_CANAL RecName: Full=Probable NADPH reductase TAH18;       
   44::264     1e-05  26%  292 aa  NCB5R_ASPOR RecName: Full=NADH-cytochrome b5 reductase 1;       
  137::290     1e-05  30%  301 aa  NB5R3_CANFA RecName: Full=NADH-cytochrome b5 reductase 3;       
  136::289     1e-05  30%  300 aa  NB5R3_BOVIN RecName: Full=NADH-cytochrome b5 reductase 3;       
  143::341     1e-05  28%  348 aa  MMOC_METCA RecName: Full=Methane monooxygenase component C;        
  229::352     1e-05  23%  413 aa  FENR_SYNY3 RecName: Full=Ferredoxin--NADP reductase;       
  169::292     2e-05  23%  301 aa  NQRF_SHEPU RecName: Full=Na(+)-translocating NADH-quinone reductase
  259::405     2e-05  25%  431 aa  NQRF_CHLFF RecName: Full=Na(+)-translocating NADH-quinone reductase
  752::869     2e-05  23%  881 aa  NIA1_PHAVU RecName: Full=Nitrate reductase [NADH] 1;       
    8::252     2e-05  24%  259 aa  PYRK_BACSK RecName: Full=Dihydroorotate dehydrogenase electron
  736::820     3e-05  29%  902 aa  NIA_PHYIN RecName: Full=Nitrate reductase [NADPH];       
  137::290     4e-05  30%  301 aa  NB5R3_MACFA RecName: Full=NADH-cytochrome b5 reductase 3;       
  741::904     7e-05  25%  916 aa  NIA1_ORYSJ RecName: Full=Nitrate reductase [NADH] 1;       
  137::268     9e-05  28%  296 aa  NCB5R_ASPTN RecName: Full=NADH-cytochrome b5 reductase 1;       
   31::206     9e-05  22%  237 aa  FRE_VIBHA RecName: Full=NAD(P)H-flavin reductase;       
  395::592     1e-04  24%  620 aa  TAH18_ASHGO RecName: Full=Probable NADPH reductase TAH18;       
  215::274     1e-04  27%  399 aa  HMP_BACSU RecName: Full=Flavohemoprotein;AltName:
  351::523     2e-04  22%  523 aa  NB5R4_XENTR RecName: Full=Cytochrome b5 reductase 4;       
  323::495     2e-04  24%  521 aa  NB5R4_HUMAN RecName: Full=Cytochrome b5 reductase 4;       
  348::494     2e-04  21%  520 aa  NB5R4_BOVIN RecName: Full=Cytochrome b5 reductase 4;       
  193::291     2e-04  28%  406 aa  HMP_OCEIH RecName: Full=Flavohemoprotein;AltName:
    2::208     2e-04  24%  233 aa  FRE_PHOLU RecName: Full=NAD(P)H-flavin reductase;       
    2::182     2e-04  22%  233 aa  FRE_ECOLI RecName: Full=NAD(P)H-flavin reductase;       
    2::182     2e-04  22%  233 aa  FRE_ECOL6 RecName: Full=NAD(P)H-flavin reductase;       
    2::182     2e-04  22%  233 aa  FRE_ECO57 RecName: Full=NAD(P)H-flavin reductase;       
    6::158     2e-04  26%  258 aa  FENR_AZOVI RecName: Full=Ferredoxin--NADP reductase;       
  202::339     2e-04  26%  348 aa  BENC_ACIAD RecName: Full=Benzoate 1,2-dioxygenase electron transfer
  559::702     2e-04  34%  858 aa  RBOHD_SOLTU RecName: Full=Respiratory burst oxidase homolog protein
  259::344     2e-04  32%  431 aa  NQRF_CHLMU RecName: Full=Probable Na(+)-translocating NADH-quinone
  364::487     2e-04  23%  536 aa  NB5R4_MOUSE RecName: Full=Cytochrome b5 reductase 4;       
  184::381     2e-04  26%  394 aa  HMP_VIBVY RecName: Full=Flavohemoprotein;AltName:
  184::381     2e-04  26%  394 aa  HMP_VIBVU RecName: Full=Flavohemoprotein;AltName:
  231::397     2e-04  28%  402 aa  FENR_SYNP2 RecName: Full=Ferredoxin--NADP reductase;       
  872::968     2e-04  32% 1066 aa  C505_FUSOX RecName: Full=Bifunctional P-450:NADPH-P450
  757::903     3e-04  23%  915 aa  NIA1_HORVU RecName: Full=Nitrate reductase [NADH];       
   64::285     3e-04  25%  313 aa  NCB5R_EMENI RecName: Full=NADH-cytochrome b5 reductase 1;       
   31::205     3e-04  23%  236 aa  FRE_VIBFI RecName: Full=NAD(P)H-flavin reductase;       
 1323::1393    3e-04  42% 1545 aa  DUOX2_PIG RecName: Full=Dual oxidase 2;         EC=1.6.3.1;       
 1296::1396    3e-04  34% 1548 aa  DUOX2_HUMAN RecName: Full=Dual oxidase 2;         EC=1.6.3.1;        
 1299::1399    3e-04  35% 1551 aa  DUOX1_CANFA RecName: Full=Dual oxidase 1;         EC=1.6.3.1;        
  389::461     3e-04  36% 1043 aa  CARY_BACST RecName: Full=Carbamoyl-phosphate synthase
    2::130     4e-04  27%  251 aa  Y325_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0325;   
  150::281     4e-04  26%  309 aa  NCB5R_NEOFI RecName: Full=NADH-cytochrome b5 reductase 1;       
 1299::1399    6e-04  35% 1551 aa  DUOX1_HUMAN RecName: Full=Dual oxidase 1;         EC=1.6.3.1;        
  867::960     6e-04  31% 1054 aa  CYPE_BACSU RecName: Full=Probable bifunctional P-450/NADPH-P450
  164::243     7e-04  36%  251 aa  PYRK_AQUAE RecName: Full=Probable dihydroorotate dehydrogenase
  127::281     7e-04  25%  309 aa  NCB5R_ASPCL RecName: Full=NADH-cytochrome b5 reductase 1;       
  201::381     7e-04  25%  386 aa  FENR_THEEB RecName: Full=Ferredoxin--NADP reductase;       
  179::270     7e-04  22%  363 aa  FENR_CYAPA RecName: Full=Ferredoxin--NADP reductase, cyanelle;     
 1265::1365    7e-04  34% 1517 aa  DUOX2_RAT RecName: Full=Dual oxidase 2;         EC=1.6.3.1;       
  348::494     0.001  23%  520 aa  NB5R4_RAT RecName: Full=Cytochrome b5 reductase 4;       
    1::263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHNEYTPFISKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRRVGV
ASRB_SALTY      ------PAAYRILSITRHTPLEWNFRVAVDFPAHWGQFVEVSLPRVGEAPISVSDYGDGWIDLLIRNVGK
PYRK_PYRKO      ------------------------FRFNENIEFAPGQFIMAWLPGVGEKPFSLAW--EDMI--VVKRVGP
PYRK_PYRHO      ------------------------FRFDEKLDFTPGQFIMVWLPGVNEKPFSLA----DKDLIVVKRVGP
PYRK_CLOPE      ----------------------YSLVVEHEAKINAGQFYMIKTPNFLGRPISVCEVNGNDVRFVYATVGA
PYRK_THEVO      -------------NVKESQNVN-TLYFNWDQDIRPGQFAMIWIPGYGEIPMSFSGLGRRK-SITVKAYGS
PYRK_METMA      ------PLNATITQIIEESPLIRTFFFDHKEDMEPGQFVMVWVRGVDEVPMGLSRNNS----ITVQKVGE
PYRK_PYRAB      ------------------------FRFDEKLDFIPGQFIMLWLPGINEKPFSLA----DKDLIVVKKVGP
PYRK_METBF      ------PLNATIVQINEESPLVRTFFFDFQFEMEPGQFVMVWVRGVDEVPMGLSSKNS----ITVQKVGE
PYRK_PYRFU      ------------------------FRLSEKLEFTPGQFIMLWLPGVEEKPLSLA----DKNLIMVKKVGR
PYRK_ARCFU      -------YYTRITQIERLTDEVATLYFSISLRSYPGQFVMVYVPGCEEIPLSLSSSNS----VTVKAVGE
PYRK_UNCMA      ------PISATIKEIIDETPTIKTFRLDVDDWLKPGQYVMVWIRGVDEVPMTLSYDNA----ITVQKVGE
PYRK_METAC      ------PLNVTITQITEESPLVRTFFFDHREDMDPGQFVMVWVRGVDEVPMGLSRNNS----ITVQKVGE
PYRK_METJA      ------PVICRIKEIIEESPTVKTFVVDKDFDFKPGQFAMLWLPGVDEKPFGFSSKNS----FSVARVGE
PYRK_THEAC      -------------------------------DVKPGQFVMVWLPGLGEIPMSLSYVGSPK-GITVKAYGK
PYRK_METTH      ----------------------FIFSWDFRREVRPGQFVMVWDFR-DEKPMSVSLIDRSEIGISIRRVGE
PYRK_CLOAB      MKEKYT--VEKVYENIKVEDGIYKLSIKGEFEVRPGQFYLLDIEPTLSRPISIYDADDEKISFLYSVVGK
PYRK_METBU      ------PVNAKIVEIVEESPTIRTFRFDISDDALPGQFVMVWVRGVDEVPM-----GSSYLNITVQNVGD
PYRK_STRMU      ------------------------FEMVLKGDMQAGQFLHIRVPKLLRRPISIADINKEAQEATIRIEGR
MCR1_KLULA      -------------------------------------------------PVSDNGT-KGKMELVVKHYGK
PYRK_LISIN      ---------------------------ECVADMSPGQFLMLKPSRSDRRPISICSYDKTAKTLLYRVEGD
PYRK_LISMH      ---------------------------ECVADMSPGQFLMLKPSRSDRRPISICSYDKTAKTLLYRVEGD
PYRK_LISMO      --------------------------------MSPGQFLMLKPSRSDRRPISICSYDKTAKTLLYRVEGD
PYRK_BACLD      ---------------------DHIYQMVLEGEIAPGQFLHISLTPLLRRPISIADINKAARQVTIRKDGE
PYRK_LISMF      ---------------------------ECVADMSPGQFLMLKPSRSDRRPISICSYDKTAKTLLYRIEGD
PYRK_BACSU      ------------------------FQMVLKGELTPGQFLHLKVSELLRRPISIADVNFEKNEVTIRVDGE
PYRK_BACA2      ------------LTVQSNSEIDRIYKMVLKGELEPGQFLHLAVTPLLRRPLSIADVNADEVSVIYRADGE
YADH_CLOBE      ----------KIVSKKELTNNIFSMDIEVAKSAKPGQFIIIKNDEKGERPLTIADYDQEKGTVTIQTVGK
PYRK_LISMC      -------------------------------DMSPGQFLMLKPSRSDRRPISICSYDKTAKTLLYRIEGD
PYRK_BACP2      ---------------------DHIYEMTLKGDLTAGQFLHISMTPLLRRPISIANIHAEKQEATIRAEGE
PYRK_LACLM      --------LQEMMTVVSQREVAYNFEMVLKGTLVPGQFLHLAVPNGARRPISISSWDKRAKTCTILRIGD
PYRK_LACLA      ------------------------FEMVLKGELVPGQFLHLAVPNASRRPISISSWDKVAKTCTILRIGD
NCB5R_YEAST     -------------------------------------------------PTSLDGDTKGNFELLVKSTGN
PYRK_THEMA      -------------------------------EARPGQFVVIRLHEKGERPLTVADTKEGLFRMVVKVVGK
MCR1_MAGGR      -----------------------------------------------------------YLDLIVKKYGP
PYRK_BACCQ      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_FUSNN      -----------------------TYKMKIKGNFTPGQFVNIRIGDGRERPISISEIGENLVTIIYRIVGE
PYRK_LISW6      -------------------------------DMSPGQFLMLKPSRSDRRPISICSYDKSAQTLLYRVEGD
PYRK_LACLS      --------LQEMMTVVSQREAAYNFEMVLKGTLVPGQFLHLAVSNGARRPISISSWDKRAKTCTILRIGD
MCR1_EMENI      -----------------------------------------------------------YLELVVKRYGP
PYRK_METKA      ---------------------------------EPGQFLMLGISGVDEKPMAFSGGDDREFELTIEIVGP
MCR1_CANAL      --------------------------------------------------------------------GK
NCB5R_LACBS     ----------------------YTFKLPHAEDVLGGQHISVSADINGKTPISRQNARGRF-ELIIKTYGN
MCR1_LODEL      --------------------------------------------------------------------GK
NCB5R_YEAS7     -------------------------------------------------PTSLDGDTKGNFELLVKSTGN
NCB5R_PICST     -----------------------------------------------------------YFDLLIKTYGN
NCB5R_LODEL     -------------------------------------------------PISL-GDQQGHFDLLIKTYGN
MCR1_USTMA      --------------------------------------------------------------------GK
NCB5R_ARATH     ----------------------------------------------------------------------
MCR1_AJECN      -------------------------------------------------PVSDEGMWASYLDLLVKRYGP
MCR1_PHANO      --------------------------------------------------------------------GP
MCR1_DEBHA      --------------------------------------------------------GKGSIEFVIKKYGK
NB5R2_DANRE     ----------------------------------------------------------------------
MCR1_NEUCR      ---------------------------------------------------------QGYIDLLVKKYGP
MCR1_YARLI      --------------------------------------------------------------------GK
MCR1_COCIM      -----------------------------------------------------------YLDLVVKQYGP
NIA2_ARATH      ----------------------------------------------------------------------
MCR1_PICST      --------------------------------------------------------------------GK
PYRK_THETN      ---------ARVLSNRRIASEVYEMTFEWKGKKPPGQFLMIDCQTFLKRPFSVNDFEEEKMTILYQVRGE
PYRK_GEOSW      ----------------------------------PGQFVHVKVTSQADPPLSLCRIDQNARECTLRKEGI
NIA_SPIOL       --------------------------------------------------------------------GV
MCR1_CHAGB      -----------------------------------------------------------YLDLLVKKYGP
MCR1_BOTFB      ---------------------------------------------------------QGFIDLLVKKYGV
MCR1_ASPCL      -----------------------------------------------------------YLDLVVKVYGP
MCR1_ASHGO      --------------------------------------------------------------------GK
PYRK_ENTFA      ------------------------YQLDLQGELRPGQFVHIKVPRADRRPISINQI--DHSNETCRRVEG
MCR1_ASPNC      -----------------------------------------------------------YIDLVVKVYGP
NIA_SOLLC       ----------------------------------------------------------------------
MCR1_SCLS1      -----------------------------------------------------------FIDLLVKKYGV
NCB5R_KLULA     -------------------------------------------------PTSLDSDAVGHFELLIKSYGN
NCB5R_ASHGO     -------------------------------------------------PTSLDSDATGYFELLVKSYGN
NQRF_IDILO      --------------------------------------------------------------------GK
NIA_CUCMA       --------------------------------------------------------------------GI
NCB5R_YARLI     -------------------------------------------------PTSSDLYDKGYFDILIKTYGN
NCB5R_VANPO     -------------------------------------------------PISLDSEAKGYFELLIKSYGK
NQRF_METCA      --------------------------------------------------------------------GV
MCR1_NEOFI      -----------------------------------------------------------YLDLVVKVYGP
NIA_PETHY       ----------------------------------------------------------------------
NIA1_ARATH      ----------------------------------------------------------------------
NCB5R_PICGU     -----------------------------------------------------------YFDLLIKTYGN
PYRK_STRR6      --------------------------------MRAGQFLHLRVPDDAHLPISISSIDKKQCHLIYRIEGA
NQRF_PSEA6      --------------------------------------------------------------------GK
