[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81206.1

[Show Plain Result]


## Summary of Sequence Search
    1::440
    4::111     4e-04  27% 1700 aa  YR472_MIMIV RecName: Full=Uncharacterized protein R472;
   95::236     0.001  28%  238 aa  YL074_MIMIV RecName: Full=Uncharacterized protein L74;
    1::440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YR472_MIMIV     ----------------------------------------------------------------------
YL074_MIMIV     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YR472_MIMIV     ----------------------------------------------------------------------
YL074_MIMIV     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YR472_MIMIV     ----------------------------------------------------------------------
YL074_MIMIV     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxKLEMEYKYYSNLKDNQEKVKRLYHDIKNHIACIEGNNKETGIRKKYIDS
YR472_MIMIV     ----------------------------------------------------------------------
YL074_MIMIV     ---------------------KIEYTHHFYYNKNDSDMDKKTVPKNTSNTDVIILSSDNIDGIKEKY-NQ


                         .         *         .         .         .         .         +:350
query           LNSEIDKLNLGFNTGNEVLDVILNNKREKCMENNISLKVFIDFSKVNFIEYFDICTIFSNCIDNAIEACK
YR472_MIMIV     ------------NQIDDIIDGILNKLYFEGLSNDESFNSIVNSNKINFVEYREQINKFIDDFVKSIDEIR
YL074_MIMIV     LANEYDSEYFSYISSQHHLEDF-----SECYRNMDKIS-----DRNNAKDKWIFQRIKENCRDKYYQELD


                         .         .         .         .         *         .         .:420
query           KIKDNNRYISLKGNCVNNFYVIKIENSKTNKIKKLNGDFLTDKKxxxxxxxxxxxxxxxxxxxxxxxxxx
YR472_MIMIV     KIKDNNRIIDIIKRYVAYYYFLSIAYNYTGSLKDFRNNMIQYSK--------------------------
YL074_MIMIV     KLLEKERFISLLNNQVGNF-ILKHESSTTNKI--------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxx
YR472_MIMIV     --------------------
YL074_MIMIV     --------------------