[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81382.1

[Show Plain Result]


## Summary of Sequence Search
    1::796
    1::796       0.0 100%  796 aa  FTSK_CLOPE RecName: Full=DNA translocase ftsK;
   60::765       0.0  58%  765 aa  FTSK_CLOAB RecName: Full=DNA translocase ftsK;
   71::158       0.0  65%  743 aa  FTSK_CLOTE RecName: Full=DNA translocase ftsK;
  273::703     e-159  67%  709 aa  FTSK_THETN RecName: Full=DNA translocase ftsK;
  342::779     e-144  61%  780 aa  FTSK_SPOUR RecName: Full=DNA translocase ftsK;AltName: Full=DNA
  347::785     e-143  62%  787 aa  FTSK_BACSU RecName: Full=DNA translocase ftsK;AltName: Full=DNA
  355::786     e-143  63%  793 aa  FTSK_BACAN RecName: Full=DNA translocase ftsK;
  355::786     e-142  63%  793 aa  FTSK_BACCR RecName: Full=DNA translocase ftsK;
   64::788     e-138  44%  788 aa  FTSK_STAAN RecName: Full=DNA translocase ftsK;
   64::788     e-138  44%  788 aa  FTSK_STAAM RecName: Full=DNA translocase ftsK;
   64::789     e-136  44%  789 aa  FTSK_STAAW RecName: Full=DNA translocase ftsK;
   64::789     e-136  44%  789 aa  FTSK_STAAS RecName: Full=DNA translocase ftsK;
   64::789     e-136  44%  789 aa  FTSK_STAAC RecName: Full=DNA translocase ftsK;
   64::789     e-136  44%  789 aa  FTSK_STAAR RecName: Full=DNA translocase ftsK;
  349::785     e-135  59%  789 aa  FTSK_BACHD RecName: Full=DNA translocase ftsK;
  353::790     e-135  58%  802 aa  FTSK_LACPL RecName: Full=DNA translocase ftsK;
  342::773     e-134  60%  782 aa  FTSK_OCEIH RecName: Full=DNA translocase ftsK;
  325::753     e-132  60%  762 aa  FTSK_LISIN RecName: Full=DNA translocase ftsK;
  320::748     e-132  60%  757 aa  FTSK_LISMO RecName: Full=DNA translocase ftsK;
  518::946     e-130  54%  946 aa  FTSK_CAMJE RecName: Full=DNA translocase ftsK;
  518::946     e-129  54%  946 aa  FTSK_CAMJJ RecName: Full=DNA translocase ftsK;
  331::765     e-127  55%  767 aa  FTSK_STRR6 RecName: Full=DNA translocase ftsK;
  331::765     e-127  55%  767 aa  FTSK_STRPN RecName: Full=DNA translocase ftsK;
  367::799     e-126  53%  799 aa  FTSK_TREPA RecName: Full=DNA translocase ftsK;
  361::794     e-126  57%  797 aa  FTSK_STAES RecName: Full=DNA translocase ftsK;
  361::794     e-126  57%  797 aa  FTSK_STAEQ RecName: Full=DNA translocase ftsK;
  362::798     e-124  55%  801 aa  FTSK_STRP8 RecName: Full=DNA translocase ftsK;
  362::798     e-124  55%  801 aa  FTSK_STRP3 RecName: Full=DNA translocase ftsK;
  362::798     e-124  55%  801 aa  FTSK_STRP1 RecName: Full=DNA translocase ftsK;
  349::786     e-124  55%  787 aa  FTSK_STRMU RecName: Full=DNA translocase ftsK;
  362::798     e-123  55%  801 aa  FTSK_STRP6 RecName: Full=DNA translocase ftsK;
  373::811     e-123  55%  816 aa  FTSK_STRA3 RecName: Full=DNA translocase ftsK;
  359::812     e-123  52%  812 aa  FTSK1_NEIMA RecName: Full=DNA translocase ftsK 1;
  423::882     e-123  54%  891 aa  FTSK_AGRT5 RecName: Full=DNA translocase ftsK;
  373::811     e-122  55%  816 aa  FTSK_STRA5 RecName: Full=DNA translocase ftsK;
  560::1012    e-122  51% 1014 aa  FTSK2_NEIMA RecName: Full=DNA translocase ftsK 2;
  560::1012    e-122  51% 1014 aa  FTSK2_NEIMB RecName: Full=DNA translocase ftsK 2;
  471::923     e-121  55%  930 aa  FTSK_PASMU RecName: Full=DNA translocase ftsK;
  321::779     e-121  54%  784 aa  FTSK_XYLFT RecName: Full=DNA translocase ftsK;
  321::779     e-121  54%  784 aa  FTSK_XYLFA RecName: Full=DNA translocase ftsK;
  315::754     e-121  53%  763 aa  FTSK_LACLA RecName: Full=DNA translocase ftsK;
  534::974     e-121  52%  980 aa  FTSKL_DEIRA RecName: Full=Uncharacterized ftsK-like protein
  413::872     e-120  54%  881 aa  FTSK_RHIME RecName: Full=DNA translocase ftsK;
  371::827     e-119  52%  834 aa  FTSK_PSEPK RecName: Full=DNA translocase ftsK;
  318::779     e-118  54%  785 aa  FTSK_XANAC RecName: Full=DNA translocase ftsK;
  414::884     e-118  53%  887 aa  FTSK_RHILO RecName: Full=DNA translocase ftsK;
  318::779     e-117  54%  785 aa  FTSK_XANCP RecName: Full=DNA translocase ftsK;
  359::812     e-117  50%  812 aa  FTSK1_NEIMB RecName: Full=DNA translocase ftsK 1;
  448::903     e-117  53%  911 aa  FTSK_SHEON RecName: Full=DNA translocase ftsK;
  285::741     e-117  53%  744 aa  FTSK_RICPR RecName: Full=DNA translocase ftsK;
  890::1341    e-117  52% 1347 aa  FTSK_ECOL6 RecName: Full=DNA translocase ftsK;
  495::943     e-117  49%  969 aa  FTSK_BIFLO RecName: Full=DNA translocase ftsK;
  505::955     e-117  52%  957 aa  FTSK_HAEDU RecName: Full=DNA translocase ftsK;
  374::818     e-116  49%  831 aa  FTSK_MYCTU RecName: Full=DNA translocase ftsK;
  499::953     e-116  52%  960 aa  FTSK_VIBCH RecName: Full=DNA translocase ftsK;
  285::741     e-116  51%  744 aa  FTSK_RICCN RecName: Full=DNA translocase ftsK;
  885::1336    e-116  52% 1342 aa  FTSK_SHIFL RecName: Full=DNA translocase ftsK;
  872::1323    e-116  52% 1329 aa  FTSK_ECOLI RecName: Full=DNA translocase ftsK;
  885::1336    e-116  52% 1342 aa  FTSK_ECO57 RecName: Full=DNA translocase ftsK;
  434::877     e-116  49%  921 aa  FTSK_CORGL RecName: Full=DNA translocase ftsK;
  339::794     e-116  51%  801 aa  FTSK_PSEU2 RecName: Full=DNA translocase ftsK;
  281::737     e-116  52%  740 aa  FTSK_RICTY RecName: Full=DNA translocase ftsK;
  339::794     e-116  51%  801 aa  FTSK_PSESM RecName: Full=DNA translocase ftsK;
   72::528     e-116  52%  529 aa  FTSK_HAEIN RecName: Full=DNA translocase ftsK;
  356::822     e-116  52%  825 aa  FTSK_BRAJA RecName: Full=DNA translocase ftsK;
  430::855     e-115  49%  858 aa  FTSK_HELPY RecName: Full=DNA translocase ftsK;
  416::841     e-115  48%  844 aa  FTSK_HELPJ RecName: Full=DNA translocase ftsK;
  357::787     e-115  51%  787 aa  FTSK_BORBU RecName: Full=DNA translocase ftsK;
  286::742     e-115  51%  745 aa  FTSK_RICFE RecName: Full=DNA translocase ftsK;
  377::821     e-115  49%  840 aa  FTSK_MYCLE RecName: Full=DNA translocase ftsK;
  503::953     e-115  50%  959 aa  FTSK1_RALSO RecName: Full=DNA translocase ftsK 1;
  894::1345    e-115  51% 1351 aa  FTSK_SALTY RecName: Full=DNA translocase ftsK;
  886::1337    e-115  51% 1343 aa  FTSK_SALTI RecName: Full=DNA translocase ftsK;
  847::1299    e-114  52% 1305 aa  FTSK_YERPE RecName: Full=DNA translocase ftsK;
  451::895     e-113  48%  905 aa  FTSK_STRAW RecName: Full=DNA translocase ftsK;
  388::847     e-113  51%  854 aa  FTSK_BRUSU RecName: Full=DNA translocase ftsK;