NIA2_TOBAC      ----------------------------------------------------------------------
NIA2_PHAVU      ----------------------------------------------------------------------
PYRK_BACHD      ----------------------------------PGQFVHVKVDDGSELPLSICHVDEQTSELTLRAEGQ
NCB5R_CANGA     --------------------------------------------------------------------GN
PYRK_STRPN      --------------------------------MRAGQFLHLRVPDDAHLPISISSIDKANKQCLIYRIDG
PYRK_LYSSC      ---------------------ELTLHGELVQDMTPGQFVHVSLEPLLRRPISIANIDKDNNEFTMRAEGR
NIA_LOTJA       ----------------------------------------------------------------------
NCB5R_DICDI     -----------------------------------------------------------YFDLLIKEKGA
NQRF_SERP5      --------------------------------------------------------------------GI
NQRF_MARMS      --------------------------------------------------------------------GQ
NIA1_TOBAC      ----------------------------------------------------------------------
PYRK_STRTD      ---------------------EMVLKGEMVADMQLGQFVHLKVPKLLRRPISISEIDYNKKEATIYRVER
NQRF_YERPS      --------------------------------------------------------------------GI
NQRF_YERPP      --------------------------------------------------------------------GI
NQRF_YERPN      --------------------------------------------------------------------GI
NQRF_YERPE      --------------------------------------------------------------------GI
NQRF_YERPA      --------------------------------------------------------------------GI
NQRF_YERP3      --------------------------------------------------------------------GI
NQRF_VIBAN      --------------------------------------------------------------------GQ
NCB5R_CANAL     --------------------------------------------------------------------GN
YMM5_YEAST      --------------ISKNTAL-YRFKLKTRLDIPAGHHVAVRVPIDGKQPIS-SKLESGYLDLVVKAYGK
PYRK_BACWK      ----------------------------------PGQFVHIKVAELLRRPISICNVDQDKNEFTMRAEGQ
NIA1_BRANA      ----------------------------------------------------------------------
XYLA_PSEPU      ----------------------------------------------------------------------
NCB5R_COCIM     ---EFQNFVLKDKTIVSHNVCIYRFALPRPTDILGGQHISLAATIPGQSPIS-SDDDAGYFDLLVKSYGN
DMPP_ACICA      -------------------------------EFQAGQYINVQFPNIGTRAFSIANSPSEVVELHIRKVGA
PYRK_BACCN      ------------------------YELVLQGDLEPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
NQRF_VIBVY      --------------------------------------------------------------------GQ
NQRF_VIBVU      --------------------------------------------------------------------GQ
NQRF_PSYCK      ----------------------------------------------------------------------
NIA_PICAN       --------------------------------------------------------------------GI
NIA_EMENI       ----------------------------------------------------------------------
NCB5R_MORAP     --------------------------------------------------------------------GN
NCB5R_DEBHA     -----------------------------------------------------------YFDLLIKAYGN
PYRK_BACC2      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
NQRF_VIBAL      --------------------------------------------------------------------GI
NIA_FUSOX       -----------------------------------------------------------YYDTPQRKGGV
MCR1_PICGU      ----------------------------------------------------------------------
PYRK_BACHK      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACCZ      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACCR      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACC7      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACC1      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACC0      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACAN      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACAC      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACAA      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
NIA2_BRANA      ----------------------------------------------------------------------
MMOC_METTR      ----------------------------------PGQFVDIEIPTHTRRSYSMASVAEDQLEFIIR---L
NQRF_YERE8      --------------------------------------------------------------------GI
NQRF_SHEDO      --------------------------------------------------------------------GK
NCB5R_SCHPO     --------------VLNHNTAIYRFRLPRANDVLGGQHLKVFVDVDGKTPLS-SDADKGYFDLLVKSYGK
ASCD_YERPS      --------------------------------------------------------GNGNIELHVRKVGV
ASCD_YERPE      --------------------------------------------------------GNGNIELHVRKVGV
PYRK_BACC3      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
PYRK_BACAH      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
NQRF_VIBCH      --------------------------------------------------------------------GQ
NQRF_VIBC3      --------------------------------------------------------------------GQ
NQRF_HAES1      --------------------------------------------------------------------GQ
NDOR_PSEPU      -------------------------------EFSPGQYATLQFSPEHARPYSMAGLPDDQMEFHIRKVGR
NB5R2_XENTR     ----------------------------------------------------------------------
MCR1_ASPOR      -----------------------------------------------------------YLDLVVKVYGP
PYRK_BACC4      ---------------------------------EPGQFVHIKVAELLRRPISICNVDQEKNEFTMRAEGQ
NQRF_VIBPA      --------------------------------------------------------------------GI
NQRF_ACTP2      --------------------------------------------------------------------GQ
NCB5R_AJECN     ----------------------------------------------------------------------
YMI7_YEAST      --------LSKKTRISRNTSL-YCFKLKYPFEIPMGYHLAVRVTINGETPVNVPNT-EGHLELVVKKHGV
NQRF_PASMU      --------------------------------------------------------------------GQ
NQRF_NEIMF      --------------------------------------------------------------------GQ
NQRF_NEIMB      --------------------------------------------------------------------GQ
NQRF_NEIMA      --------------------------------------------------------------------GQ
NQRF_NEIM0      --------------------------------------------------------------------GQ
NQRF_HAEI8      --------------------------------------------------------------------GQ
NQRF_VIBHB      --------------------------------------------------------------------GI
NQRF_NEIG1      --------------------------------------------------------------------GQ
NQRF_HAEIN      --------------------------------------------------------------------GQ
NQRF_HAEIE      --------------------------------------------------------------------GQ
NB5R2_XENLA     ----------------------------------------------------------------------
NQRF_KLEP7      --------------------------------------------------------------------GI
NQRF_HAEIG      --------------------------------------------------------------------GQ
NQRF_HAEDU      --------------------------------------------------------------------GQ
NCB5R_ASPNC     ----------------------------------------------------------------------
NQRF_PSYA2      ----------------------------------------------------------------------
NQRF_PSEAE      --------------------------------------------------------------------GQ
NQRF_PSEAB      --------------------------------------------------------------------GQ
NB5R2_HUMAN     --------------------------------------------------------------------GK
NB5R2_CHICK     ----------------------------------------------------------------------
NQRF_PSEA7      --------------------------------------------------------------------GQ
NIA_ASPNG       -----------------------------------------------------------YFDTPTVKGGK
NCB5R_CRYNE     ----------------------------------------------------------------------
NCB5R_ASPFU     ----------------------------------------------------------------------
FHBA_DICDI      ----------------------------------PGQYITIKVPENGEQRTHIRHYSEQYYRISVKKEGV
MCR1_YEAS7      --------------------------------------------------------------------GK
NB5R2_RAT       --------------------------------------------------------------------GK
NB5R1_MOUSE     ----------------------------------------------------------------------
RFBI_SALTY      ----------------------------------PGQYINLHYKGVTRSYSIANSDESNGIELHVRNVGQ
NCB5R_NEUCR     -----------------------------------------------------------YFDLLIKSTGN
HMP_VIBPA       ---------------------------------KPGQYLGIYIDKFENQEIRQSSVQENTYRISVKREGK
TMOF_PSEME      -------FSTRVVSKRFLSDEMFELRLEAEQKVSPGQYFMVDVPELGTRAYSAANVDGNTLTLIVKAVPA
NQRF_ACTSZ      --------------------------------------------------------------------GQ
NIA_LOTTE       ----------------------------------------------------------------------
MCR1_ASPTN      ----------------------------------------------------------------------
BOXA_AZOEV      ------------------------------------RMYSVASPRDGERPLTVKRVVEDHEGNPTR--GV
NQRF_MANSM      --------------------------------------------------------------------GQ
NIA_CICIN       --------------------------------------------------------------------GL
NB5R5_MOUSE     -----------ISTMEKVTKDTYLVRFTLPGNLRPGQHLEIQRAYTPISPVTAEG----YFDVLIKRTGL
MCR1_ASPFU      -----------------------------------------------------------YLDLVVKVYGP
CYPD_BACSU      --------------------------------------------------------------------GV
NQRF_ALTMA      ---------------------EFDIPEEYRGDWERFGFFDIE-SKVDEETIRAYSMAEGIIMLNVRPAGK
NB5R1_HUMAN     ----------------------------------------------------------------------
MCR1_YEAST      --------------------------------------------------------------------GK
NB5R1_RAT       ----------------------------------------------------------------------
DMPP_PSEUF      -----------------------------------GQYVNLALPGIGTRAFSLANSRNDEVELHVRLVGA
NQRF_COLPS      --------------------------------------------------------------------GK
NB5R1_BOVIN     ----------------------------------------------------------------------
MCR1A_VANPO     --------------------------------------------------------------------GK
CBDC_BURCE      -----------------------------KVDFLPGQYAQLRIPGTTESAYSYSSMGSSHVTFLVRDVGY
NQRF_PSEHA      --------------------------------------------------------------------GK
NCB5R_USTMA     --------------------------------------------------------------------GN
NB5R2_MOUSE     --------------------------------------------------------------------GK
NB5R3_HUMAN     ----------------------------------------------------------------------
FRE_SALTY       -----TTLSCKVTSVEAITDTVYRVRLDAAFSFRAGQYLMVVMDERDKRPFSMASTPDEFIELHISELNL
NIA_LEPMC       -----------------------------------------------------------YADAPGREGGK
NIA1_SOYBN      --------------------------------------------------------------------GI
HMP_RHIME       -------------------------------DFEPGQYTSVAVPKLGQYSLSDSPNGRSY-RISVKREGY
NQRF_SHEHA      --------------------------------------------------------------------GK
NIA7_HORVU      ----------------------------------------------------------------------
NB5R3_RAT       ----------------------------------------------------------------------
FHBB_DICDI      ---------------------------------------------------------DEYYRISIKKEGI
NQRF_CHLTA      --------------------------------------------------------------------GV
NB5R3_MOUSE     ----------------------------------------------------------------------
NQRF_VIBMA      ---------------------DYDIPEEYRGDWQHFGFFDVE-SKVDEDTISMANCPEEIIMLNVRPAGK
NQRF_PHOPO      --------------------------------------------------------------------GQ
NQRF_COLMA      --------------------------------------------------------------------GK
NQRF_CHLTR      --------------------------------------------------------------------GV
NQRF_CHLCV      --------------------------------------------------------------------GI
NIA_NEUCR       ----------------------------------------------------------------------
NIA_BETVE       ----------------------------------------------------------------------
NIA3_MAIZE      ----------------------------------------------------------------------
NIA2_SOYBN      --------------------------------------------------------------------GI
NB5R3_PIG       ----------------------------------------------------------------------
