[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81210.1

[Show Plain Result]


## Summary of Sequence Search
    1::337
  121::437     3e-37  32%  437 aa  YABE_BACSU RecName: Full=Uncharacterized protein yabE;
  193::287     1e-25  55%  287 aa  YOCH_BACSU RecName: Full=Cell wall-binding protein yocH;Flags:
  173::236     3e-09  51%  238 aa  YORM_BACSU RecName: Full=SPBc2 prophage-derived uncharacterized
  234::317     6e-04  33%  955 aa  UVRA_RICCN RecName: Full=UvrABC system protein A;       
    1::337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFSMRKTLNVVVNGERTEIVTYKGTVQGALHDNGITLAP
YABE_BACSU      --------------------------------YEAAKPVKLTINGEEKTLWSTAKTVGALLXXXXXXXXX
YOCH_BACSU      ----------------------------------------------------------------------
YORM_BACSU      ----------------------------------------------------------------------
UVRA_RICCN      ----------------------------------------------------------------GITYLE


                         .         .         *         .         .         .         .:140
query           KDKVTPSLESKISKNETITINKAVNVKVKTEDGEKEIVSAEDNVEDMLKSEGISFDDDDKILPDKKESLK
YABE_BACSU      XXXXXPAIDTDISKDMKINIEPAFQVTVNDAGKQKKIWTTSTTVADFLKQQKMNIKDEDKIKPALDAKLT
YOCH_BACSU      ----------------------------------------------------------------------
YORM_BACSU      ----------------------------------------------------------------------
UVRA_RICCN      IVELPPAVKSEFEKNQRITFSEQYSCPVQLTEIEPRIFSFNSPFGACPKCEGIGFFDRDLIVPDQRIAIK


                         +         .         .         .         .         *         .:210
query           DGMNXXXXXXXXXXXXXXHPIEFTTEVKKDESKPQTYTEVLNDGQDGEKKVTRELVYENGKEVSNNVIQX
YABE_BACSU      KGKDITITRIEKVTDVVEEKIAFDVKKQEDASXXXXXXXXXXXXXXXXXXXHFEVVKENGKEVSRELVKE
YOCH_BACSU      ----------------------------------------------------------------------
YORM_BACSU      ----------------------------------------------------------------------
UVRA_RICCN      DG--------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXGTKETQTLSRGGESINFKKKLSVKSTAYNHPLGSAEAYTASGMHVLRDPNGYSTIAV
YABE_BACSU      ETAEQSKDKVIAVGTKQSETVSASGDSKTVVKVMTVSSTAYTASCSGCSGHTATGVNLKNNPNA-KVIAV
YOCH_BACSU      -------------------------------KELTVTATAYTANDGGISGVTATGIDLNKNPNA-KVIAV
YORM_BACSU      --------------------------------------------------------------NGKRIIAV
UVRA_RICCN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DPSVIPLGTKLYVEGYGYAIAADTGGAIKGNRVDLFFNTEAEASNWGVRNLDVYILN
YABE_BACSU      DPNVIPLGSKVHVEGYGYAIAADTGSAIKGNKIDVFFPEKSSAYRWGNKTVKIKILN
YOCH_BACSU      DPNVIPLGSKVYVEGYGEATAADTGGAIKGNKIDVFVPSKSDASNWGVKTVSVKVLN
YORM_BACSU      DPEVIPLYSLVQVEGNSFAYAIDTGGDIKNNRIDILMDSEQEANAFGRKNVRV----
UVRA_RICCN      ---------------------------------------------------------