  351::810     e-113  51%  817 aa  FTSK_BRUME RecName: Full=DNA translocase ftsK;
  312::769     e-113  50%  781 aa  FTSK2_RALSO RecName: Full=DNA translocase ftsK 2;
  347::804     e-112  51%  811 aa  FTSK_PSEAE RecName: Full=DNA translocase ftsK;
  317::778     e-112  50%  778 aa  FTSK_COXBU RecName: Full=DNA translocase ftsK;
  520::947     e-109  47%  948 aa  FTSK_LEPIN RecName: Full=DNA translocase ftsK;
  520::947     e-109  47%  948 aa  FTSK_LEPIC RecName: Full=DNA translocase ftsK;
  290::726     e-109  47%  741 aa  FTSK_TROWT RecName: Full=DNA translocase ftsK;
  290::726     e-109  47%  741 aa  FTSK_TROW8 RecName: Full=DNA translocase ftsK;
  357::792     e-109  48%  799 aa  FTSK_CHLTR RecName: Full=DNA translocase ftsK;
  352::794     e-109  47%  794 aa  FTSK_CHLMU RecName: Full=DNA translocase ftsK;
  290::746     e-108  48%  749 aa  FTSK_RICBR RecName: Full=DNA translocase ftsK;
  465::907     e-108  46%  917 aa  FTSK_STRCO RecName: Full=DNA translocase ftsK;
  350::797     e-108  49%  804 aa  FTSK_CHLTE RecName: Full=DNA translocase ftsK;
  524::967     e-108  49%  990 aa  FTSK_VIBVU RecName: Full=DNA translocase ftsK;
  567::1021    e-107  48% 1028 aa  FTSK_VIBPA RecName: Full=DNA translocase ftsK;
  447::890     e-107  46%  946 aa  FTSK_COREF RecName: Full=DNA translocase ftsK;
  355::812     e-104  47%  819 aa  FTSK_CAUCR RecName: Full=DNA translocase ftsK;
  365::800     e-102  45%  806 aa  FTSK_CHLPN RecName: Full=DNA translocase ftsK;
  377::631     2e-50  47%  631 aa  FTSK_AZOBR RecName: Full=DNA translocase ftsK;Flags: Fragment;
  259::595     2e-29  28%  725 aa  FTSKL_ANASP RecName: Full=Uncharacterized ftsK-like protein
  669::882     3e-26  37% 1498 aa  Y3709_CLOAB RecName: Full=Ftsk domain-containing protein CA_C3709;
  650::854     6e-25  33% 1482 aa  ESSC_STAAR RecName: Full=Protein essC;
  650::854     6e-25  33% 1479 aa  ESSC_STAAN RecName: Full=Protein essC;
  650::854     6e-25  33% 1479 aa  ESSC_STAAM RecName: Full=Protein essC;
  650::854     8e-25  33% 1479 aa  ESSC_STAAW RecName: Full=Protein essC;
  650::854     8e-25  33% 1479 aa  ESSC_STAAS RecName: Full=Protein essC;
  650::854     8e-25  33% 1479 aa  ESSC_STAAE RecName: Full=Protein essC;
  650::854     8e-25  33% 1479 aa  ESSC_STAAC RecName: Full=Protein essC;
  676::875     1e-22  34% 1495 aa  YUKB_BACSU RecName: Full=Ftsk domain-containing protein yukB;
  273::475     1e-08  32%  621 aa  TRA_STRLI RecName: Full=Protein tra;
  218::394     2e-06  28%  480 aa  YDCQ_BACSU RecName: Full=Ftsk domain-containing protein ydcQ;
  631::736     2e-05  34%  922 aa  CAPP_METEA RecName: Full=Phosphoenolpyruvate carboxylase;       
  509::624     7e-05  30%  879 aa  RAD50_PYRHO RecName: Full=DNA double-strand break repair rad50
  957::1080    1e-04  31% 1568 aa  MYO2_SACBA RecName: Full=Myosin-2;AltName: Full=Class V
  948::1095    2e-04  24% 1323 aa  HST6_CANAL RecName: Full=Alpha-factor-transporting ATPase;       
    6::94      5e-04  40%  558 aa  Y1934_STRMU RecName: Full=Putative ABC transporter ATP-binding
  450::557     8e-04  31% 1006 aa  XRN2_YEAST RecName: Full=5'-3' exoribonuclease 2;       
  155::281     8e-04  34%  405 aa  FLGE_BUCAI RecName: Full=Flagellar hook protein flgE;
    1::796

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAGGXXXXXXXXXXXXXXXXXXVTEEIYALIAICVSLIVMFSLYTDKAGYLSVISRTLLIGLFGIGAFFI
FTSK_CLOPE      MAGGXXXXXXXXXXXXXXXXXXVTEEIYALIAICVSLIVMFSLYTDKAGYLSVISRTLLIGLFGIGAFFI
FTSK_CLOAB      -------------------------------------------FTSFTGIIGNGMKKLLFTLVGIGAYIF
FTSK_CLOTE      ----------------------------------------------------------------------
FTSK_THETN      ----------------------------------------------------------------------
FTSK_SPOUR      ----------------------------------------------------------------------
FTSK_BACSU      ----------------------------------------------------------------------
FTSK_BACAN      ----------------------------------------------------------------------
FTSK_BACCR      ----------------------------------------------------------------------
FTSK_STAAN      -------------------------------------------------------------LFGYSRYLT
FTSK_STAAM      -------------------------------------------------------------LFGYSRYLT
FTSK_STAAW      -------------------------------------------------------------LFGYSRYLT
FTSK_STAAS      -------------------------------------------------------------LFGYSRYLT
FTSK_STAAC      -------------------------------------------------------------LFGYSRYLT
FTSK_STAAR      -------------------------------------------------------------LFGYSRYLT
FTSK_BACHD      ----------------------------------------------------------------------
FTSK_LACPL      ----------------------------------------------------------------------
FTSK_OCEIH      ----------------------------------------------------------------------
FTSK_LISIN      ----------------------------------------------------------------------
FTSK_LISMO      ----------------------------------------------------------------------
FTSK_CAMJE      ----------------------------------------------------------------------
FTSK_CAMJJ      ----------------------------------------------------------------------
FTSK_STRR6      ----------------------------------------------------------------------
FTSK_STRPN      ----------------------------------------------------------------------
FTSK_TREPA      ----------------------------------------------------------------------
FTSK_STAES      ----------------------------------------------------------------------
FTSK_STAEQ      ----------------------------------------------------------------------
FTSK_STRP8      ----------------------------------------------------------------------
FTSK_STRP3      ----------------------------------------------------------------------
FTSK_STRP1      ----------------------------------------------------------------------
FTSK_STRMU      ----------------------------------------------------------------------
FTSK_STRP6      ----------------------------------------------------------------------
FTSK_STRA3      ----------------------------------------------------------------------
FTSK1_NEIMA     ----------------------------------------------------------------------
FTSK_AGRT5      ----------------------------------------------------------------------
FTSK_STRA5      ----------------------------------------------------------------------