MCR1B_VANPO     ------------------------------------------------------------IEFVIKHVGG
TAH18_CANAL     --------------------------------IRPRMFSIASCPSSKEVELVVAIVEYKTIIRKIRR-GV
NCB5R_ASPOR     ---EFQNFVLKEKNEISHNVAIYRFALPRPTDILGGQHISLAATIEGEVVRSYTPISSDYFDLLVKAYGN
NB5R3_CANFA     ----------------------------------------------------------------------
NB5R3_BOVIN     ----------------------------------------------------------------------
MMOC_METCA      ---------------------------------EPGQFMDLTIPSRSYSPANLPN-PEGRLEFLIR---V
FENR_SYNY3      --------------------------------------------------------------------GV
NQRF_SHEPU      --------------------------------------------------------------------GK
NQRF_CHLFF      --------------------------------------------------------------------GV
NIA1_PHAVU      ----------------------------------------------------------------------
PYRK_BACSK      ------------LTIVKQTEVARSYELVLEGELQPGQFLHVRVDESEDLPISIANIDPEKEQVTMRAGGA
NIA_PHYIN       ----------------------------------------------------------------------
NB5R3_MACFA     ----------------------------------------------------------------------
NIA1_ORYSJ      --------------------------------------------------------------------GL
NCB5R_ASPTN     ----------------------------------------------------------------------
FRE_VIBHA       ---------------------------------KAGQYLMVVMGEKDKRPFSIASSGELELHIGAAEHNA
TAH18_ASHGO     --------------------LPWEYILDYLPHIKPRFFSISSQPCNKDIELTIAIVRYKTILRRIRR-GL
HMP_BACSU       --------------------------------------------------------GKDYYRISVKKDGV
NB5R4_XENTR     -----------------------------------------------------------YLMIKIYPNGS
NB5R4_HUMAN     --------------VKPYTPVSGSLLSEFKEPVLPNNKYI-------------------YFLIKIYPTGL
NB5R4_BOVIN     -----------------------------------------------------------YFLIKIYPAGF
HMP_OCEIH       ----------------------------------PGQYITIKAQIESEAYVHLTAPGKDYYRISVKRIGV
FRE_PHOLU       -----TTLSCKVTSVEAITDTVYRVRLDSPFLFRAGQYLMVVMDERDKRPFSMASTPKEFIELHISELNL
FRE_ECOLI       -----TTLSCKVTSVEAITDTVYRVRIDAAFSFRAGQYLMVVMDERDKRPFSMASTPDEFIELHISEINL
FRE_ECOL6       -----TTLSCKVTSVEAITDTVYRVRIDAAFSFRAGQYLMVVMDERDKRPFSMASTPDEFIELHISEINL
FRE_ECO57       -----TTLSCKVTSVEAITDTVYRVRIDAAFSFRAGQYLMVVMDERDKRPFSMASTPDEFIELHISEINL
FENR_AZOVI      --------VERVLSVHHWNDTLFSFKTTRNPSLRNGQFVMIGLEVDGRPLMRAYSIAEEHLEFFSIKVGP
BENC_ACIAD      ----------------------------------------------------------------------
RBOHD_SOLTU     ----------KILKVAMYTGNVLTLQMSKPQNYKSGQYMFVNVSPFEWHPFSISAPGDEYLSVHIRRSGL
NQRF_CHLMU      --------------------------------------------------------------------GV
NB5R4_MOUSE     -----------------------------------------------------------YFLIKIYPAGL
HMP_VIBVY       ---------------------------------KPGQYLGIYIEQFENQEIRQSSVRPDCYRISVKREGR
HMP_VIBVU       ---------------------------------KPGQYLGIYIEQFENQEIRQSSVRPDCYRISVKREGR
FENR_SYNP2      ----------------------------------------------------------------------
C505_FUSOX      -----------------------------------------------------------------RHVGV
NIA1_HORVU      ----------------------------------------------------------------------
NCB5R_EMENI     --NEFQNFVLKEKNDISHNVTIYRFALPRPTDILGGQHISLAATIEGEVVRSYTPISSDYFDLLVKAYGN
FRE_VIBFI       ---------------------------------KAGQYLTVVMGEKDKRPFSIASSGEIELHIGAAEHNA
DUOX2_PIG       ---------------------------------------------------------EDTLSLHIRAVGP
DUOX2_HUMAN     -------------------------------EYKSGQWVRIACLALGTTPFTLSAPHEDTLSLHIRAVGP
DUOX1_CANFA     -------------------------------EYKSGQWVQIACLALGTTPFTLSAPHEDTLSLHIRAAGP
CARY_BACST      ----------------------------------------------------------------------
Y325_THEMA      ----------------------------------------------------------------------
NCB5R_NEOFI     ----------------------------------------------------------------------
DUOX1_HUMAN     -------------------------------EYKSGQWVRIACLALGTTPFTLSAPHEDTLSLHIRAAGP
CYPE_BACSU      --------------------------------------------------------------------GV
PYRK_AQUAE      ----------------------------------------------------------------------
NCB5R_ASPCL     -----------------------------------------------------------YFDLLVKAYGN
FENR_THEEB      --------------------------------------------------------------------GV
FENR_CYAPA      --------------------------------------------------------------------GV
DUOX2_RAT       -------------------------------EYKSGQWVRIACLSLGTNPFTLSAPHEDTLSLHIRAVGP
NB5R4_RAT       -----------------------------------------------------------YFLIKIYPAGL


                         .         .         *         .         .         .         .:140
query           VTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFK
ASRB_SALTY      VTSALFTLKEGDNVWLRGCYGNGYPVDTLRHKPLLVVAGGTGVAPVKGLMRYFVENPQEIGQLDMILGYK
PYRK_PYRKO      FTTKLFELKEGDRLWIRGPYGHGFIK---RGEKVALVGGGIGIPPLYA---FAKKNQGKFRQMTLIYGAR
PYRK_PYRHO      FTSKLFTLEEGDYLWIRGPYGNGF--KEVKGK-VALVAGGIGIPPIYALAKHGKLEEK-----VLIYGAR
PYRK_CLOPE      GTNEMKKMISGDEIEIIGPLGNGFDINKDYGR-VALVSGGIGTAPMLELAKSLRKNNKDIK-MDFYGGFR
PYRK_THEVO      ASRKLTELKAGDDLFLRGPYGNGFDVREGRKXXXXXXXXXXXXYPI-----------ADQETDALISA-K
PYRK_METMA      ATSKLFELKEGDSFGLRGPFGKGFTL-PAKGEKVLIIAGGVGAAPLS---PYXXXXXXXXXXVNTVLGAR
PYRK_PYRAB      FTSKLFKLEEGDYVWIRGPYGNGF--KSVEGK-VALVAGGIGIPPIYALAKYGNLEEK-----VLIYGAR
PYRK_METBF      ATSKLFELKEGDSFGLRGPFGKGFSLPS-EGEKTLIIAGGVGXXXXXXXXXXXXXXGSEVHT---VLGAR
PYRK_PYRFU      FTNELFKLKEGDYVWIRGPYGHGF---SGKGKSVXXXXXXXXXXXXXXXXKY-----GNFKRSILIYGAR
PYRK_ARCFU      TTASLINAKEGQYVGVRGAFGSAFTPS----KRALIVAGGIGIAPMKYLYEYLM---KCGSKVSVVYGER
PYRK_UNCMA      ATEALFKLKAGDSVGIRGPYGNGWEI---VGDDILLISGGVGSAPLAPLGE---KARRIGVNVTTLAGYR
PYRK_METAC      ATSKLFELKEGDSFGLRGPFGKGFTLPS-RGEKVLLIAGGVXXXXXXXXXXXXXXXXXXVHT---ILGAR
PYRK_METJA      FTKKMHELKEGDIIGVRGPYGTYFEPI---GDKXXXXXXXXXXXXXXXXXEEFS---KQGIEITTILGAR
PYRK_THEAC      VSQAMIDMEPGHEFYIRGPYGNGFQIES-----------GRKXXXXXXXXXXXXXXXADSDTDALISA-K
PYRK_METTH      FTDRVHGLSEGDLLGIRGPYGRGFEL---MGRDILLVGGGIGMXXXXXXXXXXXXRGMRVDA---LVAAR
PYRK_CLOAB      GTEILSKLKSGDEIKITGPLGNGFNVKRISGK-VAIVCGGIGVAPMV----YLAKNLKNC-NVDFYAGFK
PYRK_METBU      ATSKLFDMKVGDSVGLRGPFGKGFTLPK-KDEHXXXXXXXXXXXXXXXXXDYAAE---CGAKVTTILGSR
PYRK_STRMU      GTAIFSQLKAGDKLDCLGPQGNGFDLSVIKGQKALXXXXXXXVPPLLEVAKQLCK--KGVEAYAVL-GFA
MCR1_KLULA      FTSHLFGLKENDTVSFKGPITKWWKPNSYDS--ITLLGAGTGINPLYQLVHHIAENPEDNTKIHLYYGNK
PYRK_LISIN      GTKDFSSLSKGDSIDVLGPLGKGFDLNTIPAKTALLIGGGIGVPPMYQLGKELADK---GVQVTFVNGFQ
PYRK_LISMH      GTRDFSKLSEGDTIDVLGPLGKGFDIDQTPAKTALLIGGGIGVPPMYQLGKELAGK---GVQVTFVNGFQ
PYRK_LISMO      GTRDFSKLSEGDTIDVLGPLGKGFDIDTTPAKTALLIGGGIGVPPMYQLGKELAEK---GVQVMFVNGFQ
PYRK_BACLD      GTRLLSLKQEGDQLDVLGPLGNGFPAESLEGKTAXXXXXXXXXXXXYELSKQLTNRGVHAIH---VLGFA
PYRK_LISMF      GTRDFSKLSEGDTIDVLGPLGKGFDIDQTPAKTALLIGGGIGVPPMYQLGKELAGK---GVQVTFVNGFQ
PYRK_BACSU      GTRLLSLKQQGELVDVLGPLGNGFPVNEVQGKTAXXXXXXXXXXXXQELSKRLIEK---GVNVIHVLGFQ
PYRK_BACA2      GTRLLAGKKEGGRIDVLGPLGNGFPVRRIEGKTAXXXXXXXXXXXXQELSKRLTEK---GVNVIHVLGFQ
YADH_CLOBE      GTKQLAAFNEGDHVAFVGPLGSEFDIEELKKKNFIFVAGGVGAAPVYPQVKWMHEH---GIAVDVILGSR
PYRK_LISMC      GTRDFSKLSEGDTIDVLGPLGKGFDIDQTPAKTALLIGGGIGVPPMYQLGKELAGK---GVQVTFVNGFQ
PYRK_BACP2      GTKLLSQKRDGESIDVLGPLGNGYDPS-------VVQSGQTAXXXXXXXXELSKRLTKKGVIVKHVLGFQ
PYRK_LACLM      ETTGTYKKLEGAKVDVMGPLGNGFPVAEVTSTDKXXXXXXXXXVPP--LYELAKQLEKTGCQMTILLGFA
PYRK_LACLA      ETSEISKLQSGAKIDVMGPLGNGFPVDEVVSTDKXXXXXXXXXXXXX--YELAKQLEEKNCQMTILLGFA
NCB5R_YEAST     VSKMIGELKIGDSIQIKGPRGNYHYERNCRS-HLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNV
PYRK_THEMA      TTHELSLKKEGDTILVVGPLGNPSEIENYXXXXXXXXXXXIALYPIAKALKEAGNN------ITTVLGAR
MCR1_MAGGR      MSTHIHELVPGQKLDFKGPLPK-YEWSANKHPHVAMIAGGTGITPMYQIMRAIFKNPADKTKVTLVVGNI
PYRK_BACCQ      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEGQTALLVGGGIGVSPL-----YELSQRLVAKGVRVIHGFQ
PYRK_FUSNN      GTKFMANIKKGNEIDVMGPLGRGYDVLSLTKEQ--TAXXXXXXXXXXXXYELAKQFNKRGIKTIIILGFN
PYRK_LISW6      GTEDFSKLSSDDTIDVLGPLGKGFDIDRTEPKTALLIGGGIGVPPMYQLGKELAGK---GVQVTFVNGFQ
PYRK_LACLS      ETTGTYEKLEGAKVDIMGPLGNGFPVAEVTSTDKXXXXXXXXXVPP--LYELAKQLEKTGCQMTILLGFA
MCR1_EMENI      MSEHLHNMNVDQRLDFKGPLPK-YPWEANKHKHICLVAGGTGITPMYQLAREIFKNPEDKTKVTLVFGNV
PYRK_METKA      FTERCADLEPGDVVWVRGPYGKPFEXXXXXXXXXXXXXXXXPLVPL------VERLRRARVHVTSVLGGP
MCR1_CANAL      MSSHIFDLKEGETLSFKGPIVKWWEPNQFKS--IALIGGGTGITPLYQLLHQITSNPKDNTKVNLIYGNL
NCB5R_LACBS     ISRHVASLKIGDTLRVKGPKGN-FKYTPGLTAHLGMIAGGTGLAPMIQIVRAILQNPPDRTNITLIYANV
MCR1_LODEL      MSNHIHNLKEGETLSFKGPVVKWWEPNQFKS--IALIGGGTGITPLYQLLREITSNPEDKTKVSLIYGNT
NCB5R_YEAS7     VSKMIGELKIGDSIQIKGPRGNYHYERNCRS-HLGMIAGGTGIAPMYQIMKAIAMDSHDTTKVSLVFGNV
NCB5R_PICST     ISKHVDSKKVGEYVEIRGPKGF-FTYTPNMVKSFGMIAGGTGIAPMYQIITAILRNPADKTKISLIYANV
NCB5R_LODEL     ISRHVAEKQVGDFVEIRGPKGFFTYTPNMK-KSLGLIAGGTGIAPMYQIITAIMNNPEDKTKVHLLYANV
MCR1_USTMA      MTTYMHSMKPGDKLGIKGPIAKAYKANEFES--IGMIAGGSGITPMYQVIQDIASNPSDKTKVTLIYSNK
NCB5R_ARATH     ----------GDVLEVKGPVEK-FKYSPNMKKHIGMIAGGSGITPMLQVIDAIVKNPEDNTQISLLYANV
MCR1_AJECN      MSNHLHNMAVGQRLDFKGPLPK-YPWEPSKHDHICLIAGGTGITPMYQLVRKIFSNPEDKTKVTLVFANV
MCR1_PHANO      MSSHMHNMEPGQRLDIKGPIPK-YPWSPNKHEHIALIAGGTGITPMWQTARAIFKNPEDKTKVTLVFGNI
MCR1_DEBHA      MSSHIHDLKPNDTLAFKGPVVKWWEPNQYKS--IALIGGGTGITPLYQLMHEITKNPEDKTKVNLFYGNL
NB5R2_DANRE     ----------GDTIDFRGP--NGLLVYNGKGKHVAMIAGGTGITPMLQLIRSITADSFDETVCSLIFANQ
MCR1_NEUCR      MSTYLHDMAPGQRLDIKGPLPK-YPWEANKHKHIALVAGGTGITPMYQLIRAIFNNPDDKTKVTLVFGNV
MCR1_YARLI      MSKHIHELKEGDTLSFKGPIIK-YQWQPNLHKEITLIGAGTGITPLYQLISAINKNPEDKTKVNLFYGNA
MCR1_COCIM      MSTHLHNMAVGQQLSFKGPIPK-YPWEQNKHDHICMIAGGTGITPMYQIIRKIFNNPNDKTKVTLVFGNI
NIA2_ARATH      ----------GSTLEIKGPLGHSFTVHGKPADKLAMLAGGTGITPVYQIIQAILKDPEDETEMYVIYANR
MCR1_PICST      MSSHIHDLKPNDTLSFKGPFVKWWEPNQFKS--IALIGGGTGITPLYQLIHEITKNPADKTQVSLFYGSQ
PYRK_THETN      GTKNLSQMKEGDILEITGPHGNGFEI--LEGKRVLIVGGGVGIAPLL----YLAKKVK-AQKLYIALGFK
PYRK_GEOSW      GTTLLSEKRPGETIDVLGPLGNGFPLDAAQGRR---AXXXXXXXXXXXXYELAKQLVKKGVIVTSVLGFQ
NIA_SPIOL       MSQHLDSLSLGSIVDVKGPLGHNFTVHGKPAKKLAMISGGTGITPIYQVMQAILKDPEDKTEMHVVYANR
MCR1_CHAGB      MSTHLHDMVPGQRLDVKGPLPKYPWTANKHG-HIALVAGGTGITPMFQLCRAIFNNPDDQTKVTLVFGNV
MCR1_BOTFB      MSEHMHDMVPGQRLDFKGPIPK-YPWSANKHDHIALIAGGTGITPMYQLARAIFNNPADKTKVTLVFANV
MCR1_ASPCL      MSEHLHSMNVDQRLEFKGPIPK-YPWETNKHKHICLIAGGTGITPMYQLARQIFKNPEDQTKVTLVFGNV
MCR1_ASHGO      FTTHLFGLKENDTVEFKGPIQKWWDPNMFDS--IVLMGAGTGITPLFQMMHHIAENPTDNTKVHLLYGNK
PYRK_ENTFA      AGTEVFATMKGEQLDILGPLGNGFDITTVAGQTAFIVGGGIGIPPLYELSKQLNE--------------K
MCR1_ASPNC      MSEHLHSMNVGQRLDFKGPIVK-YPWETNKHNHICLIAGGTGITPMYQLAREIFKNPEDQTKVTLVFGNV
NIA_SOLLC       -------------------------------KKLAMIAGGTGITPVYQVMQSILKDPEDDTEMYVVYANR
MCR1_SCLS1      MSEHMHEMVPGQRLDFKGPIPK-YAWSANKHDHIALIAGGTGITPMYQLARAIFNNPADKTKVTLVFANV
NCB5R_KLULA     ISKHFAQLNIGDKIKVRGPKGF-YHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQ
NCB5R_ASHGO     ISKMLAELAIGDRIKVRGPKGYHYEPNMYK--EIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQ
NQRF_IDILO      MSSYIFSLKPGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHLFDQMRRIKTDRKVSFWYGAR
NIA_CUCMA       MSQYLDSMEVGSTLDVKGPLGHNFMVHGKPARRLAMLAGGTGITPIYQVVQAILKDPEDETEMYVVYANR
NCB5R_YARLI     ISKYVSELAIGDTMKVRGPKGN-FVYNHGLVESFGMVCGGTGITPMYQILRHIAADPADNTKVNLVYANV
NCB5R_VANPO     ISKMFTSLKIGDTIDVQGPKGF-YEYTDRSSKHLAMIAGGSGLTPMYQIIKSIAENPKDKTKVTFIYGNV
NQRF_METCA      MSSYIFNLKPGDKVTISGPFGEFFARDT--DKEMVFIGGGAGMAPMRSHIFDQLLRLKSKRKMTFWYGAR
MCR1_NEOFI      MSEHLHSMNVDQRLEFKGPIPK-YPWEANKHKHICLIAGGTGITPMYQLARKIFKDPEDQTKVTLVFGNV
NIA_PETHY       -------------------------------KKLAMLAGGTGITPVYQVMQAILKDPEDETEMHVVYANR
NIA1_ARATH      ----------GSMIDIKGPLGH----IEYKGKKLAMLAGGTGITPIYQIIQSILSDPEDETEMYVVYANR
NCB5R_PICGU     ISRHVDSKSVGDHIEVRGPKGF-FTYTPNMVEHLGMIAGGTGIAPMYQVLTAILTNPDDKTKISLVYANV
PYRK_STRR6      GTAIFSTLSQGDTLDVMGPQGNGFDLSDLD--EQNQXXXXXXXXXXXXXXXXAKELHERGVKVVTVLGFA
NQRF_PSEA6      MSSYIWSLKEGDKATISGPFGEFFAKKT--DAEMVFIGGGAGMAPMRSHIFDQLRRLKTDRKISFWYGAR
NIA2_TOBAC      ----------GSFLDVKGPLGHNFLVHGKQAKKLAMIAGGTGITPVYQVMQAILKDPEDDTEMYVVYANR
NIA2_PHAVU      ----------GSMLDVKGPLGHNFTVNGKSAKRLAMLAGGTGITPIYQVAQAILKDPEDLTEMHVVYANR
