[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81193.1

[Show Plain Result]


## Summary of Sequence Search
    1::334
   59::281     9e-12  26%  334 aa  YTLA_BACSU RecName: Full=Putative binding protein ytlA;Flags:
  190::304     1e-06  31%  440 aa  NRTA_ANASP RecName: Full=Nitrate transport protein nrtA;Flags:
  367::420     1e-04  41%  617 aa  SYP_STRA5 RecName: Full=Prolyl-tRNA synthetase;       
  367::420     1e-04  41%  617 aa  SYP_STRA3 RecName: Full=Prolyl-tRNA synthetase;       
  367::420     4e-04  39%  617 aa  SYP_STRA1 RecName: Full=Prolyl-tRNA synthetase;       
  192::322     0.001  27%  443 aa  NRTA_SYNE7 RecName: Full=Nitrate transport protein nrtA;Flags:
    1::334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKGLDI
YTLA_BACSU      -----------------------------------------------------------------EGLDV
NRTA_ANASP      ----------------------------------------------------------------------
SYP_STRA5       ----------------------------------------------------------------------
SYP_STRA3       ----------------------------------------------------------------------
SYP_STRA1       ----------------------------------------------------------------------
NRTA_SYNE7      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGSLYVISSDDSVNSLEDLKGKD
YTLA_BACSU      DVNTTWGGDKTMTSLLSNGSDIALVGSETSIYVEAQGAKDPVINTQTDGTFLVAREDVEHFDWDQLKGKT
NRTA_ANASP      ----------------------------------------------------------------------
SYP_STRA5       ----------------------------------------------GFGSLGPVNLPDSVKIIADRKVQD
SYP_STRA3       ----------------------------------------------GFGSLGPVNLPDSVKIIADRKVQD
SYP_STRA1       ----------------------------------------------GFGSLGPVNLPESVKIIADRKVQD
NRTA_SYNE7      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASELAPLFIEGKAKYAVVPEPMLTQIMTKKPETK
YTLA_BACSU      FLGQRKGGMPQMVGEYVLNKHKIDPHKDIDLIQXXXXXXXXXXXXSGTGEYVQLFEPQ-ASLFEKKGIGH
NRTA_ANASP      ------GGTHDLWMRYWLAAGGINPDQDVVLEAVPPPQMVANMKVNTVDGFCV-GEPWNAQLVNQKIGYS
SYP_STRA5       LANAVSGANQD-----GYHFTGVNPERDFTAEYVD-----------------------------------
SYP_STRA3       LANAVSGANQD-----GYHFTGVNPERDFTAEYVD-----------------------------------
SYP_STRA1       LANAVSGANQD-----GYHFTGVNPERDFTAEYVD-----------------------------------
NRTA_SYNE7      ------GGTHDLWMRYWLAANGIDPNNDADLVVIPPPQMVANMQT-GTMDTFCVGEPWNARLVNKKLGYT


                         .         .         .         +         .         .         .:280
query           IVASLNEQWKEMSDSKMGYPQSSVIVKEDLAKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEEVGITG
YTLA_BACSU      IVASFGEESGEV-------PYTTFMAKQSYLKKNEDTAVKFTKAIYKAQQWVENHKDITDAIKDEFDDT-
NRTA_ANASP      ALVT-GELWKD-------HPEKAFSMRQDWIEQNPNAAQAILMAILEAQQWCDENKEE------------
SYP_STRA5       ----------------------------------------------------------------------
SYP_STRA3       ----------------------------------------------------------------------
SYP_STRA1       ----------------------------------------------------------------------
NRTA_SYNE7      -AAVTGELWKF-------HPEKALTIRADWADKNPKATMALLKAVQEAQIWC----EDPANLDELCQITA


                         .         *         .         .         .         .         +:350
query           KKEIIAKSLERxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YTLA_BACSU      DPDVIETSIER-------------------------------------------
NRTA_ANASP      ------------------------------------------------------
SYP_STRA5       ------------------------------------------------------
SYP_STRA3       ------------------------------------------------------
SYP_STRA1       ------------------------------------------------------
NRTA_SYNE7      QDKYFKTSVE--------------------------------------------