FTSK2_NEIMA     ----------------------------------------------------------------------
FTSK2_NEIMB     ----------------------------------------------------------------------
FTSK_PASMU      ----------------------------------------------------------------------
FTSK_XYLFT      ----------------------------------------------------------------------
FTSK_XYLFA      ----------------------------------------------------------------------
FTSK_LACLA      ----------------------------------------------------------------------
FTSKL_DEIRA     ----------------------------------------------------------------------
FTSK_RHIME      ----------------------------------------------------------------------
FTSK_PSEPK      ----------------------------------------------------------------------
FTSK_XANAC      ----------------------------------------------------------------------
FTSK_RHILO      ----------------------------------------------------------------------
FTSK_XANCP      ----------------------------------------------------------------------
FTSK1_NEIMB     ----------------------------------------------------------------------
FTSK_SHEON      ----------------------------------------------------------------------
FTSK_RICPR      ----------------------------------------------------------------------
FTSK_ECOL6      ----------------------------------------------------------------------
FTSK_BIFLO      ----------------------------------------------------------------------
FTSK_HAEDU      ----------------------------------------------------------------------
FTSK_MYCTU      ----------------------------------------------------------------------
FTSK_VIBCH      ----------------------------------------------------------------------
FTSK_RICCN      ----------------------------------------------------------------------
FTSK_SHIFL      ----------------------------------------------------------------------
FTSK_ECOLI      ----------------------------------------------------------------------
FTSK_ECO57      ----------------------------------------------------------------------
FTSK_CORGL      ----------------------------------------------------------------------
FTSK_PSEU2      ----------------------------------------------------------------------
FTSK_RICTY      ----------------------------------------------------------------------
FTSK_PSESM      ----------------------------------------------------------------------
FTSK_HAEIN      ----------------------------------------------------------------------
FTSK_BRAJA      ----------------------------------------------------------------------
FTSK_HELPY      ----------------------------------------------------------------------
FTSK_HELPJ      ----------------------------------------------------------------------
FTSK_BORBU      ----------------------------------------------------------------------
FTSK_RICFE      ----------------------------------------------------------------------
FTSK_MYCLE      ----------------------------------------------------------------------
FTSK1_RALSO     ----------------------------------------------------------------------
FTSK_SALTY      ----------------------------------------------------------------------
FTSK_SALTI      ----------------------------------------------------------------------
FTSK_YERPE      ----------------------------------------------------------------------
FTSK_STRAW      ----------------------------------------------------------------------
FTSK_BRUSU      ----------------------------------------------------------------------
FTSK_BRUME      ----------------------------------------------------------------------
FTSK2_RALSO     ----------------------------------------------------------------------
FTSK_PSEAE      ----------------------------------------------------------------------
FTSK_COXBU      ----------------------------------------------------------------------
FTSK_LEPIN      ----------------------------------------------------------------------
FTSK_LEPIC      ----------------------------------------------------------------------
FTSK_TROWT      ----------------------------------------------------------------------
FTSK_TROW8      ----------------------------------------------------------------------
FTSK_CHLTR      ----------------------------------------------------------------------
FTSK_CHLMU      ----------------------------------------------------------------------
FTSK_RICBR      ----------------------------------------------------------------------
FTSK_STRCO      ----------------------------------------------------------------------
FTSK_CHLTE      ----------------------------------------------------------------------
FTSK_VIBVU      ----------------------------------------------------------------------
FTSK_VIBPA      ----------------------------------------------------------------------
FTSK_COREF      ----------------------------------------------------------------------
FTSK_CAUCR      ----------------------------------------------------------------------
FTSK_CHLPN      ----------------------------------------------------------------------
FTSK_AZOBR      ----------------------------------------------------------------------
FTSKL_ANASP     ----------------------------------------------------------------------
Y3709_CLOAB     ----------------------------------------------------------------------
ESSC_STAAR      ----------------------------------------------------------------------
ESSC_STAAN      ----------------------------------------------------------------------
ESSC_STAAM      ----------------------------------------------------------------------
ESSC_STAAW      ----------------------------------------------------------------------
ESSC_STAAS      ----------------------------------------------------------------------
ESSC_STAAE      ----------------------------------------------------------------------
ESSC_STAAC      ----------------------------------------------------------------------
YUKB_BACSU      ----------------------------------------------------------------------
TRA_STRLI       ----------------------------------------------------------------------
YDCQ_BACSU      ----------------------------------------------------------------------
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