PYRK_BACHD      GTKRLAQKARGETVDILGPLGQGFPLEAIASGET---AXXXXXXXXXXXXXXXAKRLKAKGCHVIVLGFQ
NCB5R_CANGA     ISKHIGDMKIGEKINISGPRGFYEYVPNVH-KHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNV
PYRK_STRPN      AGTAIFSTLQGDTLDVMGPQGNGFDLSDLD--EQNQXXXXXXXXXXXXXXXXAKELHERGVKVVTVLGFA
PYRK_LYSSC      GTKVLATNREGQQVNVLGPIGNGFPVDAV--KEXXXXXXXXXXXXXXXXHELSKQLNARGVKTIHVLGFQ
NIA_LOTJA       ----------GSDLDVKGPLGHNFLVHGKHAKKLAMLAGGTGITPIYQVAQAILKDPEDHTKMYVVYANR
NCB5R_DICDI     MSGYVDNMFIGDSIEVKGPKGK-FNYQPNMRKSIGMLAGGTGITPMLQVIKAILKNPSDKTEISLVFGXX
NQRF_SERP5      MSSYIWSLKAGDKVTISGPFGEFFAKDT--DAEMIFIGGGAGMAPMRSHIFDQLNRLKSKRKITFWYGAR
NQRF_MARMS      MSSYVFSLKPGDKIKVYGPFGEFFAKDT--DAEMVFVGGGAGMAPMRSIFDQLKRNSKRKISFWY--GAR
NIA1_TOBAC      ----------GSFLDVKGPLGHNFLVHGKQAKKLAMIAGGTGITPVYQVMQAILKDPEDDTEMYVVYANR
PYRK_STRTD      EGTAILSKMAGQTIDTMGPQGNGFDIS-------IIEAGQKAXXXXXXXXXXXXXETKGVEVVSVI-GFA
NQRF_YERPS      MSSYIWSLKPGDKVVISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGAR
NQRF_YERPP      MSSYIWSLKPGDKVVISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGAR
NQRF_YERPN      MSSYIWSLKPGDKVVISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGAR
NQRF_YERPE      MSSYIWSLKPGDKVVISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGAR
NQRF_YERPA      MSSYIWSLKPGDKVVISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGAR
NQRF_YERP3      MSSYIWSLKPGDKVVISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGAR
NQRF_VIBAN      MSSYIWSLKEGDKCTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLKSTRKMSYWYGAR
NCB5R_CANAL     ISRHVAGKNVGEHIEIRGPKGF-FTYTPNMVKSFGMIAGGTGIAPMYQIITAILKNPEDKTKIHLVYANV
YMM5_YEAST      VSKYFAGLNSGDTVDFKGPIGTNYEPNS--SKHLGIVAGGSGITPVLQILNEIITVPEDLTKVSLLYANE
PYRK_BACWK      GTKTLAKRKQGELVDVLGPLGHGFPVEEAESGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
NIA1_BRANA      --------------------------------KLAMLAGGTGITPIYQVIQSILSDPEDETEMFVVYANR
XYLA_PSEPU      ----------GATLTLRAPYGQGLHESN---ATMVCVAGGTGLAPIKCVLQSMTQAQRERD-VLLFFGAR
NCB5R_COCIM     ISKHLTTLRIGDKMKVRGPKGAMVYTPNMV-RHIGMIAGGTGITPIKAIIKGRPRNGNDTTQIDLIFANV
DMPP_ACICA      ATTYVHEQLAGDQLDISGPYGQ-FFVRKSDDQNAIFIAGGSGLSPQSMILDLLESG--DSRTIYL---FQ
PYRK_BACCN      GTKTLAKRKQGELVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
NQRF_VIBVY      MSSYIWSLKEGDKCTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGAR
NQRF_VIBVU      MSSYIWSLKEGDKCTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGAR
NQRF_PSYCK      -----FSLKPGDKVTVSGPYGEFFAKKTEA--EMIFVGGGAGMAPMRSIFDQLKRLNSDRK-ISFWYGAR
NIA_PICAN       MTNLIENLQVGNQIEVKGPVGESFNNKPYQMKHFVMISGGSGITPTYQVLQAIFSDPEDRTSVQLFFGNK
NIA_EMENI       -------------------------------KSFVMICGGTGITPVFQVLRAVMQDEQDETKCVMLDGNR
NCB5R_MORAP     ISKMFSELSIGDSINARGPKGQ-FSYTPNMCRAIGMIAGGTGLTPMLQIIRAIVKNPEDKTQVNFIFANV
NCB5R_DEBHA     ISRHVESKKIGETIDIRGPKGF-FTYTPGMVESFGMIAGGTGITPMYQILTAILRNPEDKTKVSLVYANV
PYRK_BACC2      GTKTLATRKQGEMIDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
NQRF_VIBAL      MSSYIWSLKEGDKCTISGPFGEFFAKDT--DAEMVFVGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGAR
NIA_FUSOX       MTQALDALPIGHWVDFKGPHGNGLCTINEKERRVIMVCGGSGITPIRQVLRAVIDNPKDTTPCLVFNGNR
MCR1_PICGU      ---------EGDTVSFKGPIVKWWEPNQFQS--IALIGGGTGITPLYQLLHEITKNPEDKTKVKLFYGNL
PYRK_BACHK      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACCZ      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACCR      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACC7      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACC1      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACC0      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACAN      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACAC      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACAA      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
NIA2_BRANA      ----------GSVLNIKGPLGHNFMVTGKPAKKLAMLAGGPGITPIYQVIQSILSDPEDETEMFVVYANR
MMOC_METTR      LPDGAFSKFVGMRVDLRGPAGSFF-LHDHGGRSRVFVAGGTGLSPVLSMIRQLGK-ASDPSPATLLFGVT
NQRF_YERE8      MSSYIWSLKPGDKVVISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRRISFWYGAR
NQRF_SHEDO      MSSYIWSLKAGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHLFDQLKRLKSKRKMSFWYGAR
NCB5R_SCHPO     VSKKFSELKIGDTIGVRGPKGN-WKHRTGLARHFGMIAGGTGITPMLQIIRAVLSNFEDPTEITLLYANV
ASCD_YERPS      FSNIIFNELKLQQLLIEGPQGTFFVRED--NLPIVFLAGGTGFAPVKSMVEALI-NKNDQRQVHIYWGMP
ASCD_YERPE      FSNIIFNELKLQQLLIEGPQGTFFVRED--NLPIVFLAGGTGFAPVKSMVEALI-NKNDQRQVHIYWGMP
PYRK_BACC3      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
PYRK_BACAH      GTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
NQRF_VIBCH      MSSYIWSLKAGDKCTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGAR
NQRF_VIBC3      MSSYIWSLKAGDKCTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGAR
NQRF_HAES1      MSSYIWSLKEGDKVTISGPFGEFFAKET--DNEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSFWYGAR
NDOR_PSEPU      VTEYVFEHVEGTSIKLSGPLGTAYLRQKHTGP-MLCVGGGTGLAPVLSIVRGALKSGM-TNPILLYFGVR
NB5R2_XENTR     ----------GETIDFRGP--NGLLVYKEKGKFAIMLAGGTGITPMLQLIRQITQDPNDNTKCSLIFANQ
MCR1_ASPOR      MSEHLHSMNVDQRLSFKGPLPK-YQWETNKHEHIALIAGGTGITPMYQLIRQIFKNPDDKTKVTLVYGNV
PYRK_BACC4      GTKTLATRKQGEMVDVLGPLGHGFPLEEAEAGQT----AXXXXXXXXXXXXYELSQRLVAKGVRVIHGFQ
NQRF_VIBPA      MSSYIWSLKEGDKCTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGAR
NQRF_ACTP2      MSSYIWSLKPGDKVTISGPFGEFFAKET--DNEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSFWYGAR
NCB5R_AJECN     ----------GQTMKVRGPKGAMVYTPNMV-KKIGMIAGGTGITPIKAIIRGRPRNGNDTTQVDLIFANV
YMI7_YEAST      VSKYFDKLKIRQYVEFKGPLGE-LEYDQDTATELGIIAGGSGITPVLQVLQEIIPSPEDLTHISLIYANE
NQRF_PASMU      MSSYIWSLKAGDKVTISGPFGEFFAKET--DAEMVFVGGGAGMAPMRSHIFDQLKRLKSKRKMSFWYGAR
NQRF_NEIMF      MSSYIWSLKPGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLNSKRKITFWYGAR
NQRF_NEIMB      MSSYIWSLKPGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLNSKRKITFWYGAR
NQRF_NEIMA      MSSYIWSLKPGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLNSKRKITFWYGAR
NQRF_NEIM0      MSSYIWSLKPGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLNSKRKITFWYGAR
NQRF_HAEI8      MSSYIWSLKAGDKVTISGPFGEFFAKET--NAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGAR
NQRF_VIBHB      MSSFIWSLKEGDKCTISGPFGEFFAKDT--DAEMVFVGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGAR
NQRF_NEIG1      MSSYIWSLKPGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKITFWYGAR
NQRF_HAEIN      MSSYIWSLKAGDKVTISGPFGEFFAKET--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGAR
NQRF_HAEIE      MSSYIWSLKAGDKVTISGPFGEFFAKET--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGAR
NB5R2_XENLA     ----------GETIDFRGP--NGLLVYKGKGKFAIMLAGGTGITPMLQLIRQITQDPNDNTKCYLIFANQ
NQRF_KLEP7      MSSYIWSLKPGDKVTISGPFGEFFAKET--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSTRKISFWYGAR
NQRF_HAEIG      MSSYIWSLKAGDKVTISGPFGEFFAKET--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGAR
NQRF_HAEDU      MSSYIWSLKAGDKVTISGPFGEFFAKET--DNEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSFWYGAR
NCB5R_ASPNC     ----------GQTMKVRGPKGAMVYTPNMC-RHIGMIAGGTGITPMYQIIKAIIRNGNDTTQVDLIFANV
NQRF_PSYA2      -----FSLKPGDKVTVSGPYGEFFAKKTEA--EMIFVGGGAGMAPMRSIFDQLKRLNSDRK-ISFWYGAR
NQRF_PSEAE      MSSWVFNLKPGDKVTVYGPFGEFFAKDT--EAEMVFIGGGAGMAPMRSHIFDQLRRLKSNRKISFWYGAR
NQRF_PSEAB      MSSWVFNLKPGDKVTVYGPFGEFFAKDT--EAEMVFIGGGAGMAPMRSHIFDQLRRLKSNRKISFWYGAR
NB5R2_HUMAN     MTQYLENMKIGETIFFRGPRGRLFDQTSEPKKTLAMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQ
NB5R2_CHICK     ----------GDVIDFRGP--NGLLV--YKGKHLGVIAGGTGITPMLQLIRHITSDPKDSTKCYLLFANQ
NQRF_PSEA7      MSSWVFNLKPGDKVTVYGPFGEFFAKDT--EAEMVFIGGGAGMAPMRSHIFDQLRRLRSTRKISFWYGAR
NIA_ASPNG       MTMALEKLALGSEIDCKGPTGRFEYLGNGKGKERHVICGGTGITPIFQVLRAVMQDKQDPTSCVVLDGNR
NCB5R_CRYNE     ----------GQEIKVKGPKGK-FVYTPNMAPHLVMIAGGTGITPMYQIIKSSIKTPGDKTRLSLIYANI
NCB5R_ASPFU     ----------GDTMKVRGPKGAMVYTPNMC-RHIGMIAGGTGITPMLQIIKAVIRNGNDTTKLDLIFANV
FHBA_DICDI      VSNHLHANVKGDKVLLSPPAGD-YVVDQLSSNPILLVSGGVGITPLLSMAKATLAKQPERE-VTFVHSSK
MCR1_YEAS7      MTSHLFGLKPNDTVSFKGPIMKWWQPNQFKS--ITLLGAGTGINPLYQLAHHIVENPNDKTKVNLLYGNK
NB5R2_RAT       MTQYLENMKIGDTILFRGPTGRLFDKTSEPEKKLVMIAGGTGITPMLQLIRHITKDTSDGTRMSLLFANQ
NB5R1_MOUSE     ----------GDMVEFRGPSGGNFNIQPNKAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQ
RFBI_SALTY      MSSLIFELQENTLMRIEGPCGTFFIRES--DRPIIFLAGGTGFAPVKSMVEHLIQG-KCRREIYIYWGMQ
NCB5R_NEUCR     ISKHMASLQVGQTIRVKGPKG-AFVYTPNMVRHFGMVAGGTGITPMLQVIRAIGRAAGDRTEVDLIFANV
HMP_VIBPA       VSNYLHDELNGDKVKLAAPAGDFFDVDT--NTPVVLISAGVGLTPTLSMLESLTEHHAPV---TWVHATE
TMOF_PSEME      LANETIE-----TLQLDGPYGLSV-LKTADETQSVFIAGGSGIAPMVSMVNTLIAQGYE-KPITVFYGSR
NQRF_ACTSZ      MSSYIWSLKPGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGAR
NIA_LOTTE       -------------------------------RRLAMLAGGTGITPIYQVIQAVLKDPDDTEMFFAVYSNK
MCR1_ASPTN      -----------------------------KHQHICLIAGGTGITPMYQLARHIFKNPEDKTKVTLVYGNV
BOXA_AZOEV      ASNYVCDLKKGDKVQVTGPYGSTYLMPNHPGSSIMMICTGTGSAPXXXXXXXXXXXXKEGGELVLFFGAR
NQRF_MANSM      MSSYIWSLKPGDKVTISGPFGEFFAKDT--DAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGAR
NIA_CICIN       MSQHLESMELGSSIEIKGPLGHTFSVHGKQARKLAMFAGGTGITPDLSSDASYLKDPEDDTEMYVVYANR
NB5R5_MOUSE     MSQYVESWRTGDTAFWRGPFGS-FLYEPKKYGELLMLAAGTGLAPMVPILQSITDDEDDETFVTLVGCFK
MCR1_ASPFU      MSEHLHSMNVDQRLEFKGPIPK-YPWEANKHKHICLIAGGTGITPMYQLARKIFKDPEDQTKVTLVFGNV
CYPD_BACSU      ASNDLAERQAGDDMFIRTPESR-FQLPKDPETPIIMVGPGTGVAPFRGFLDVLKREGKTLGEAHLYFGCR
NQRF_ALTMA      MSSYIWSLKEGDKATISGPFGEFFAKET--ENEMVFVGGGAGMAPMRSHIFDQLRRLKSKRKMSFWYGAR
NB5R1_HUMAN     ----------GDVVEFRGPSGGHFNIQPNKAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQ
MCR1_YEAST      MTSHLFGLKPNDTVSFKGPIMKWWQPNQFKS--ITLLGAGTGINPLYQLAHHIVENPNDKTKVNLLYGNK
NB5R1_RAT       ----------GDVVEFRGPSGGNFNIQPNKAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQ
DMPP_PSEUF      ATGFIHKQLKGDAVELSGPYGQ-FFVRDSQAGDLIFIAGGSGLSPQSMILDLLERG--DTRRITLFQGAR
NQRF_COLPS      MSSFIFSLKEGDKVTISGPFGEFFAKET--DNEMVFIGGGAGMAPMRSHIFDQLKRLQSKRKMSFWYGAR
NB5R1_BOVIN     ----------GDVVEFRGPSGGKFNIQPNKARNLGMIAGGTGITPMLQLIRAILKDPEDPTQCFLLFANQ
MCR1A_VANPO     MTNHIFSLKVNDTLSFKGPIPKWKWVPN-SFESXXXXXXXXXXXPLYQLIHAITKNPNDKTKIRLFYSNK
CBDC_BURCE      LRNQITETFTFD-----GPYGAFY--LREPVRPILMLAGGTGLAPFLSMLQYMALQRNDLPSVRLVYGVN
NQRF_PSEHA      MSSYIWSLKEGDKVTISGPFGEFFAKDT--DAEMVFVGGGAGMAPMRSIFDQLKRNSKRKISFWY--GAR
NCB5R_USTMA     VSKYIGSMKIGDLLSVKGPKGQMRYAPGLS-RHIGMIAGGTGLTPCLQIIRAALKNPADKTQIDFIYAXX
NB5R2_MOUSE     MTQYLENMKIGDTILFRGPTGRLFNKTSEPEKKLVMIAGGTGITPMLQLIRHITKDTSDETRMSLLFANQ
NB5R3_HUMAN     ----------GDTIEFRGP--SGLLVYQGKGKFAIMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQ
FRE_SALTY       YAMAVMDRILKDRIVVDIPHGDAW-LRDDEERPLILIAGGTGFSYVRSILTALARNP--ARDVTIYWGGR
NIA_LEPMC       MTKALDSIPCGHWVDMKGPIGKSINGNERRVRSMKMICGGSGITPIYQVLRAILQDSADSTHCTVLNGNR
NIA1_SOYBN      MSQHLDSLPIGSVLDVKGPLGH----IEYTGRRLAMLAGGTGITPIYQVVQAILKDPEDCTEMHVVYANR
HMP_RHIME       VSSLLHDEINGDELKLAAPYGN-FYIDVSATTPIVLISGGVGLTPMVSMLKKALQTP--PRKVVFVHGAR
NQRF_SHEHA      MSSYIFSLNAGDKVTISGPFGEFFDTDN----EMVFVGGGAGMAPMRSHIFDQLKRLHTSRKMSFWYGAR
NIA7_HORVU      ----------GAPVDIKGPVGHAFTVGGERARRLAMVAGGTGITPVYQVIQVLRDQPDDTTEMHLVYANR
NB5R3_RAT       ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQ
FHBB_DICDI      VSNHFHNNIKGDVVPMSVPAGD-FVVNNDSETPILLICGGVGINPLFSMLETLVQQPDRKINFIFSTHCE
NQRF_CHLTA      CSSYIFSLKPGDKVMISGPYGESFMKED--NRPVIFLIGGAGSSFGRSILDLLLNKHSDRE-LTLWYGAR
NB5R3_MOUSE     ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQ
NQRF_VIBMA      MSSYIFSLKAGDKVTISGPFGEFFAKET--DNEMVFVGGGAGMAPMRSIFDQLNRDTKRKVSFWY--GAR
NQRF_PHOPO      MSSFIWSLKEGDKCTISGPFGEFFDTDN----EMVFVGGGAGMAPMRSHIFDQLKRLHSKRKMSYWYGAR
NQRF_COLMA      MSSYIFSLKAGDKVTISGPFGEFFAKET--DNEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGAR
NQRF_CHLTR      CSSYIFSLKPGDKVMVSGPYGESFMKED--NRPVIFLIGGAGSSFGRSILDLLLNKHSDRE-LTLWYGAR
NQRF_CHLCV      CSSYIFSLKPGDKITVSGPYGESFMKEN--NRPLIFLIGGAGSSFGRSHILDLLLNKHSTRDITLWYGAR
NIA_NEUCR       -----------------------------KVKRFVMVCGGSGVTPIYQVAEAVAVDDQDGTECLVLDGNR
NIA_BETVE       ----------GSVLHVKGPLGHNFLVHGEPAKRLAMVAGGTGITPIYQVIQAILKDPEDETEMFVVYANR
