[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81146.1

[Show Plain Result]


## Summary of Sequence Search
    1::338
    1::341     1e-77  42%  347 aa  ASRA_SALTY RecName: Full=Anaerobic sulfite reductase subunit
  809::951     4e-04  31% 1196 aa  BXCN_CLOBO RecName: Full=Botulinum neurotoxin type C1 nontoxic
   65::87      6e-04  61%  181 aa  HYFH_ECOLI RecName: Full=Hydrogenase-4 component H;
  154::250     6e-04  32%  691 aa  EFG_SYNR3 RecName: Full=Elongation factor G;         Short=EF-G;
   29::74      0.001  33%  264 aa  Y437_STAAM RecName: Full=Uncharacterized lipoprotein SAV0437;Flags:
   29::74      0.001  33%  266 aa  Y411_STAA3 RecName: Full=Uncharacterized lipoprotein
   29::74      0.001  33%  264 aa  Y397_STAAN RecName: Full=Uncharacterized lipoprotein SA0397;Flags:
    1::338

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGLRLTKDNFDKIIDCLKKEYKIYAPKVMEGKGRFSDTDMTRYGEIDSINDIEFSKKSDFSYKEVLLPIT
ASRA_SALTY      MAIKITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNIIYQRISGWRDLIWHEKSHMSPNTIIAPIT
BXCN_CLOBO      -----------------------------------------KFLDIQSIKNF-FNSQVEQVMKEILSPY-
HYFH_ECOLI      ----------------------------------------------------------------------
EFG_SYNR3       ----------------------------------------------------------------------
Y437_STAAM      ----------------------------------------------------------------------
Y411_STAA3      ----------------------------------------------------------------------
Y397_STAAN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QTLFFFTEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYYKKLREKAKFIVMGCENSFDN
ASRA_SALTY      ETLFYFDKDTIQIAETDTSPIIIFARACDINAMSRLDYMYLSNGNNSDYYQLLREHIRFVLIECEESFEN
BXCN_CLOBO      QLLLFASKGPNSNIDISGKNTLI-------QYTESIELVYGVNG-ESLYLKSPNETIKFFTNGLTNNFTI
HYFH_ECOLI      ----------------------------------------------------------------------
EFG_SYNR3       ---------------------------------------------------RLKAKAAPIQLPIGAEGDL
Y437_STAAM      ------TAEKAKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKK------------------
Y411_STAA3      ------TGEKAKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDSEFKK------------------
Y397_STAAN      ------TAEKAKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKK------------------


                         +         .         .         .         .         *         .:210
query           CFCVSMGTNKTDEYSAYIGLDNDEVLLDIKDEELSKIFEAVESNKEEVSPKFVEENETKVEVPEGIDLNI
ASRA_SALTY      CFCVSMGTNKTDCYSAAMRFSDEGALVSIRDPFIEAAIQGL-GQEADYTPSFVSENRETVVTPDSVDPQK
BXCN_CLOBO      CFWLRF-TGKNDDKTRLIGNKVNNCGWEIYFEDNGLVFEIIDSNGNQES---------------------
HYFH_ECOLI      ----------------------------------------------------------------------
EFG_SYNR3       SGIIDLVANKAYIYKNDLGTDIEEAEIDMADEAAAKLMESVAENDEELIEKFLETGETEAELKKGIRDGV
Y437_STAAM      ----------------------------------------------------------------------
Y411_STAA3      ----------------------------------------------------------------------
Y397_STAAN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IKSTVWNEYSERCIACGRCNFVCPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDK
ASRA_SALTY      IRDPLWDAYDSRCISXXXXXXXXXXXXXYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGGHGFREKP
BXCN_CLOBO      ----------------------------------------------------------------------
HYFH_ECOLI      --SRTWQLYLGRCIYCGRCEEVCPT---------------------------------------------
EFG_SYNR3       LK--------------------------------------------------------------------
Y437_STAAM      ----------------------------------------------------------------------
Y411_STAA3      ----------------------------------------------------------------------
Y397_STAAN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICPEYISFSECVNKLKDAVEExxxxx
ASRA_SALTY      GERLRYRALHKVNDYKARNGIHMCVGCGRCDDRCPQYIKFSLIINKMTAAVRQ-----
BXCN_CLOBO      ----------------------------------------------------------
HYFH_ECOLI      ----------------------------------------------------------
EFG_SYNR3       ----------------------------------------------------------
Y437_STAAM      ----------------------------------------------------------
Y411_STAA3      ----------------------------------------------------------
Y397_STAAN      ----------------------------------------------------------