HST6_CANAL      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      ----------------------------------------------------------------------
FLGE_BUCAI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PIYIIYLCTKLFLFKREVLFSRIGLGITIALITSVLLIQTVNINDYYVQGSIWGSIKTIWHSQSEWHGGV
FTSK_CLOPE      PIYIIYLCTKLFLFKREVLFSRIGLGITIALITSVLLIQTVNINDYYVQGSIWGSIKTIWHSQSEWHGGV
FTSK_CLOAB      PILLMFIGVCYLIKKGKITFSKRFYGVNIIIINTLMLIQMQKLSLYY-NGNILDGIKKIYESSDTFHGGV
FTSK_CLOTE      ----------LILKKGKVTYSGKFYGIVLFILNTLFCLHIGDIVTKGLDRSFFQGIVDIYNSETFLHGGV
FTSK_THETN      ----------------------------------------------------------------------
FTSK_SPOUR      ----------------------------------------------------------------------
FTSK_BACSU      ----------------------------------------------------------------------
FTSK_BACAN      ----------------------------------------------------------------------
FTSK_BACCR      ----------------------------------------------------------------------
FTSK_STAAN      YILVL-LATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNSGIKAEREPVLSYVYQSYQHSHGGV
FTSK_STAAM      YILVL-LATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNSGIKAEREPVLSYVYQSYQHSHGGV
FTSK_STAAW      YILVL-LATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNSGIKAEREPVLSYVYQSYQHSHGGV
FTSK_STAAS      YILVL-LATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNSGIKAEREPVLSYVYQSYQHSHGGV
FTSK_STAAC      YILVL-LATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNSGIKAEREPVLSYVYQSYQHSHGGV
FTSK_STAAR      YILVL-LATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNSGIKAEREPVLSYVYQSYQHSHGGV
FTSK_BACHD      ----------------------------------------------------------------------
FTSK_LACPL      ----------------------------------------------------------------------
FTSK_OCEIH      ----------------------------------------------------------------------
FTSK_LISIN      ----------------------------------------------------------------------
FTSK_LISMO      ----------------------------------------------------------------------
FTSK_CAMJE      ----------------------------------------------------------------------
FTSK_CAMJJ      ----------------------------------------------------------------------
FTSK_STRR6      ----------------------------------------------------------------------
FTSK_STRPN      ----------------------------------------------------------------------
FTSK_TREPA      ----------------------------------------------------------------------
FTSK_STAES      ----------------------------------------------------------------------
FTSK_STAEQ      ----------------------------------------------------------------------
FTSK_STRP8      ----------------------------------------------------------------------
FTSK_STRP3      ----------------------------------------------------------------------
FTSK_STRP1      ----------------------------------------------------------------------
FTSK_STRMU      ----------------------------------------------------------------------
FTSK_STRP6      ----------------------------------------------------------------------
FTSK_STRA3      ----------------------------------------------------------------------
FTSK1_NEIMA     ----------------------------------------------------------------------
FTSK_AGRT5      ----------------------------------------------------------------------
FTSK_STRA5      ----------------------------------------------------------------------
FTSK2_NEIMA     ----------------------------------------------------------------------
FTSK2_NEIMB     ----------------------------------------------------------------------
FTSK_PASMU      ----------------------------------------------------------------------
FTSK_XYLFT      ----------------------------------------------------------------------
FTSK_XYLFA      ----------------------------------------------------------------------
FTSK_LACLA      ----------------------------------------------------------------------
FTSKL_DEIRA     ----------------------------------------------------------------------
FTSK_RHIME      ----------------------------------------------------------------------
FTSK_PSEPK      ----------------------------------------------------------------------
FTSK_XANAC      ----------------------------------------------------------------------
FTSK_RHILO      ----------------------------------------------------------------------
FTSK_XANCP      ----------------------------------------------------------------------
FTSK1_NEIMB     ----------------------------------------------------------------------
FTSK_SHEON      ----------------------------------------------------------------------
FTSK_RICPR      ----------------------------------------------------------------------
FTSK_ECOL6      ----------------------------------------------------------------------
FTSK_BIFLO      ----------------------------------------------------------------------
FTSK_HAEDU      ----------------------------------------------------------------------
FTSK_MYCTU      ----------------------------------------------------------------------
FTSK_VIBCH      ----------------------------------------------------------------------
FTSK_RICCN      ----------------------------------------------------------------------
FTSK_SHIFL      ----------------------------------------------------------------------
FTSK_ECOLI      ----------------------------------------------------------------------
FTSK_ECO57      ----------------------------------------------------------------------
FTSK_CORGL      ----------------------------------------------------------------------
FTSK_PSEU2      ----------------------------------------------------------------------
FTSK_RICTY      ----------------------------------------------------------------------
FTSK_PSESM      ----------------------------------------------------------------------
FTSK_HAEIN      ----------------------------------------------------------------------
FTSK_BRAJA      ----------------------------------------------------------------------
FTSK_HELPY      ----------------------------------------------------------------------
FTSK_HELPJ      ----------------------------------------------------------------------
FTSK_BORBU      ----------------------------------------------------------------------
FTSK_RICFE      ----------------------------------------------------------------------
FTSK_MYCLE      ----------------------------------------------------------------------