NIA3_MAIZE      ----------GAHVDVKGPLGHGFVIDGKKAGRLAMVAGGSGITPIYQVIQVLRDQPEDKTEMHLVYANR
NIA2_SOYBN      MSQHLDSLPIGSVLDVKGPLGHNFLVHGKPATRLAMLAGGTGITPIYQVVRAILKDPEDCTEMHVVYANR
NB5R3_PIG       ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQ
MCR1B_VANPO     MSSHMFSLKPNDTVSFTGPIVK-YEWKQNKFDSVTLLGAGSGITPLYQLMGSILSNPEDKTKINLFYANK
TAH18_CANAL     CTRWLKNLKPGDQ-FLFSIQRSSFKYKD-DNSPIIMVAPGTGIAPMKSLIDEVIQNNSKQELYLFFGCRF
NCB5R_ASPOR     ISKYLTTLKIGDNMKVRGPKGAMVYTPNMC-RHIGMIAGGTGITPMLQIIKAIIRNGNDTTQVDLIFANV
NB5R3_CANFA     ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAIIKDPHDPTVCHLLFANQ
NB5R3_BOVIN     ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQ
MMOC_METCA      LPEGRFSDYVGQVLSVKGPLGV-FGLKERGMAPRYFVAGGTGLAPVVSMVRQMQEWTAPNET-RIYFGVN
FENR_SYNY3      CSTYLCNIKEGDDIAITGPVGKEMLLPPDEDANIVMLATGTGIAPFRAFLWRMFKEQHEDYKFKLIFGIP
NQRF_SHEPU      MSSYIFNLKAGDKVTISGPFGEFFVKET--DAEMVFIGGGAGMAPMRSHIFDQLKSKKTKRKMSFWYGAR
NQRF_CHLFF      CSSYIFSLKPGDKITVSGPYGESFMKEN--NRPLIFLIGGAGSSFGRSHILDLLLDKHSTRDITLWYGAR
NIA1_PHAVU      -------------------------------KRLTMLAGGTGITPIYQVVQAILKDPEDRTEMYVVYANR
PYRK_BACSK      GTKRLAAQRVGTEVDVLGPLGQGFPLE--EAKRXXXXXXXXXXXXXXXXXXXXRRLVENGARVTSVLGFA
NIA_PHYIN       ----------GQQIQIKGPYGDGLETTNFHAYKFGFVAGGTGITPVYQVMRAILEDAKDQTKVALIYCVR
NB5R3_MACFA     ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQ
NIA1_ORYSJ      MTQYLDSLPVGAYIDVKGPLGHGEFVINGKARRLAMIAGGSGITPMYQVIQVLRDQPEDTTEMHLVYANR
NCB5R_ASPTN     ----------GDTLKVRGPKGAMVYTPNMC-RHIGMIAGGTGITPMLQIIKAIIRNGNDTTKIDLIFANV
FRE_VIBHA       YALEVVEAMQAGHIEIDAPHGDAW-VQEESERPLLLIAGGTGFSYVRSILDHCVAQNK-TNPIYLYWGAR
TAH18_ASHGO     CTNYISDLSEGSIIRYKVQYNDLLPAGK-QDRPVIMISPGVGLAPMKCLIYAQLFNP----MLLFFGNRY
HMP_BACSU       VSSYLHDLQEGDSIEISAPAGD-FVLDHASQKDLVLISAGVGITPM------------------------
NB5R4_XENTR     ITPHLENLTVGDYISISNPQGSSFQIENVM--DVFLVAAGTGITPMIRLLQHVLTCVSSLRKAKLIFFNK
NB5R4_HUMAN     FTPELDRLQIGDFVSVSSPEGN-FKISKFQELELFLLAAGTGFTPMVKILNYALTDIPSLRKVKLMFFNK
NB5R4_BOVIN     FTPELDQLQIGDYVSVSNPEGNFIISQLQELEDLFLLAAGTGFTPMVKVLNYALTNIPSLRKVKLMFFNK
HMP_OCEIH       VSNYLHTSVEGSVLPISAPAGD-FILDERDHRPLVLISGGVGLTPIMSMLE-------------------
FRE_PHOLU       YAMAVMDRILDQKVIIDIPHGKAW-FRKSSANPLLLIAGGTGFSYTRSILTALEEQPK-----RHISMYW
FRE_ECOLI       YAKAVMDRILKDQIVVDIPHGEAW-LRDDEERPMILIAGGTGFSYARSILTALARNPN--RDITIYWGGR
FRE_ECOL6       YAKAVMDRILKDQIVVDIPHGEAW-LRDDEERPMILIAGGTGFSYARSILTALARNPN--RDITIYWGGR
FRE_ECO57       YAKAVMDRILKDQIVVDIPHGEAW-LRDDEERPMILIAGGTGFSYARSILTALARNPN--RDITIYWGGR
FENR_AZOVI      LTSRLQHLKEGDELMVRKPTGTLVTSDLLPGKHLYMLSTGTGLAPFMSLI----QDPEVYERFVLIHGVR
BENC_ACIAD      ----------GDKMSFTGPFGS-FYLRDVK-RPVLMLAGGTGIAPFLSMLQVLEQKGSE-HPVRLVFGVT
RBOHD_SOLTU     VADYLQDKINYPKVLIDGPY--GAPAQDYKEYEVLLLVGGIGATPMISIVKDIVNNMKE-----------
NQRF_CHLMU      CSSYIFSLKPGDKVTVSGPYGESFMKED--NRPVIFLIGGAGSSFGRSILDLLLSKHTNRE-LTLWYGAR
NB5R4_MOUSE     FTPELDRLQIGDFISVSGPEGN-FKVSKLQEVELFLLAAGTGFTPMVTVLNYALSHMSSLRKVKLMFFNK
HMP_VIBVY       VSNYLHDHLDGSKVKLAAPAGDFF-LDAAPTAPVVLISAGVGLTPTLSMLESLTEHQAPV---TWIHATE
HMP_VIBVU       VSNYLHDHLDGSKVKLAAPAGDFF-LDAAPTAPVVLISAGVGLTPTLSMLESLTEHQAPV---TWIHATE
FENR_SYNP2      -----------DDVKITGPVGKEMLLPDDEDATVVMLATGTGIAPFRAFLRMFKEQHEDYKKAWLIFGVP
C505_FUSOX      ATNFLSHLTAGDKLHVSRASSEAFHLPSDAEKTIICVAAGTGLAPLRGFIQERAAMLAAGRTLALFFGCR
NIA1_HORVU      ---------------VKGPLGHNFVINGKRARRLAMICGGSGITPMYQVIQVLRDQPEDETEMHLVYANR
NCB5R_EMENI     ISKYLTTLKVGDTMKVRGPKGAMVYTPNMC-RHIGMIAGGTGITPMLQIIKAIIRNGNDTTQVDLIFANV
FRE_VIBFI       YAGEVVESMKGGDILIDAPHGEAW-IREDSDRSMLLIAGGTGFSYVRSILDHISQQIQ--KPIYLYWGGR
DUOX2_PIG       WTTRLREIYSGDKLYLDGPFGEGHQ-EWHKFEVSVLVGGGIGVTPFASIL--------------------
DUOX2_HUMAN     WTTRLREIYSSPKLYLDGPFGEGHQ-EWHKFEVSVLVGGGIGVTPFASIL--------------------
DUOX1_CANFA     WTTRLREIYSGDKLYLDGPFGEGHQ-EWHKFEVSVLVGGGIGVTPFASIL--------------------
CARY_BACST      ----------------------------------------------------------------------
Y325_THEMA      ---------------------------NFQGKVVLITGAGSGIGK-KAAVMFAERGAKVAETVELIKSMG
NCB5R_NEOFI     ----------GDTMKVRGPKGAMVYTPNMC-RHIGMIAGGTGITPMLQIIKAVIRNGNDTTKLDLIFANV
DUOX1_HUMAN     WTTRLREIYSGDKLYLDGPFGEGHQ-EWHKFEVSVLVGGGIGVTPFASIL--------------------
CYPE_BACSU      ASNYLAELNTGDAAFIRTPQ-SGFQMPNDPETPMIMVGPGTGIAPFRGFIQARSVLKKEGSTLLLYFGCR
PYRK_AQUAE      ----------------------------------------------------------------------
NCB5R_ASPCL     ISKHLTTLKVGDVMKVRGPKGAMVYTPNMC-RHIGMIAGGTGITPMLQVIKAIIRNPRDITKVDLIFANV
FENR_THEEB      CSSYLNQLQPGDEVKITGPVGKEMLLSDDPEATIIMLATGTGIAPFRAFLRMFKENNPDYQFKGLAWLFF
FENR_CYAPA      CSNYLCDLKPGDEVMITGPVGTTMLMPEDQSATIIMLATGTGIAPFRSFLRRMFEETHADYKFNLFLGVP
DUOX2_RAT       WTTRLREIYSPPKLYLDGPFGEGHQ-EWHKFEVSVLVGGGIGVTPFASIL--------------------
NB5R4_RAT       FTPELDRLQIGDFVSVSGPEGN-FKVSKLQEVELFLLAAGTGFTPMVTVLNHALTHMSSLRKVKLMFFNK


                         +         .         .         .         .         *         .:210
query           GPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYIPELEIKDMDNVQVIVVGPPMMMKFTVLE
ASRB_SALTY      NRDCVLYKEEMATWRGKHNLVLTLDEGEADDRYQIGRVTDRLADMTLSDIDTMQAIVVGPPIMITFTVKM
PYRK_PYRKO      S-KDELSLLDIENYVDDA--VITTD---DGSAGRKGFPTEVLAERR-EEFD--QVYACGPEPMLKAVL--
PYRK_PYRHO      G-KDELALLDIENYVD--EIVITTDDGSYGIKGPTDVLAKRKEEFS-------QVYACGPEIMLA-KVLE
PYRK_CLOPE      --DDIYLVDEIAEYVDEVKI-----STNTGKHGHKGFVTEILP---LQEYDT--VLCCGPEIMMK-KVVE
PYRK_THEVO      TRDELIFKDRFPESRR----FIATDDGSDGFHGFAHELLQRI------NIDSYEAIYVCGPEQMMYKVLQ
PYRK_METMA      SEEHLLFEG---RFEALGTVYVSTDDGSKGFK---GFVTDVLKNLDVTSYD--RIAVCGPEIMMA-SVFR
PYRK_PYRAB      SKEELATLDIENYVDE---VVITTDDGSAGIKGFPTDV------LARRKVEFSQVYACGPEVMLA-KVLE
PYRK_METBF      SAGDLLFEKRFAEAGK------VYISTDDGSKGTKGFVTDVLTDLDLSVYD--RIAVCGPEIMIS-SVFR
PYRK_PYRFU      TKEEIALPKDIESYVDEV--IITTDDGSYGIKGPTDVLMERRSEFDY-------VYACGPEIMLA-KILE
PYRK_ARCFU      TAKNLFWLDKFDR--------ITVTTED----GSFGLKGTVLDALKLEKLDEYEKIYVCGSEGMLRATYD
PYRK_UNCMA      TKEEVHFED---RYRAAGELVVATD---DGTYGKKGYVTDLLKSVDLKKF--TQIYCCGPEKMMYRVLCA
PYRK_METAC      SAGDLLF-----EWRFEALGDIYA-STDDGSKGVKGFVTDVLKGLDVAAYD--RIAVCGPEIMMA-SVFR
PYRK_METJA      TKEELLFLD---RFEKVSRLEICTDDGSFGFKGFTTEKMKEVLKEEKFDL----IITCGPEIMMKKVVEI
PYRK_THEAC      TKEELIFTDRFPE----SRLFIATDDGSEGFHG---FPHEFLDRLDISVYR--KIYVCGPEPMLYRVMQK
PYRK_METTH      TADELLFLDRLE--AAGVNISTCTDDGSCGFKG-------FAHERLLTLEENHDMAAVCGPEPMMFQVMR
PYRK_CLOAB      TVSKTV--DNVEKYVKELKL-----STEDGSIGHKGYVTD-----NFKPEEYDYVLCCGPEIMM-YKVVK
PYRK_METBU      ECYELVFED---RFSSAGELHITTD---DGSAGTCGFVTTVLADMDVSVYD--RICVCGPEIMMA-NVMK
PYRK_STRMU      NKDAVILEEKMSQYA---TVVVTTD---DGSYGQKGYVSTVVDNL---DFLADAIYACGAPGMLKYVDKK
MCR1_KLULA      TPEDILLKSELKKYPDQVKITYFVDKAEGNFEGETGFITKYLSHQAPKPSEKNQVFVCGPPPFMK-----
PYRK_LISIN      SEKDSFYEKEMTEY--GTVHIATVDGS-YGTQGFVTDITKNFPE------EPDVIYSCGPKAM-----LQ
PYRK_LISMH      SAKDSFYEKEMTAY--GTVHIATVDGS-LGTQGFVTDVTKNFPE------EPDVIYSCGPKAM-----LQ
PYRK_LISMO      SAKDSFYAQEMAEY--GTVHIATVDGS-LGTQGFVTDITKNFPE------EPDVIYSCGPKAM-----LQ
PYRK_BACLD      SAKDVFYEQEFSRFGR-----VYVATAD-GTRGSKGFVTDVI---ENEGLQFDCIMACGPTPMLKA----
PYRK_LISMF      SAKDSFY-------EKEMNAYGTVHIATDGSLGTQGFVTDITNNFEEPDV----IYSCGPKAM-----LQ
PYRK_BACSU      SAKDVFYEEECRQYGD------TYVATADGSYGETGFVTDVIKR---KKLEFDILLSCGPTPMLKA----
PYRK_BACA2      SAKDVFYEQECRAYGD------TYVATADGTYGEKGFVTDVIRE---KQLEFDVLLSCGPTPMLKA----
YADH_CLOBE      N-KDLLIYEE-KLNKAAGNLYVTTDDGSYEFKGTGSDMLKELVNNQGKKYDH--AIIIGPMIMMKFTSML
PYRK_LISMC      SAKDSFY-------EKEMNAYGTVHIATDGSLGTQGFVTDITNNFEEPDV----IYSCGPKAM-----LQ
PYRK_BACP2      SKKDVFYEEKFQALGDTF--IATVD----GTYGAKGFVTNVIEE---NDLSFDVMLSCGPTPMLKA----
PYRK_LACLM      SENVKILENEFSNL-KNVTLKIATDDGSYGTKGHVGMLMNEI------DFEVDALYTCGAPAMLKAVA--
PYRK_LACLA      SEKVKILEKEFAEL-KNVSLKIATDDGSYGTKGHVGMLMEEI------DFEVDALYTCGAPAMLKAVA--
NCB5R_YEAST     HEEDILLKKELEALPSQFKIVYYLDSPDEDWTGGVGYITKDVEHLPAATMDNVQILICGPPAMV------
PYRK_THEMA      TKDYLIMVDEFKEIS---DVLLVTD---DGSAGMKGVVTDAMDKLFRERKFDI-CWAVGPTIMMKFCTLK
MCR1_MAGGR      TEEDILLKKQLAELEQRFRAFYVLDNPPKDWAGTKGYITKDLLKTVLPEEENIKVFVCGPPGMMK-----
PYRK_BACCQ      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_FUSNN      SKDEVFYEDEFKKFGE------TYVSTIDGSVGTKGFVTDVIKKLQAENLVFDKYYSCGPVPMLKALV--
PYRK_LISW6      SAKDSFYEKEMTKY--GTVHIATVD----GTLGTQGFVTDITKNLEEPDV----IYSCGPKAM-----LE
PYRK_LACLS      SENVKILENEFSNL-KNVTLKIATDDGSYGTKGHVGMLMNEI------DFEADALYTCGAPAMLKAVA--
MCR1_EMENI      SEEDILLKREFEDLEQRFRAFYVLDNPPEGWTGGKGYITKELLKTVLPEEENIKIFVCGPPGMYK-----
PYRK_METKA      HADRLPRKDDLEKLSDELYV-----TTEDGSEGRKGFPTDVLEELVEKECPDV-VYACGPEGML-VRVAE
MCR1_CANAL      TPEDILLKKEISKHKDQVKVHYFVDKADEKWEGQIGFITKEFLQKELKPGSDFKVFVCGPPGLYK-----
NCB5R_LACBS     NEEDILLRAELDAYESRFNLFYVLNNPPSGWTGGVGFVTKE----HIKDLSNSKILICGPPPMV------
MCR1_LODEL      SPEDVLIKDRIDDIQVKVTYFVDENKATKDWEGEVGFITKEFLEKELKPSPDFKIFVCGPPGLYK-----
NCB5R_YEAS7     HEEDILLKKELEALPSQFKIVYYLDSPDEDWAGGVGYITKDVEHLPAATVDNVQILICGPPAMV------
NCB5R_PICST     TESDILLKSELDKWAENFSVHYVLNEAPENWKGSVGFVTPEIIDSKLKASDDSNLLLCGPPPMI------
NCB5R_LODEL     TENDILLRDELEQYAKRLKIHHVLNEAPEGWQHLTGFVTPELIDKHLKPSADTNLLLCGPPPMI------
MCR1_USTMA      TEQDILLRDQLAKKDDRFTIIYGLDKLPKGFNGFEGYVTKHLPQPEL--ADKAKIFVCGPP---------
NCB5R_ARATH     SPDDILLKDVLQANHPNLKIFYTVDNPTKNWKGGVGYISK---DMALKGLDDTLILVCGPPGMME-----
MCR1_AJECN      TEEDILLRKEFEHLERRFRAFYTLDKPPKNWAQGTGFITKDLLKTVLPETENIKIFVCGPPAMYK-----
MCR1_PHANO      SEEDILLK---KEWEQRFRAFYVLDNPPESWQGGKGFITKELLKTEPKEGEKVKIFVCGPPGMYK-----
MCR1_DEBHA      TEKDILIKKELEKHKDQVNVVYFLDKAPENWNGETGYISKEFLQSKLPGKDN-KVFVCGPPGLYK-----
NB5R2_DANRE     TEKDILLRNELDEVHRNLKLWYTLDRPSEGWKYSEGFVNAAMMKDHLPPADDVLVVMCGPPAMIEKACLN
MCR1_NEUCR      SEEDVLLKHELNHYPQRFRAFYVLDNPPKEWAGNKGYINKDLLKTVLPEPKNIKIFVCGPPGMM------
MCR1_YARLI      TEGDILLKDEIKAKPQQFNVHYFLDKPSDNWKGENGFISEEFGNSPAADSDNVKVFVCGPPPFYK-----
MCR1_COCIM      TEEDILLKKELNTYPRRFRAFYLLDKPPAGWTQGTGYVTKELLKTVLPETENIKIFVCGPPGMYK-----
NIA2_ARATH      TEEDILLREELDGWAERLKVWYVVESAKEGWAYSTGFISEAIMREHIPDLDSALAMACGPPPMIQFAVLE
MCR1_PICST      TPDDILIKKELAKHKDQVKIVYFVDKADASWKGETGYISKEFKNLPAPGPDN-KIFVCGPPPLYK-----
PYRK_THETN      RETFLV--------EKFEGLXXXXXXXXXXXXXRKGLVTSVVEEM-IGEVD--IVYGCGPKPMLKALQEI
PYRK_GEOSW      TKEVVFYEREFAEFGE--TYIATVD----GSHGTKGFVTDVIHERAISDV----LYACGPKPMLK-----
NIA_SPIOL       TEEDILLREELDKWRDRVKVWYVVEKAEEGWKYDTGFISEKILRDHVPAVDDVLALTCGPPPMIQFAVLD
MCR1_CHAGB      REDDILLKKELAALENNFRAFYVLDDPPKHWTGGKGFITKDLLKTEPKD-ENIKVFVCGPPGMM------
MCR1_BOTFB      TEEDILLKREFEDLEQRFRAFYVLDNPPKSWSGGKGFVNKELLKTVLPETENVKVFVCGPPGMYK-----
MCR1_ASPCL      SEEDILLKKELQELERRFKAFYVLDNPPKEWTGGKGYVTKELLKTVLPEEEDIKIFVCGPPGMYK-----
MCR1_ASHGO      TPQDILLRKELEEYPDQVKVTYFVDKPEGDYKGEKGFITKFLKQNLPTPGSNSHIFVCGPPPFM------
PYRK_ENTFA      GVKVIHFKEVAYYQQEFMALGETHFATDDGSFGAHGNVGRLLSEALAKGRIPDAVYACGANGMLKAIDSL
MCR1_ASPNC      KEEDILLKKEFEELERRFRAFYVLDNPPKEWTGGKGYISKELLKTVLPEEENIKIFVCGPPGMYK-----
NIA_SOLLC       TEDDILLKDELDAWAEQVPNRVKVESITQGWKYSTGFVTESILREHIPEPSHTTLLACGPPPMIQFAILE
MCR1_SCLS1      TEEDILLKREFEDLEQRFRAFYVLDNPPKSWKGGKGFINKELLKTVLPESENIKLFVCGPPGMYK-----
NCB5R_KLULA     TEEDILLKKELDAFVEQFKVYYLLDKAPEAWTGGVGYITDTMKERLPAPAEGVQLLVCGPPPMV------
NCB5R_ASHGO     TKDDILLKPELDAMPDQFKILYMLDKVAEGWEGKLGYITEAI----------------------------
NQRF_IDILO      SKKEMFYVEDLAEENENFDWHVALSQPEDNWEGDTGFIHNVLYERYLKDHDDCEFYMCGPPVMNAAVINL
NIA_CUCMA       TEDDILLRDELDTWAKKNQRLVVQESIREGWEYSVGFITENILREHIAAAEDTLALACGPPAMIQFAVQP
NCB5R_YARLI     NHDDILLKDAIAAENDNIKIHYVLNNAPEDWTGSVGFVTKEILEKHCPPPPNTKLLLCGPPPMI------
NCB5R_VANPO     EEXXXXXXXXXXKFAASKPGQITIDKPSENWKGGSGYVT---PELMKEKLDGVQLLVCGPPMV-------
NQRF_METCA      SLREAFYVEEFDRLQENPNLGLSDPKPEDGWTGYTGFIHNILYEQYLKNPEDCEYYMCGPPMMNSAVIQM
MCR1_NEOFI      REEDILLKKELQELERRFRAFYVLDHPPKEWTGGKGYITKELLKTVLPEEENIKIFVCGPPGMYK-----
NIA_PETHY       TEDDILLKDELDSWERVKVWYVVQDSIKEGWKYSTGFITEAVLREHIPPSQTTLALACGPPPMIQFAV--
NIA1_ARATH      TEDDILVREELEGWKERLKIWYVVEIAKEGWSYSTGFITEHIPELEGESL----ALACGPPPMIQFALLE
NCB5R_PICGU     TEEDILLRAELKEHPDRFKVHYVLNNAPENWNGSVGFVTPEIMELPNKDQDGYLLLCGPPPMI-------
PYRK_STRR6      NKDAVILKTELAQYGQ---VFVTTDDGSYGIKGNVSVV--------INDLDSQAVYSCGAPGMMKYINQT
NQRF_PSEA6      SLREMFYVEDFDMLQKKWHVALSDPQPEDNWEGMTGFIHQVLLENYLKDPEDCEFYMCGPPMMNAAVISM
NIA2_TOBAC      TEDDILLKEELDSWAEKIPERVKVDSIKEGWKYSIGFITEAILREHIPEPSHTTLLACGPPPMIQFAV--
NIA2_PHAVU      TEDDILLREELDTWAKRFKVWYVVETAKEGWGYGVGFITEAIMREHLPEASSDSLMTCGPPPMIQFAVQP
PYRK_BACHD      SAKDSFYYEQFSQL--GTTYVATVD----GTAGTKGFVTHVLNQEALSY--NV-VYSCGPTPMLKAVSER
NCB5R_CANGA     LEEDILLKQELKQRPDQFKITYLLDKPEDDWEGGVGYVTDLMKESFPSAEEDVQLLVCGPPGMV------
PYRK_STRPN      NKDAVILKTELAQYGQ---VFVTTDDGSYGIKGNVSVV--------INDLDSQAVYSCGAPGMMKYINQT
PYRK_LYSSC      TEDVCFYEEEFSALGE--THYVTVD----GSKGTKGFVTNVLPEFDV-------FYSCGPLPMLK-----
NIA_LOTJA       TEDDILLREELDTWEDRFKVWYVVETAKEGWGYSVGFVTEGVMREHLPEADDALALACGPPPMIQFAV--
NCB5R_DICDI     XXXXXXXXXXXXXXHPQFKVYYVLNNPPKGWTQGVGFVSKEIIESRLSPSDQTMVIMCGPPMMNKAMTGH
NQRF_SERP5      SLREMFYEEDFNQLQENENVALSDPQPEDNWTGYTGFIHNVLLENYLRNPEDCEFYMCGPPMMNAAVIKM
NQRF_MARMS      SVREAFYTEEYKLQEENENLALSDPQPEDNWEGKTGFIHNVLYESYLKDPEDCEFYMCGPPMMNASVIKM
NIA1_TOBAC      TEDDILLKEELDSWAEKIPERVKVDSIKEGWKYSLGFISEAILREHIPEPSHTTLLACGPPPMIQFAV--
PYRK_STRTD      NKNAVILEDKLRACG---DVYVTTDDGSYGIKGYVSTV------IDNFDWTPDAVYSCGAPGMLKYVDSK
NQRF_YERPS      SRREMFYEEDFDQLQARWHVALSDPQPEDNWTGYTGFIHNVLLENYLKDPEDCEFYMCGPPMMNAAVIKM
NQRF_YERPP      SRREMFYEEDFDQLQARWHVALSDPQPEDNWTGYTGFIHNVLLENYLKDPEDCEFYMCGPPMMNAAVIKM
NQRF_YERPN      SRREMFYEEDFDQLQARWHVALSDPQPEDNWTGYTGFIHNVLLENYLKDPEDCEFYMCGPPMMNAAVIKM
NQRF_YERPE      SRREMFYEEDFDQLQARWHVALSDPQPEDNWTGYTGFIHNVLLENYLKDPEDCEFYMCGPPMMNAAVIKM
NQRF_YERPA      SRREMFYEEDFDQLQARWHVALSDPQPEDNWTGYTGFIHNVLLENYLKDPEDCEFYMCGPPMMNAAVIKM
NQRF_YERP3      SRREMFYEEDFDQLQARWHVALSDPQPEDNWTGYTGFIHNVLLENYLKDPEDCEFYMCGPPMMNAAVIKM
NQRF_VIBAN      SKREMFYVEDFDGLAENSNFVLSDPMPEDNWDGYTGFIHNVLYENYLKDPEDCEYYMCGPPMMNAAVIGM
NCB5R_CANAL     TESDILLKEELDNFPDRLKIHYVLNEAPANWQGSVGFVTPEIIDTHLKASNDTNLLLCGPPPMV------
YMM5_YEAST      TENDILLKDELDEMAEHFQVHYVVHYPSDRWTGDVGYITKYLPEYS----EDNRLLICGPDGM-------
PYRK_BACWK      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDSYGI-DFD---ILYSCGPLAM----LR
NIA1_BRANA      TEDDILVREELEGWASRLKIWYVVEIAKEGWEYSTGFITEHVPELEGESL----ALACGPPPMIQFALLE
XYLA_PSEPU      QQRDLYCLDEIEDWGGRFELILSEESSTSSWKGKRGMVTEYFK--EYLTGQPYEGYLCGPPPMVDAAETE
NCB5R_COCIM     NPDDILLKEELDQLAKEFRIYYVLNNPPEKWNGGVGFVTPDMIKAKLAPAGDIKVLICGPPPMVSAMKKA
DMPP_ACICA      GARDLLFEQLVKDY-PNFRYILNAPKPEDQWTGFTGFVHEAVADYFENRCGGHKAYLCGPPIMIDSAIST
PYRK_BACCN      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDNYGI-DFD---ILYSCGPLAM----LR
NQRF_VIBVY      SKREMFYVEDFDGLAENDNFVLSDPLPEDNWDGYTGFIHNVLYENYLRDHDDCEYYMCGPPMMNAAVIGM
NQRF_VIBVU      SKREMFYVEDFDGLAENDNFVLSDPLPEDNWDGYTGFIHNVLYENYLRDHDDCEYYMCGPPMMNAAVIGM
NQRF_PSYCK      SIREMFYVEDYDQLEEEFHVALSDPLPEDNWDGYTGFIHNVLLEEYLKDHPNCEYYMCGPPMMNAAVIDM
NIA_PICAN       KVDDILLREELPEQFKVDYSLSDLDHLPENWSGVRGRLTFDILDTYVKKMGEYMLLVCGPPGM-------
NIA_EMENI       LEEDILLKNELDEFEEKCKIVHTLTKGSESWTGRRGRIDEELIRQHAGTPDETMVLVCGPEAMEKASKKI
NCB5R_MORAP     TEEDIILKDLLSQKHPQFKVYYVLNNAPEGWTGGVGFVADMIKEHMPAPAADIKVLLCGPPPMV------
NCB5R_DEBHA     TEDDILLKEELREHPDRFKIYYVLNTPPENWTGGVGFVTPEIMDKHLKASEATNLLLCGPPPMI------
PYRK_BACC2      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDNYGI-DFD---ILYSCGPLAM----LR
NQRF_VIBAL      SKREMFYVEDFDMLQENDNFVLSDPLPEDNWDGYTGFIHNVLYENYLRDPEDCEYYMCGPPMMNAAVIGM
NIA_FUSOX       SVNDILCMXXXXXXXRVVNALSNPPPEWNGLKGNQALVPEYMDLPKASGEGDELLLVCGPPPMVKAVEAS
MCR1_PICGU      TEEDILIKDDIAEKHKDVSITYFVDKASANWKGETGHIDKEFLQSNLPPSKDSKVFVCGPPGLYK-----
PYRK_BACHK      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_BACCZ      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_BACCR      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDNYGI-DFD---ILYSCGPLAM----LR
PYRK_BACC7      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_BACC1      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_BACC0      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_BACAN      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_BACAC      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_BACAA      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
NIA2_BRANA      TEDDILVREELEGWKDRLKVWYVVEIAKEGWNYSTGFITEHVPELEGESL----ALACGPPPMIQFALLE
MMOC_METTR      NREELFYVDELKTLAQSM----------------------------------------------------
NQRF_YERE8      SRREMFYEEDFDQLQARWHVALSDPQPEDNWTGYTGFIHNVLLENYLKNPEDCEFYMCGPPMMNAAVIKM
NQRF_SHEDO      SKREMFYVEDFENENFQWHVALSDPQAEDEWTGYTGFIHNVLYENYLRDHDDCEFYMCGPPMMNAAVISM
NCB5R_SCHPO     SEGDIVLRDEIDALAKRFTVHYVLNNPPENWKGSVGFVTQELIKAHFAPSPETKVLICGPTPMV------
ASCD_YERPS      AGHN-FYSDIANEWHPNIHYVPVVSGDDSTWTGATGFVHQAVLE-DIPDLSLFNVYACGSLAMITAARND
ASCD_YERPE      AGHN-FYSDIANEWHPNIHYVPVVSGDDSTWTGATGFVHQAVLE-DIPDLSLFNVYACGSLAMITAARND
PYRK_BACC3      -TKDVVFYEE-KFAELGDAYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
PYRK_BACAH      -TKDVVFYEE-KFAELGDAYVATVD----GTHGTKGFVTDVIDHYGI-DFD---ILYSCGPLAM----LR
NQRF_VIBCH      SKREMFYVEDFDGLAENDNFVLSDPQPEDNWTGYTGFIHNVLYENYLKDHEDCEYYMCGPPMMNAAVINM
NQRF_VIBC3      SKREMFYVEDFDGLAENDNFVLSDPQPEDNWTGYTGFIHNVLYENYLKDHEDCEYYMCGPPMMNAAVINM
NQRF_HAES1      SKREMFYVEDFDMLQENDNFVLSDPLPEDDWDGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVIKM
NDOR_PSEPU      SQQDLLHKLAADHPQLTVHTVIATGPINEGQ--RAGLITDVI-EKDILSLAGWRAYLCGAPAMVEALCTV
NB5R2_XENTR     TEDDILLRYELKSHPEQFKLWYTLDRPPQGWKYGAGFVTDMIKEHLPPPSEDVVVLMCGPPPMIQFACQD
MCR1_ASPOR      TEDDILLKKELQDLEQRFKAFYLLDKPPKEWTGGKGYINKELLKTVLPEEENQKIFVCGPP---------
PYRK_BACC4      -TKDVVFYEE-KFAELGDTYVATVD----GTHGTKGFVTDVIDNYGI-DFD---ILYSCGPLAM----LR
NQRF_VIBPA      SKREMFYVEDFDGLAENDNFVLSDPLPEDNWDGYTGFIHNVLYENYLRDPEDCEYYMCGPPMMNAAVIGM
NQRF_ACTP2      SKREIFYQEDFDQLAENDNFVVALSDAEDNWTGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVIGM
NCB5R_AJECN     NPDDILLKDELDQLAKGFRVFYVLNNPPEGWEGGVGFVTPDMIRAKLAAAPDTKVLICGPPPMVSAMKKA
YMI7_YEAST      TEDDILMKDHMAKEYPHFKVHYVIHKPNGKWNGDVGYVTRYLP----KQAEDHRLLICGPPKMNEM-VLN
NQRF_PASMU      SKREMFYVEDFDTLQENDNFVWHVALSDDNWDGYTGFIHNVLYENYLKDPEDCEYYMCGPPIMNASVIKM
NQRF_NEIMF      SKREMFYVEDFDQLAAEFHVALSDPLPEDNWDGYTGFIHNVVYENHLKNPEDCEFYMCGPPIMNQSVIKM
NQRF_NEIMB      SKREMFYVEDFDQLAAEFHVALSDPLPEDNWDGYTGFIHNVVYENHLKNPEDCEFYMCGPPIMNQSVIKM
NQRF_NEIMA      SKREMFYVEDFDQLAAEFHVALSDPLPEDNWDGYTGFIHNVVYENHLKNPEDCEFYMCGPPIMNQSVIKM
NQRF_NEIM0      SKREMFYVEDFDQLAAEFHVALSDPLPEDNWDGYTGFIHNVVYENHLKNPEDCEFYMCGPPIMNQSVIKM
NQRF_HAEI8      SKREIFYQEDFDQLQENPNFVVALSDAEDNWTGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVIKM
NQRF_VIBHB      SKREMFYVEDFDGLADNDNFVLSDPLPEDNWDGYTGFIHNVLYENYLRDPEDCEYYMCGPPMMNAAVIGM
NQRF_NEIG1      SKREMFYVEDFDQLAAEFHVALSDPLPEDNWDGYTGFIHNVVYENHLKNPEDCEFYMCGPPIMNQSVIKM
NQRF_HAEIN      SKREIFYQEDFDQLQENPNFVVALSDAEDNWTGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVIKM
NQRF_HAEIE      SKREIFYQEDFDQLQENPNFVVALSDAEDNWTGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVIKM
NB5R2_XENLA     TEDDILLRYELKSHPEQFKLWYTLDRPPQGWKYGSGFVTDMIKEHLPPPSEDVLVLMCGPPPMIQFACQD
NQRF_KLEP7      SLREMFYDEEFEQLARDFHVALSDPLPEDNWTGHTGFIHNVLYENYLRDPEDCEFYMCGPPVMNAAVIKM
NQRF_HAEIG      SKREIFYQEDFDQLQENDNFVVALSDAEDNWTGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVIKM
NQRF_HAEDU      SKREMFYVEDFDQLQAKWHVALSDPLPEDNWDGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVIGM
NCB5R_ASPNC     NPDDILMKDELEQLAKGFRIYYVLNNPPEGWTGGVGFVTDMIKERLPAPSSDIKVLLCGPPPMV------
NQRF_PSYA2      SIREMFYVEDYDQLEADFHVALSDPQPEDNWTGYTGFIHNVLLEEYLKGHPNCEYYMCGPPMMNAAVIDM
NQRF_PSEAE      SLREAFYTEEYDQLQENPNLALSDPQPEDNWTGLTGFIHNVLFENYLKDPEDCEFYMCGPPMMNAAVIKM
NQRF_PSEAB      SLREAFYTEEYDQLQENPNLALSDPQPEDNWTGLTGFIHNVLFENYLKDPEDCEFYMCGPPMMNAAVIKM
NB5R2_HUMAN     TEEDILVRKELEEIARQFNLWYTLDRPPIGWKYSSGFVTDMIKEHLPPPAKSTLILVCGPPPLIQ-----
NB5R2_CHICK     TEKDILLRAELEDIAKQVRLWYTLDRPPQDWKYSSGFVTADMIKTHLPPPGGETLILMGPPPMIQF----
NQRF_PSEA7      SLREAFYTEEYDQLQENPNLALSDPQPEDNWTGLTGFIHNVLFENYLKDPEDCEFYMCGPPMMNAAVIKM
NIA_ASPNG       QEEDILCRADLDAYEKKCKVVHTLTKAPDSWTGRRGRISELLKEHAIPDGKSM-VLICGPEAMEKSARKI
NCB5R_CRYNE     QEDDILLKKEIDELQAKSNVKYVLNNPPEGWTGGVGFVTKEMIEEAMPSSEGHKVLMCGPPPMI------
NCB5R_ASPFU     NPDDILLKEELAAEDPDFNIYYVLNNPPQGWTGGVGFVTEMIKEHLPAPASDVKILLCGPPPMI------
FHBA_DICDI      NKQYQPFANELSQLEKSNKVKVSTVHSETDGQITKDKLEKFINPSQIKD---TKVFICGPVSFMSAINKQ
MCR1_YEAS7      TPQDILLRKELDALKENVTYFVXXXXXXXXXXGEIGFISKFIQEHVPGPKESTHLFVCGPPPFM------
NB5R2_RAT       TEEDILLRKELEEHQNQFSLWYTLDRPPSGWEYSSGFITDMIKEHLPPPGEATLILVCGPPPLIQ-----
NB5R1_MOUSE     TERDIILREDLEEYPNRFKLWFTLDSPPEDWTYSKGFVTDMIQEHLPAPAEDVLLLLCGPPPMVQ-----
RFBI_SALTY      YSKDFALPQQWSEQHDNVHYIPVVSGDDAEWGGRKGFVHHAVMD-DFDSLEFFDIYACGSPVMIDASKKD
NCB5R_NEUCR     TAQDILLKEDLDAQDKGIRVHYVLDRPPEGWTGGVGFVTEMVEKLLPKPASDVKILLCGPPPMI------
HMP_VIBPA       NSKHHAFKEHVNQLKENMNALIWYNTAEDKIGEDTGFVNLHEIEAALKQ-DNVQVYFCGPVGFMQHVAKQ
TMOF_PSEME      XXXXXXXXXXXFGWKENLKLISVVGNSEKKYP--TGYVHEIIPEY-MEGLLGAEFYLCGPPQMI------
NQRF_ACTSZ      SKREMFYVEDFDQLQENPNVALSDPLPEDNWDGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVIKM
NIA_LOTTE       TESDILLREELDAWAKRFKVWYVVDKAGNDWAFSTGRVNESIMRVHLPGPSDALALACGPP---------
MCR1_ASPTN      SEQDIXXXXXXNTYPQRFKAFYVLDNPPKEWTGGKGYISKELLKTVLPEEENIKIFVCGPPGLYK-----
BOXA_AZOEV      APEELPYFGPLQKLPK------------------------------------------------------
NQRF_MANSM      SKREMFYVEDFDQLQATWHVALSDPLPEDNWDGYTGFIHNVLYENYLKNPEDCEYYMCGPPVMNAAVINM
NIA_CICIN       TEDDILLREELDAWADKYSWYVVAKSIREGWKYSEGFITEDIMREHVPEVEDTLALACGPPPMIQFAI--
NB5R5_MOUSE     TFEGIYLKTFFQEQARFWNV--------------------------------------------------
MCR1_ASPFU      REEDIXXXXXXNTYPRRFRAFYLLDHPPKEWTGGKGYITKELLKTVLPEEENIKIFVCGPPGMYK-----
CYPD_BACSU      NDRDFIYRDELERFEK--DGIVTVHTA---FSRKEGMPKTYVQHLMADQADTL-----------------
NQRF_ALTMA      SLREMFYTEDFDELAAEWHVALSDPQPEDNWEGYTGFIHQVLLENYLKD---------------------
NB5R1_HUMAN     TEKDIILREDLEEYPNRFKLWFTLDHPPKDWAYSKGFVTDMIREHLPAPGDDVLVLLCGPPPMVQ-----
MCR1_YEAST      TPQDILLRKELDALKENVTYFVXXXXXXXXXXGEISFISKFIQEHVPGPKESTHLFVCGPPPFM------
NB5R1_RAT       TEKDIILREDLEELQARFKLWFTLDYPPEDWTYSKGFVTDMIQEHLPAPAEDVLLLLCGPPPMVQ-----
DMPP_PSEUF      NRAELLF-EELAARHPNFSYVPALNQANDDWQGFKGFVHDAAKAHFDGRFGGQKAYLCGPPPMIDAAITT
NQRF_COLPS      SKREMFYEDDYNGLAADWHVALSDPQPEDNWEGMTGFIHNVLFEEYLKD---------------------
NB5R1_BOVIN     TEKDIILREDLEELQARFKLWFTLDHPPEGWAYSKGFVSDMIREHLPAPGEDVLLLLCGPPPMVQ-----
MCR1A_VANPO     TSQDVLMKKELDEYPDQLRITYFITTPDKGYKGESGFISKFIASNADKPSPKSHVFVCGPPPFM------
CBDC_BURCE      RDDDLVGLDKLDELATQLSSYITTVVDKDSAQLRRGYVTQQITNDDMNGGD-VDIYVCGPPPMVE-----
NQRF_PSEHA      SKREMFYVEDFDGLEQNENFVLSDPQPEDNWEGYTGFIHNVLFENYLKD---------------------
NCB5R_USTMA     XXXXXXXXXXXXXXXXQFRISYFLNEAPEGWKGGVGFVTKEALEKNLKPANDIKVLMCGPPPMIK-----
NB5R2_MOUSE     TEEDILLRKELEEHHKQFNLWYTLDRPPSDWKYSSGFVSDMIKEHLPPPGEDTLILVCGPPPLIQ-----
NB5R3_HUMAN     TEKDILLRPELEELRNRFKLWYTLDRAPEAWDYGQGFVNEMIRDHLXXXXXXXLVLMCGPPPMIQYACL-
FRE_SALTY       EEKHLY---DLSELEPNLRIEPVVEQPEEGWRGRTGTV--------------------------------
NIA_LEPMC       LEEDILCREDLEENGERCTLVHTLTQAAEGWTGRRGRIGEELLKEFCGTEEDGLVLVCGP----------
NIA1_SOYBN      TXXXXXXXXXXXXWAKKYDRLVIQESIREGWEYSVGFITESILTEHIPNASDTLALTCGPPPMIQFAVQP
HMP_RHIME       NSAVHAMRDRLKEASRDFKLFIFYDELPTDIEGRDYDFAGLVDVEKVKDLDDADYYICGPVPFMRMQHDK
NQRF_SHEHA      SKREMFYVEDFENENFDWHVALSDPQPEDNWEGKTGFIHNVLYESYLRD---------------------
NIA7_HORVU      TEDDMLLREEIDRWAKVWYVVSKVGRPEDAWEYGVGRVDEQVEHLPLGGDGETLALVCGPPAMLECTVRP
NB5R3_RAT       SEKDIXXXXXXXXXSSRFKLWYTVDKAPDAWDYSQG----FVNEEMIRDHEETLILMCGPPPMIQFACLP
FHBB_DICDI      SSQP--FKEELKQLEDDYNLKINLVYSENQGHINKEIIEKYVDQAEIAETD---VYICGPVPFMMQVNKD
NQRF_CHLTA      SLKENIYQEEYEKLEKHYHLVLSQEDLDQGWDKNDPIKTNFL----------------------------
NB5R3_MOUSE     SEKDIXXXXXXXXXSARFKLWYTVDKAPDAWDYSQG----FVNEEMIRDHEEPLILMCGPPPMIQFACLP
NQRF_VIBMA      SKREMFYVEDFKENENEWHVALSDPQPEDNWEGYTGFIHNVILE--------------------------
NQRF_PHOPO      SKREMFYEEDFDALAENPNFVLSDPQPEDNWDGYTGFIHNVLYENYLRD---------------------
NQRF_COLMA      SKREMFYEDDYNGLAADWHVALSDPQPEDNWDGLTGFIHNVLFEEYLKD---------------------
NQRF_CHLTR      SLKENIYQEEYEKLEKHYHLVLSQEDLDQGWDKNDPIKTNFL----------------------------
NQRF_CHLCV      SLKENIYQEEYEKLEKDFS---------------------------------------------------
NIA_NEUCR       VEGDILMKDELVERAKPMRVKYTLSRPGAEWEGLRGRLDKTMLEREVGEGDETMVLLCGPEGMQNM-VRE
NIA_BETVE       TXXXXXXXXXXXXWAKKHEKLVVKESKREGWEYSVGYIRESILREHIPESDDVLALACGAPSMIEEAV--
NIA3_MAIZE      TEDDILLRAELDRWAKVWYVVSQVKRLDE-WKYSVGIVTEAVLRDDVPERDGTLALLCGPPSMIQSPILP