FTSK1_RALSO     ----------------------------------------------------------------------
FTSK_SALTY      ----------------------------------------------------------------------
FTSK_SALTI      ----------------------------------------------------------------------
FTSK_YERPE      ----------------------------------------------------------------------
FTSK_STRAW      ----------------------------------------------------------------------
FTSK_BRUSU      ----------------------------------------------------------------------
FTSK_BRUME      ----------------------------------------------------------------------
FTSK2_RALSO     ----------------------------------------------------------------------
FTSK_PSEAE      ----------------------------------------------------------------------
FTSK_COXBU      ----------------------------------------------------------------------
FTSK_LEPIN      ----------------------------------------------------------------------
FTSK_LEPIC      ----------------------------------------------------------------------
FTSK_TROWT      ----------------------------------------------------------------------
FTSK_TROW8      ----------------------------------------------------------------------
FTSK_CHLTR      ----------------------------------------------------------------------
FTSK_CHLMU      ----------------------------------------------------------------------
FTSK_RICBR      ----------------------------------------------------------------------
FTSK_STRCO      ----------------------------------------------------------------------
FTSK_CHLTE      ----------------------------------------------------------------------
FTSK_VIBVU      ----------------------------------------------------------------------
FTSK_VIBPA      ----------------------------------------------------------------------
FTSK_COREF      ----------------------------------------------------------------------
FTSK_CAUCR      ----------------------------------------------------------------------
FTSK_CHLPN      ----------------------------------------------------------------------
FTSK_AZOBR      ----------------------------------------------------------------------
FTSKL_ANASP     ----------------------------------------------------------------------
Y3709_CLOAB     ----------------------------------------------------------------------
ESSC_STAAR      ----------------------------------------------------------------------
ESSC_STAAN      ----------------------------------------------------------------------
ESSC_STAAM      ----------------------------------------------------------------------
ESSC_STAAW      ----------------------------------------------------------------------
ESSC_STAAS      ----------------------------------------------------------------------
ESSC_STAAE      ----------------------------------------------------------------------
ESSC_STAAC      ----------------------------------------------------------------------
YUKB_BACSU      ----------------------------------------------------------------------
TRA_STRLI       ----------------------------------------------------------------------
YDCQ_BACSU      ----------------------------------------------------------------------
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
HST6_CANAL      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      ----------------------------------------------------------------------
FLGE_BUCAI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VGFLIVLPLYKLVGKIGLFVIFVTLYLISSMLIFDYNLVSIRNFFGGFKEKASKVKFVDKKYEKDDYINL
FTSK_CLOPE      VGFLIVLPLYKLVGKIGLFVIFVTLYLISSMLIFDYNLVSIRNFFGGFKEKASKVKFVDKKYEKDDYINL
FTSK_CLOAB      ISYILDVPIYKLFGK-GYFVLFITLYIISFLLVSEKSAGEIIRENXXXXXXXXXXXSVDET-KTMDYEN-
FTSK_CLOTE      ISYIVDLPLYKLFGKWGTFVIFISIYVI------------------------------------------
FTSK_THETN      ----------------------------------------------------------------------
FTSK_SPOUR      ----------------------------------------------------------------------
FTSK_BACSU      ----------------------------------------------------------------------
FTSK_BACAN      ----------------------------------------------------------------------
FTSK_BACCR      ----------------------------------------------------------------------
FTSK_STAAN      LGFYLLELSVPLISLFGVCIITILLLCSSVILLTNHQLENIKAWFGSFNEKMSERNXXXXXXXXXXXXXX
FTSK_STAAM      LGFYLLELSVPLISLFGVCIITILLLCSSVILLTNHQLENIKAWFGSFNEKMSERNXXXXXXXXXXXXXX
FTSK_STAAW      LGFYLLELSVPLISLFGVCIITILLLCSSVILLTNHQLENIKAWFGSFNEKMSERNXXXXXXXXXXXXXX
FTSK_STAAS      LGFYLLELSVPLISLFGVCIITILLLCSSVILLTNHQLENIKAWFGSFNEKMSERNXXXXXXXXXXXXXX
FTSK_STAAC      LGFYLLELSVPLISLFGVCIITILLLCSSVILLTNHQLENIKAWFGSFNEKMSERNXXXXXXXXXXXXXX
FTSK_STAAR      LGFYLLELSVPLISLFGVCIITILLLCSSVILLTNHQLENIKAWFGSFNEKMSERNXXXXXXXXXXXXXX
FTSK_BACHD      ----------------------------------------------------------------------
FTSK_LACPL      ----------------------------------------------------------------------
FTSK_OCEIH      ----------------------------------------------------------------------
FTSK_LISIN      ----------------------------------------------------------------------
FTSK_LISMO      ----------------------------------------------------------------------
FTSK_CAMJE      ----------------------------------------------------------------------
FTSK_CAMJJ      ----------------------------------------------------------------------
FTSK_STRR6      ----------------------------------------------------------------------
FTSK_STRPN      ----------------------------------------------------------------------
FTSK_TREPA      ----------------------------------------------------------------------
FTSK_STAES      ----------------------------------------------------------------------
FTSK_STAEQ      ----------------------------------------------------------------------
FTSK_STRP8      ----------------------------------------------------------------------
FTSK_STRP3      ----------------------------------------------------------------------
FTSK_STRP1      ----------------------------------------------------------------------
FTSK_STRMU      ----------------------------------------------------------------------
FTSK_STRP6      ----------------------------------------------------------------------
FTSK_STRA3      ----------------------------------------------------------------------
FTSK1_NEIMA     ----------------------------------------------------------------------