NIA2_SOYBN      TXXXXXXXXXXXXWAKKYDRLVIQASIREGWEYSVGFITESILTEHIPNASDTLALTCGPPPMIQFAVQP
NB5R3_PIG       TEKDIXXXXXXXXXSARFKLWYTVDRAPEAWDYSQGFVNEMIRDHLXXXXXXXLVLMCGPPPMIQYACLP
MCR1B_VANPO     TSDDILLKKELDEFQQKFSDRVTKDIASTG--AKKGFIAKEIESLAPASNENTHVFVCGPEPFVK-----
TAH18_CANAL     KEKDNLIE---SFWHGNENQNLHLVSA---YSRDSNSKYRYVQDAKLLIEQNAKVFVCGSPREVKITFVE
NCB5R_ASPOR     NPEDIXXXXXXXXXDDGFRVYYVLNNPPEGWTGGVGFVTDMIKERLPAPAQDIKIMLCGPPPMI------
NB5R3_CANFA     TEKDIXXXXXXXXXSARFKLWYTVDKAPEAWDYSQGFVNEEMIRDHLXXXXXXXLILMGPPPMIQYACLP
NB5R3_BOVIN     TEKDIXXXXXXXXXSARFKLWYTVDKAPEAWDYSQGFVNEMIRDHLXXXXXXXLVLMCGPPPMIQYACLP
MMOC_METCA      TEPELFYIDELKSLERSMRNLTVVWHPSGDWEGEQGSPIDALRELESSDA-NPDIYLCGPPGMIDAACEL
FENR_SYNY3      KSENILYKDDLEEFPDNFRLTYAISREQQNAEGGRMYIQHRVAE--------------------------
NQRF_SHEPU      STREVFYQADFDALAENDNFVLSEPLPEDNWTGYTGFIHNVIYENYLKN---------------------
NQRF_CHLFF      SLKENIYQEEYEKLEKDFHLVLSEPLAEDGWDKNDPEKTNFLFRAKLSNPEDYLYYVCGPPL--------
NIA1_PHAVU      TXXXXXXXXXXXXWAKKHDRLVLQANIREGWEYSVGFITESIEHVPLASPDTL-ALTCGPPPMIQFAVQP
PYRK_BACSK      SQADVFYEQPFKQLGN-----VHIATADGSY-GAPGFVTDVISQ---QSLDFDVLYSCGPTPMLKALTAR
NIA_PHYIN       SQRDLLLRKELETLQK------------------------------------------------------
NB5R3_MACFA     TEKDIXXXXXXXXXSARFKLWYTLDRAPEAWDYSQGFVNEMIRDHLXXXXXXXLVLMCGPPPMIQYACLP
NIA1_ORYSJ      TXXXXXXXXXXXXWAKVWYVIDQVKRPEEGWKYGVGFVTEEVLREHVPEGDDTLALACGPPPMIKFAVSP
NCB5R_ASPTN     NEEDILLRDELEKLAKGFRIFYVLXXXXXXXXXXFGFVTEMIKEHLPAPAKDVKILLCGPPPMV------
FRE_VIBHA       DNCQLYAKEELVEIAANVHFVPVVEEAPADWQGKVGNVLQAVSE-DFESLENYDIYIAG-----------
TAH18_ASHGO     KDKDFLYADTLQKWENRIKLFVCFSRSPDDSPGNAREVARLITE------ENAVVYVCGSPVQVRLTLCE
HMP_BACSU       ----------------------------------------------------------------------
NB5R4_XENTR     KEEDILWKEQVEELSLEAQLILSEPSVKTGYRGQISYSLLNESILRTEEGSKILICICGPNAFVDQGISF
NB5R4_HUMAN     TEDDIIWRSQLEKLDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLKDKSKVLVCICGP----------
NB5R4_BOVIN     TEDDIIWRSQLEKLDKRFEVEFVLSAPTSEWSGKQGYISPALLSEFLKDTSKVLICLCGP----------
HMP_OCEIH       ----------------------------------------------------------------------
FRE_PHOLU       GGRESQHLYDLAELRPNLKVIPVVEQSDNGWCGRTGTVLKAVLE-DFGSLANYDIYIAGRFEMAK-----
FRE_ECOLI       EEQDLCELEALSLKHPGLQVVPVVEQPEAGWRGRTGTV--------------------------------
FRE_ECOL6       EEQDLCELEALSLKHPGLQVVPVVEQPEAGWRGRTGTV--------------------------------
FRE_ECO57       EEQDLCELEALSLKHPGLQVVPVVEQPEAGWRGRTGTV--------------------------------
FENR_AZOVI      QVNELAYQQFITE---------------------------------------------------------
BENC_ACIAD      QDCDLVALEQLDALQQKLPWFRTVVAHAESQHERKGYVTGHI-EYDWLNGGEVDVYLCGPVPMVEAVRSW
RBOHD_SOLTU     ----------------------------------------------------------------------
NQRF_CHLMU      SLKENIYQEEYEKLEK------------------------------------------------------
NB5R4_MOUSE     TEDDIIWRCQLEKLEKRFDVEFVLSAPSPEWNGKQGHISR------------------------------
HMP_VIBVY       NGQQHAFKQHVKETHPHFNSLVSDDKIGDDFQFS-GWVNLHEIETVLKQAD-VQVYFCGPVGFMQFIAKQ
HMP_VIBVU       NGQQHAFKQHVKETHPHFNSLVSDDKIGDDFQFS-GWVNLHEIETVLKQAD-VQVYFCGPVGFMQFIAKQ
FENR_SYNP2      YTANILYKDDFEENPDNFRLTYAISREQKTADGGQSRVSEYADELEMIQKPNTHVYMCGPPIDETFTAWE
C505_FUSOX      NPEDDLYAEEFERWEK------------------------------------------------------
NIA1_HORVU      SXXXXXXXXXXXXWAKVWYVIDQVKRPEDGWKFSVGFVTEDILRAHVPEGDDTLALACGPPPMIKFAISP
NCB5R_EMENI     NPXXXXXXXXXXXXXXGFRIYYVLNNPPEGWTGGVGFVTDMIKERLPAPASDIKILLCGPPPMV------
FRE_VIBFI       DECQLYAKAELESIAQAHSHITFVPVVEEGWTGKTGNVLEAV-KADFNSLADMDIYIAG-----------
DUOX2_PIG       ----------------------------------------------------------------------
DUOX2_HUMAN     ----------------------------------------------------------------------
DUOX1_CANFA     ----------------------------------------------------------------------
CARY_BACST      ------------------NMERAFQKAVQSLEGNNGLL---LPELSVKTNDELKQLLVDKDDRRFFAILE
Y325_THEMA      GEAAFIFGDVAKDAEQIVKKTVETFGRLDILVNNAGIVPGNIEETSEEDFDKTMAVVKGPFLLSKYAVEQ
NCB5R_NEOFI     NPXXXXXXXXXXXXXPDFNIYYVLNNPPQGWTGGVGFVTEMIKEHLPAPASDVKILLCGPPPMI------
DUOX1_HUMAN     ----------------------------------------------------------------------
CYPE_BACSU      RPHDDLYREELDQAEQD-----------------------------------------------------
PYRK_AQUAE      ----------------------------DGSAGRKGFVTEILKEFSTDWV----VHACGPKPMLK--TIK
NCB5R_ASPCL     NPXXXXXXXXXXXXXXXFNIYYVLNNPPQGWTGGVGFVTEMIKERLPAPASDVKVLLCGPPPMI------
FENR_THEEB      GTANILYKDELEQYPDHFRLTYAISREQKTPDGGQGRIAEHADEIQLLQKKNTHVYMCGPGIDEAMTAAE
FENR_CYAPA      TSSTLLYREELEKMQK------------------------------------------------------
DUOX2_RAT       ----------------------------------------------------------------------
NB5R4_RAT       TEDDIIWRCQLEKLDKRFHVEYVLSAPSPEWNGKQGHVSRLLSEFLQRSLENSKVFICGP----------


                         .         .         .         +         .         .         .:280
query           FLKRGIKEENIWISQERKMCCGLGKCGHCKIDDTYICLDGPVFNYTKGKLLID
ASRB_SALTY      LLQKGLKPEQIWVDYERRMACSVGKCGHCRMGEVYVCTDGPIFNYAVAQRFAD
PYRK_PYRKO      ---KVMNYKNVQISAERYMKCGIGVCGSCNLGKYLVCRDGPVFEGEK------
PYRK_PYRHO      IM----NYERTQISAERYMKCGIGICGSCALGPYLVCRDGPVF----------
PYRK_CLOPE      MCKEA--KVNVYISMEKHMACGVGACLVCKSGNKRTCKDGPVFN---------
PYRK_THEVO      VLKG--RKVFVQFSLERTMKCGIGICDSCSLGGKQVCKEGPVFN---------
PYRK_METMA      FLEEREVLEKSEFSLHRYFKCGIGVCGACCIDRSRVCKDGPVFSGTQ------
PYRK_PYRAB      IMNY----ERTQISAERYMKCGIGICGSCALGPYLVCRDGPVF----------
PYRK_METBF      LLKDRQVLEKSEFSLQRYFKCGIGVCGACCIDKSRVCRDGPVFS---------
PYRK_PYRFU      IMEF----ENVEVSAERYMKCGIGVCGSCALGPYLVCRDGPVFS---GKQLIN
PYRK_ARCFU      FLKERDALDKAEFSLERYMRCGIGVCGSCVIENLRVCADGPVFN---------
PYRK_UNCMA      LDEAGVAGLS-QFSLQRYIKCGIGVCGSCCMDGLRVCRDGPVFD---------
PYRK_METAC      LLEERKVLEKAEFSLHRYFKCGIGVCGACCIDGLRVCKDGPVFS---------
PYRK_METJA      ANEYNIP---VQVSMERYMKCGIGICGQCCVDDEGLCVDGPVF----------
PYRK_THEAC      LASMNARAE---FSLERTMKCGIGICDSCSVGGLQVCRQGPVFD---------
PYRK_METTH      ILDE--RDVPAQLSLERYMKCAVGICGQCCLDDTRVCAEGPVF----------
PYRK_CLOAB      MCEQ--KNVPVYISMEKKMACGIGACLVCKGGRRRACKEGPVF----------
PYRK_METBU      ALQEKDALDRSEFSMHRYFKCAIGVCGACCMDGLRVCKDGPVLN---GSLLID
PYRK_STRMU      FEKH----PHAYLSTEERMACGMGACYACVVQNLRVCEDGPIFE--TGQIILD
MCR1_KLULA      -----------------------------------------------------
PYRK_LISIN      AVKASFPETKTYLSLEERMACGIGACYACKAGDTKVCEDGPVF----------
PYRK_LISMH      AVKASFPETKTYLSLEERMACGIGACYACKADDTKVCEDGPVF----------
PYRK_LISMO      AVKASFPETKTYLSLEERMACGIGACYACKADDTKVCEDGPVFRADEVKL---
PYRK_BACLD      -LKQRYPDKEVYLSMEERMGCGIGACFACESETSYVCLDGPVF----------
PYRK_LISMF      AVKASFPETKTYLSLEERMACGIGACYACKADDAKVCEDGPVF----------
PYRK_BACSU      -LKQEYAHKEVYLSMEERMGCGIGACFACESETSYVCLDGPVF----------
PYRK_BACA2      -LKQQYGHKEVYLSMEERMGCGIGACFACESDTSYVCLDGPVF----------
YADH_CLOBE      TKELGIPTT---VSLNPIMVDGTGMCGACRVEVKFACVDGPEFD---------
PYRK_LISMC      AVKASFPETKTYLSLEERMACGIGACYACKADDAKVCEDGPVF----------
PYRK_BACP2      -LKDSYPDKPVYISMEERMGCGIGACFACQHEKAYVCLDGPVF----------
PYRK_LACLM      --KKYDQLERLYISMESRMACGIGACYACKEDESHVCEDGPVF----------
PYRK_LACLA      --KKYEQLERLYISMESRMACGIGACYACKEDENHVCEDGPVF----------
NCB5R_YEAST     -----------------------------------------------------
PYRK_THEMA      AREFGVP---IWVSLNPIMVDGTGMCGACRVTVSFACVDGPEF----------
MCR1_MAGGR      -----------------------------------------------------
PYRK_BACCQ      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_FUSNN      ----NAVGEDGYISLENRMACGIGACYACVCXXTRVCYDGPVY----------
PYRK_LISW6      AVKASFPETKTYLSLEERMACGIGACYACKADDRKVCEDGPVF----------
PYRK_LACLS      --KKYDQLERLYISMESRMACGIGACYACKEDESHVCEDGPVF----------
MCR1_EMENI      -----------------------------------------------------
PYRK_METKA      IARE--HDVPCQVSVVRYVKCGEGICGSCALKGLLVCRDGPVF----------
MCR1_CANAL      -----------------------------------------------------
NCB5R_LACBS     -----------------------------------------------------
MCR1_LODEL      -----------------------------------------------------
NCB5R_YEAS7     -----------------------------------------------------
NCB5R_PICST     -----------------------------------------------------
NCB5R_LODEL     -----------------------------------------------------
MCR1_USTMA      -----------------------------------------------------
NCB5R_ARATH     -----------------------------------------------------
MCR1_AJECN      -----------------------------------------------------
MCR1_PHANO      -----------------------------------------------------
MCR1_DEBHA      -----------------------------------------------------
NB5R2_DANRE     LLKLGYKKENIF-----------------------------------------
MCR1_NEUCR      -----------------------------------------------------
MCR1_YARLI      -----------------------------------------------------
MCR1_COCIM      -----------------------------------------------------
NIA2_ARATH      KMQYNIKED--------------------------------------------
MCR1_PICST      -----------------------------------------------------
PYRK_THETN      SMKANVLCQ---ISLEEKMXXXXXXXXXXKVREKRVCRDGPVF----------
PYRK_GEOSW      ALEQMFPDKEVYLSLEERMGCGIGACFACNSETAYVCCDGPVF----------
NIA_SPIOL       KMGFDIKEQ--------------------------------------------
MCR1_CHAGB      -----------------------------------------------------
MCR1_BOTFB      -----------------------------------------------------
MCR1_ASPCL      -----------------------------------------------------
MCR1_ASHGO      -----------------------------------------------------
PYRK_ENTFA      F----PTHPHVYLSLEERMACGIGACYACKKGDTKVCDEGPIF----------
MCR1_ASPNC      -----------------------------------------------------
NIA_SOLLC       KMGYDIKEE--------------------------------------------
MCR1_SCLS1      -----------------------------------------------------
NCB5R_KLULA     -----------------------------------------------------
NCB5R_ASHGO     -----------------------------------------------------
NQRF_IDILO      LKDLGVEDENIML----------------------------------------
NIA_CUCMA       NLEK-------------------------------------------------
NCB5R_YARLI     -----------------------------------------------------
NCB5R_VANPO     -----------------------------------------------------
NQRF_METCA      LLDIGVDRENIML----------------------------------------
MCR1_NEOFI      -----------------------------------------------------
NIA_PETHY       -----------------------------------------------------
NIA1_ARATH      KMGYNVKED--------------------------------------------
NCB5R_PICGU     -----------------------------------------------------
PYRK_STRR6      F----DDHPRAYLSLESRMACGMGACYACKVPESRVCEDGPVF----------
NQRF_PSEA6      LKDLGVEDENIML----------------------------------------
NIA2_TOBAC      -----------------------------------------------------
NIA2_PHAVU      NLEK-------------------------------------------------
PYRK_BACHD      FIG-----ERAFISMEERMGCGIGACFACVCHVTKICTDGPVF----------
NCB5R_CANGA     -----------------------------------------------------
PYRK_STRPN      F----DDHPRAYLSLESRMACGMGACYACVLKSQRVCEDGPVF----------
PYRK_LYSSC      ALEGFYPEKEGYLSFEERMGCGIGACFACVCDYVKVCSDGPVF----------
NIA_LOTJA       -----------------------------------------------------
NCB5R_DICDI     LETIGFNESNIF-----------------------------------------
NQRF_SERP5      LKDLGVEDENIML----------------------------------------
NQRF_MARMS      LEDLGVEKENI------------------------------------------
NIA1_TOBAC      -----------------------------------------------------
PYRK_STRTD      FENH----PHAYVSMEARMACGMGACYACVVKNLRVCEEGPVF--PTGKVIV-
NQRF_YERPS      LKDLGVEDENIML----------------------------------------
NQRF_YERPP      LKDLGVEDENIML----------------------------------------
NQRF_YERPN      LKDLGVEDENIML----------------------------------------
NQRF_YERPE      LKDLGVEDENIML----------------------------------------
NQRF_YERPA      LKDLGVEDENIML----------------------------------------
NQRF_YERP3      LKDLGVEDENIML----------------------------------------
NQRF_VIBAN      LKNLGVEDENI------------------------------------------
NCB5R_CANAL     -----------------------------------------------------
YMM5_YEAST      -----------------------------------------------------
PYRK_BACWK      ALEGRYKERKAYISLEERMGCGIGACCHLQADPSKVCSDGPVF----------
NIA1_BRANA      KMGYDIKED--------------------------------------------
XYLA_PSEPU      LVRLGVARELVF-----------------------------------------
NCB5R_COCIM     TESLGYKKANLVSKLEDQVFC--------------------------------
DMPP_ACICA      LMQSRLFERD--IHTERFLSAADGAAGQSR-----------------------
PYRK_BACCN      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
NQRF_VIBVY      LKNLGVEDENI------------------------------------------
NQRF_VIBVU      LKNLGVEDENI------------------------------------------
NQRF_PSYCK      LHSMGVEDENIML----------------------------------------
NIA_PICAN       -----------------------------------------------------
NIA_EMENI       LLSLGWKEENL------------------------------------------
NCB5R_MORAP     -----------------------------------------------------
NCB5R_DEBHA     -----------------------------------------------------
PYRK_BACC2      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
NQRF_VIBAL      LKDLGVEDENI------------------------------------------
NIA_FUSOX       FLGMGFKSDD-------------------------------------------
MCR1_PICGU      -----------------------------------------------------
PYRK_BACHK      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACCZ      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACCR      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACC7      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACC1      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACC0      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACAN      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACAC      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACAA      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
NIA2_BRANA      KMGYNVKED--------------------------------------------
MMOC_METTR      -----------------------------------------------------
NQRF_YERE8      LKDLGVEDENIML----------------------------------------
NQRF_SHEDO      LKDLGVEDENI------------------------------------------
NCB5R_SCHPO     -----------------------------------------------------
ASCD_YERPS      FINHGLAENKFF-----------------------------------------
ASCD_YERPE      FINHGLAENKFF-----------------------------------------
PYRK_BACC3      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
PYRK_BACAH      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
NQRF_VIBCH      LKNLGVEEENI------------------------------------------
NQRF_VIBC3      LKNLGVEEENI------------------------------------------
NQRF_HAES1      LKDLGVEDENI------------------------------------------
NDOR_PSEPU      TKHLGISPEHIY-----------------------------------------
NB5R2_XENTR     NLTK-------------------------------------------------
MCR1_ASPOR      -----------------------------------------------------
PYRK_BACC4      ALEGRYKEKKAYISLEERMGCGIGACFACPSGHSYVCSDGPVF----------
NQRF_VIBPA      LKDLGVEDENI------------------------------------------
NQRF_ACTP2      LKSLGVEDENI------------------------------------------
NCB5R_AJECN     TESLGFKKAGLVSKLEDQVFC--------------------------------
YMI7_YEAST      YAK--------------------------------------------------
NQRF_PASMU      LKDLGVEDENI------------------------------------------
NQRF_NEIMF      LKDLGVEDENI------------------------------------------
NQRF_NEIMB      LKDLGVEDENI------------------------------------------
NQRF_NEIMA      LKDLGVEDENI------------------------------------------
NQRF_NEIM0      LKDLGVEDENI------------------------------------------
NQRF_HAEI8      LKDLGVEDENI------------------------------------------
NQRF_VIBHB      LKDLGVEDENI------------------------------------------
NQRF_NEIG1      LKDLGVEDENI------------------------------------------
NQRF_HAEIN      LKDLGVEDENI------------------------------------------
NQRF_HAEIE      LKDLGVEDENI------------------------------------------
NB5R2_XENLA     NLTK-------------------------------------------------
NQRF_KLEP7      LKDLGVEDENI------------------------------------------
NQRF_HAEIG      LKDLGVEDENI------------------------------------------
NQRF_HAEDU      LKSLGVEDENI------------------------------------------
NCB5R_ASPNC     -----------------------------------------------------
NQRF_PSYA2      LHSLGVEDENIML----------------------------------------
NQRF_PSEAE      LTDLGVERENI------------------------------------------
NQRF_PSEAB      LTDLGVERENI------------------------------------------
NB5R2_HUMAN     -----------------------------------------------------
NB5R2_CHICK     -----------------------------------------------------
NQRF_PSEA7      LTDLGVERENI------------------------------------------
NIA_ASPNG       LLEQGWAESDL------------------------------------------
NCB5R_CRYNE     -----------------------------------------------------
NCB5R_ASPFU     -----------------------------------------------------
FHBA_DICDI      LIELGYPKENI------------------------------------------
MCR1_YEAS7      -----------------------------------------------------
NB5R2_RAT       -----------------------------------------------------
NB5R1_MOUSE     -----------------------------------------------------
RFBI_SALTY      FMMKNLSVEHFY-----------------------------------------
NCB5R_NEUCR     -----------------------------------------------------
HMP_VIBPA       LQELGVPQE--------------------------------------------
TMOF_PSEME      -----------------------------------------------------
NQRF_ACTSZ      LEDLGVEHENI------------------------------------------
NIA_LOTTE       -----------------------------------------------------
MCR1_ASPTN      -----------------------------------------------------
BOXA_AZOEV      -----------------------------------------------------
NQRF_MANSM      LESLGVEHENI------------------------------------------
NIA_CICIN       -----------------------------------------------------
NB5R5_MOUSE     -----------------------------------------------------
MCR1_ASPFU      -----------------------------------------------------
CYPD_BACSU      -----------------------------------------------------
NQRF_ALTMA      -----------------------------------------------------
NB5R1_HUMAN     -----------------------------------------------------
MCR1_YEAST      -----------------------------------------------------
NB5R1_RAT       -----------------------------------------------------
DMPP_PSEUF      LMQGRLFERDIFMERFYTAADGAGE----------------------------
NQRF_COLPS      -----------------------------------------------------
NB5R1_BOVIN     -----------------------------------------------------
MCR1A_VANPO     -----------------------------------------------------
CBDC_BURCE      -----------------------------------------------------
NQRF_PSEHA      -----------------------------------------------------
NCB5R_USTMA     -----------------------------------------------------
NB5R2_MOUSE     -----------------------------------------------------
NB5R3_HUMAN     -----------------------------------------------------
FRE_SALTY       -----------------------------------------------------
NIA_LEPMC       -----------------------------------------------------
NIA1_SOYBN      NLEK-------------------------------------------------
HMP_RHIME       LLGLGITEARI------------------------------------------
NQRF_SHEHA      -----------------------------------------------------
NIA7_HORVU      GLEK-------------------------------------------------
NB5R3_RAT       NLER-------------------------------------------------
FHBB_DICDI      LLQLGFHKENV------------------------------------------
NQRF_CHLTA      -----------------------------------------------------
NB5R3_MOUSE     NLER-------------------------------------------------
NQRF_VIBMA      -----------------------------------------------------
NQRF_PHOPO      -----------------------------------------------------
NQRF_COLMA      -----------------------------------------------------
NQRF_CHLTR      -----------------------------------------------------
NQRF_CHLCV      -----------------------------------------------------
NIA_NEUCR       VLKMGWKDEDVLV----------------------------------------
NIA_BETVE       -----------------------------------------------------
NIA3_MAIZE      NLEK-------------------------------------------------
NIA2_SOYBN      NLEK-------------------------------------------------
NB5R3_PIG       NLER-------------------------------------------------
MCR1B_VANPO     -----------------------------------------------------
TAH18_CANAL     IVKK-------------------------------------------------
NCB5R_ASPOR     -----------------------------------------------------
NB5R3_CANFA     NLDR-------------------------------------------------
NB5R3_BOVIN     NLDR-------------------------------------------------
MMOC_METCA      VRSRGIPGEQVFFEK--------------------------------------
FENR_SYNY3      -----------------------------------------------------
NQRF_SHEPU      -----------------------------------------------------
NQRF_CHLFF      -----------------------------------------------------
NIA1_PHAVU      NLEK-------------------------------------------------
PYRK_BACSK      Y-----RERRAFISLEERMXXXXXXXXHVENGQAHICTDGPVF----------
NIA_PHYIN       -----------------------------------------------------
NB5R3_MACFA     NLDR-------------------------------------------------
NIA1_ORYSJ      NLEK-------------------------------------------------
NCB5R_ASPTN     -----------------------------------------------------
FRE_VIBHA       -----------------------------------------------------
TAH18_ASHGO     VLKK-------------------------------------------------
HMP_BACSU       -----------------------------------------------------
NB5R4_XENTR     LQDLGFSKEEVFAFRE-------------------------------------
NB5R4_HUMAN     -----------------------------------------------------
NB5R4_BOVIN     -----------------------------------------------------
HMP_OCEIH       -----------------------------------------------------
FRE_PHOLU       -----------------------------------------------------
FRE_ECOLI       -----------------------------------------------------
FRE_ECOL6       -----------------------------------------------------
FRE_ECO57       -----------------------------------------------------
FENR_AZOVI      -----------------------------------------------------
BENC_ACIAD      LDTQGIQPAN-------------------------------------------
RBOHD_SOLTU     -----------------------------------------------------
NQRF_CHLMU      -----------------------------------------------------
NB5R4_MOUSE     -----------------------------------------------------
HMP_VIBVY       LLEMGVPEQ--------------------------------------------
HMP_VIBVU       LLEMGVPEQ--------------------------------------------
FENR_SYNP2      EMRRSMKKEHRW-----------------------------------------
C505_FUSOX      -----------------------------------------------------
NIA1_HORVU      NLEK-------------------------------------------------
NCB5R_EMENI     -----------------------------------------------------
FRE_VIBFI       -----------------------------------------------------
DUOX2_PIG       -----------------------------------------------------
DUOX2_HUMAN     -----------------------------------------------------
DUOX1_CANFA     -----------------------------------------------------
CARY_BACST      LLRRGVAVEAIWTKIDRFFLC--------------------------------
Y325_THEMA      MKKQG------------------------------------------------
NCB5R_NEOFI     -----------------------------------------------------
DUOX1_HUMAN     -----------------------------------------------------
CYPE_BACSU      -----------------------------------------------------
PYRK_AQUAE      EMKTGHK---VYFSLEERMACGWGVCLGCVVDGKFVCYEGPV-----------
NCB5R_ASPCL     -----------------------------------------------------
FENR_THEEB      FLKGTLKKEGRW-----------------------------------------
FENR_CYAPA      -----------------------------------------------------
DUOX2_RAT       -----------------------------------------------------
NB5R4_RAT       -----------------------------------------------------