FTSK_AGRT5      ----------------------------------------------------------------------
FTSK_STRA5      ----------------------------------------------------------------------
FTSK2_NEIMA     ----------------------------------------------------------------------
FTSK2_NEIMB     ----------------------------------------------------------------------
FTSK_PASMU      ----------------------------------------------------------------------
FTSK_XYLFT      ----------------------------------------------------------------------
FTSK_XYLFA      ----------------------------------------------------------------------
FTSK_LACLA      ----------------------------------------------------------------------
FTSKL_DEIRA     ----------------------------------------------------------------------
FTSK_RHIME      ----------------------------------------------------------------------
FTSK_PSEPK      ----------------------------------------------------------------------
FTSK_XANAC      ----------------------------------------------------------------------
FTSK_RHILO      ----------------------------------------------------------------------
FTSK_XANCP      ----------------------------------------------------------------------
FTSK1_NEIMB     ----------------------------------------------------------------------
FTSK_SHEON      ----------------------------------------------------------------------
FTSK_RICPR      ----------------------------------------------------------------------
FTSK_ECOL6      ----------------------------------------------------------------------
FTSK_BIFLO      ----------------------------------------------------------------------
FTSK_HAEDU      ----------------------------------------------------------------------
FTSK_MYCTU      ----------------------------------------------------------------------
FTSK_VIBCH      ----------------------------------------------------------------------
FTSK_RICCN      ----------------------------------------------------------------------
FTSK_SHIFL      ----------------------------------------------------------------------
FTSK_ECOLI      ----------------------------------------------------------------------
FTSK_ECO57      ----------------------------------------------------------------------
FTSK_CORGL      ----------------------------------------------------------------------
FTSK_PSEU2      ----------------------------------------------------------------------
FTSK_RICTY      ----------------------------------------------------------------------
FTSK_PSESM      ----------------------------------------------------------------------
FTSK_HAEIN      ----------------------------------------------------------------------
FTSK_BRAJA      ----------------------------------------------------------------------
FTSK_HELPY      ----------------------------------------------------------------------
FTSK_HELPJ      ----------------------------------------------------------------------
FTSK_BORBU      ----------------------------------------------------------------------
FTSK_RICFE      ----------------------------------------------------------------------
FTSK_MYCLE      ----------------------------------------------------------------------
FTSK1_RALSO     ----------------------------------------------------------------------
FTSK_SALTY      ----------------------------------------------------------------------
FTSK_SALTI      ----------------------------------------------------------------------
FTSK_YERPE      ----------------------------------------------------------------------
FTSK_STRAW      ----------------------------------------------------------------------
FTSK_BRUSU      ----------------------------------------------------------------------
FTSK_BRUME      ----------------------------------------------------------------------
FTSK2_RALSO     ----------------------------------------------------------------------
FTSK_PSEAE      ----------------------------------------------------------------------
FTSK_COXBU      ----------------------------------------------------------------------
FTSK_LEPIN      ----------------------------------------------------------------------
FTSK_LEPIC      ----------------------------------------------------------------------
FTSK_TROWT      ----------------------------------------------------------------------
FTSK_TROW8      ----------------------------------------------------------------------
FTSK_CHLTR      ----------------------------------------------------------------------
FTSK_CHLMU      ----------------------------------------------------------------------
FTSK_RICBR      ----------------------------------------------------------------------
FTSK_STRCO      ----------------------------------------------------------------------
FTSK_CHLTE      ----------------------------------------------------------------------
FTSK_VIBVU      ----------------------------------------------------------------------
FTSK_VIBPA      ----------------------------------------------------------------------
FTSK_COREF      ----------------------------------------------------------------------
FTSK_CAUCR      ----------------------------------------------------------------------
FTSK_CHLPN      ----------------------------------------------------------------------
FTSK_AZOBR      ----------------------------------------------------------------------
FTSKL_ANASP     ----------------------------------------------------------------------
Y3709_CLOAB     ----------------------------------------------------------------------
ESSC_STAAR      ----------------------------------------------------------------------
ESSC_STAAN      ----------------------------------------------------------------------
ESSC_STAAM      ----------------------------------------------------------------------
ESSC_STAAW      ----------------------------------------------------------------------
ESSC_STAAS      ----------------------------------------------------------------------
ESSC_STAAE      ----------------------------------------------------------------------
ESSC_STAAC      ----------------------------------------------------------------------
YUKB_BACSU      ----------------------------------------------------------------------
TRA_STRLI       ----------------------------------------------------------------------
YDCQ_BACSU      ----------------------------------------------------------------------
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     ------------------------------------------------RERLSKINLEDLKRDKEEYELL
MYO2_SACBA      ---------------------------------------------------ASKVKENKEMTERIKELQV
HST6_CANAL      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      -----------------------------------------------------------------DMVRL
FLGE_BUCAI      --------------------------------------IMLKAFLNRNTESKSSVDNSDNKLSKEDYMTY


                         .         .         .         +         .         .         .:280
query           KKKDGASEGNKESKKDDISEDNNKIKILDFMKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLS
FTSK_CLOPE      KKKDGASEGNKESKKDDISEDNNKIKILDFMKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLS
FTSK_CLOAB      --------DNKDKDETLAKKISSKIKIVDFMKNEG--NVDSNK----GQALEEIAVYDSAEKNEN-----
FTSK_CLOTE      ----------------------------------------------------NIEENDDTKENKPI----
FTSK_THETN      ----------------------------------------------------------------------
FTSK_SPOUR      ----------------------------------------------------------------------
FTSK_BACSU      ----------------------------------------------------------------------
FTSK_BACAN      ----------------------------------------------------------------------
FTSK_BACCR      ----------------------------------------------------------------------
FTSK_STAAN      XXXXXXQ--NEQPQIKDVSDQERDIPIYGHTENESKSQCQPSRKKR---------VFDAENSS-------
FTSK_STAAM      XXXXXXQ--NEQPQIKDVSDQERDIPIYGHTENESKSQCQPSRKKR---------VFDAENSS-------
FTSK_STAAW      XXXXXXQ--NEQPQIKDVS---------DFTEVPQERDIPENEXXXXXXXXXXXXVFDAENSS-------
FTSK_STAAS      XXXXXXQ--NEQPQIKDVS---------DFTEVPQERDIPENEXXXXXXXXXXXXVFDAENSS-------
FTSK_STAAC      XXXXXXQ--NEQPQIKDVS---------DFTEVPQERDIPENEXXXXXXXXXXXXVFDAENSS-------
FTSK_STAAR      XXXXXXQ--NEQPQIKDVS---------DFTEVPQERDIPENEXXXXXXXXXXXXVFDAENSS-------
FTSK_BACHD      ----------------------------------------------------------------------
FTSK_LACPL      ----------------------------------------------------------------------
FTSK_OCEIH      ----------------------------------------------------------------------
FTSK_LISIN      ----------------------------------------------------------------------
FTSK_LISMO      ----------------------------------------------------------------------
FTSK_CAMJE      ----------------------------------------------------------------------
FTSK_CAMJJ      ----------------------------------------------------------------------
FTSK_STRR6      ----------------------------------------------------------------------
FTSK_STRPN      ----------------------------------------------------------------------
FTSK_TREPA      ----------------------------------------------------------------------
FTSK_STAES      ----------------------------------------------------------------------
FTSK_STAEQ      ----------------------------------------------------------------------
FTSK_STRP8      ----------------------------------------------------------------------
FTSK_STRP3      ----------------------------------------------------------------------
FTSK_STRP1      ----------------------------------------------------------------------
FTSK_STRMU      ----------------------------------------------------------------------
FTSK_STRP6      ----------------------------------------------------------------------
FTSK_STRA3      ----------------------------------------------------------------------
FTSK1_NEIMA     ----------------------------------------------------------------------
FTSK_AGRT5      ----------------------------------------------------------------------
FTSK_STRA5      ----------------------------------------------------------------------
FTSK2_NEIMA     ----------------------------------------------------------------------
FTSK2_NEIMB     ----------------------------------------------------------------------
FTSK_PASMU      ----------------------------------------------------------------------
FTSK_XYLFT      ----------------------------------------------------------------------
FTSK_XYLFA      ----------------------------------------------------------------------
FTSK_LACLA      ----------------------------------------------------------------------
FTSKL_DEIRA     ----------------------------------------------------------------------
FTSK_RHIME      ----------------------------------------------------------------------
FTSK_PSEPK      ----------------------------------------------------------------------
FTSK_XANAC      ----------------------------------------------------------------------
FTSK_RHILO      ----------------------------------------------------------------------
FTSK_XANCP      ----------------------------------------------------------------------
FTSK1_NEIMB     ----------------------------------------------------------------------
FTSK_SHEON      ----------------------------------------------------------------------
FTSK_RICPR      ----------------------------------------------------------------------
FTSK_ECOL6      ----------------------------------------------------------------------
FTSK_BIFLO      ----------------------------------------------------------------------
FTSK_HAEDU      ----------------------------------------------------------------------
FTSK_MYCTU      ----------------------------------------------------------------------
FTSK_VIBCH      ----------------------------------------------------------------------
FTSK_RICCN      ----------------------------------------------------------------------
FTSK_SHIFL      ----------------------------------------------------------------------
FTSK_ECOLI      ----------------------------------------------------------------------
FTSK_ECO57      ----------------------------------------------------------------------
FTSK_CORGL      ----------------------------------------------------------------------
FTSK_PSEU2      ----------------------------------------------------------------------
FTSK_RICTY      ----------------------------------------------------------------------
FTSK_PSESM      ----------------------------------------------------------------------
FTSK_HAEIN      ----------------------------------------------------------------------
FTSK_BRAJA      ----------------------------------------------------------------------
FTSK_HELPY      ----------------------------------------------------------------------
FTSK_HELPJ      ----------------------------------------------------------------------
FTSK_BORBU      ----------------------------------------------------------------------
FTSK_RICFE      ----------------------------------------------------------------------
FTSK_MYCLE      ----------------------------------------------------------------------
FTSK1_RALSO     ----------------------------------------------------------------------
FTSK_SALTY      ----------------------------------------------------------------------
FTSK_SALTI      ----------------------------------------------------------------------
FTSK_YERPE      ----------------------------------------------------------------------
FTSK_STRAW      ----------------------------------------------------------------------
FTSK_BRUSU      ----------------------------------------------------------------------
FTSK_BRUME      ----------------------------------------------------------------------
FTSK2_RALSO     ----------------------------------------------------------------------
FTSK_PSEAE      ----------------------------------------------------------------------
FTSK_COXBU      ----------------------------------------------------------------------
FTSK_LEPIN      ----------------------------------------------------------------------
FTSK_LEPIC      ----------------------------------------------------------------------
FTSK_TROWT      ----------------------------------------------------------------------
FTSK_TROW8      ----------------------------------------------------------------------
FTSK_CHLTR      ----------------------------------------------------------------------
FTSK_CHLMU      ----------------------------------------------------------------------
FTSK_RICBR      ----------------------------------------------------------------------
FTSK_STRCO      ----------------------------------------------------------------------
FTSK_CHLTE      ----------------------------------------------------------------------
FTSK_VIBVU      ----------------------------------------------------------------------
FTSK_VIBPA      ----------------------------------------------------------------------
FTSK_COREF      ----------------------------------------------------------------------
FTSK_CAUCR      ----------------------------------------------------------------------
FTSK_CHLPN      ----------------------------------------------------------------------
FTSK_AZOBR      ----------------------------------------------------------------------
FTSKL_ANASP     ----------------------------------------------------------------------
Y3709_CLOAB     ----------------------------------------------------------------------
ESSC_STAAR      ----------------------------------------------------------------------
ESSC_STAAN      ----------------------------------------------------------------------
ESSC_STAAM      ----------------------------------------------------------------------
ESSC_STAAW      ----------------------------------------------------------------------
ESSC_STAAS      ----------------------------------------------------------------------
ESSC_STAAE      ----------------------------------------------------------------------
ESSC_STAAC      ----------------------------------------------------------------------
YUKB_BACSU      ----------------------------------------------------------------------
TRA_STRLI       ----------------------------------------------------------------------
YDCQ_BACSU      ----------------------------------------------------------------------
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     KSESNKLKGEVESLKKEVNELN------DYKNESTKLEIEIDKAKKESEIEDRLLRLGFKTIDELSRELK
MYO2_SACBA      QVEESAKETLENMKKEHVNIDNQKNKDMELQKTDNLQSTEQNLKNAQLELEEMVKHNELKEESRKQLD-E
HST6_CANAL      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      KKELMANEGNEEAKVKQQSDKNNEL-----MKDISKEEIDDSKANKTNNLAEVMKQKIINKKHRLEKDNE
FLGE_BUCAI      -----ISIYNKEGKKEDITVSFNKKETNKWTVNVESNDSDDKETIKDGELTSDNVFNITSKDSKKYENIT


                         .         *         .         .         .         .         +:350
query           LDNTIIEQRGFNSEKAKEEESIDKEISNNIASKGSSVGASYVAPXXXXXXXXXXXXXXXXXXXXXXXXXX
FTSK_CLOPE      LDNTIIEQRGFNSEKAKEEESIDKEISNNIASKGSSVGASYVAPXXXXXXXXXXXXXXXXXXXXXXXXXX
FTSK_CLOAB      -ESKVIG--------AELEDAIGQTSSNNS-------DITYEFPPISLLNVNXXXXXXXXXXXXXXXXXX
FTSK_CLOTE      -------QKGKDSNNIQGEKDINKELEEEM-SKAALKTIDYEFPSIDLLNDXXXXXXXXXXXXXXXXXXX
FTSK_THETN      ----------------------------------------------------------------------
FTSK_SPOUR      ----------------------------------------------------------------------
FTSK_BACSU      ----------------------------------------------------------------------
FTSK_BACAN      ----------------------------------------------------------------------
FTSK_BACCR      ----------------------------------------------------------------------
FTSK_STAAN      --NNIVNHQADQQEQLTEQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVL
FTSK_STAAM      --NNIVNHQADQQEQLTEQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVL
FTSK_STAAW      -NNIVNHHQADQQEQLTEQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVL
FTSK_STAAS      -NNIVNHHQADQQEQLTEQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVL
FTSK_STAAC      -NNIVNHHQADQQEQLTEQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVL
FTSK_STAAR      -NNIVNHHQADQQEQLIEQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVL
FTSK_BACHD      ----------------------------------------------------------------------
FTSK_LACPL      ----------------------------------------------------------------------
FTSK_OCEIH      ----------------------------------------------------------------------
FTSK_LISIN      ----------------------------------------------------------------------
FTSK_LISMO      ----------------------------------------------------------------------
FTSK_CAMJE      ----------------------------------------------------------------------
FTSK_CAMJJ      ----------------------------------------------------------------------
FTSK_STRR6      ----------------------------------------------------------------------
FTSK_STRPN      ----------------------------------------------------------------------
FTSK_TREPA      ----------------------------------------------------------------------
FTSK_STAES      ----------------------------------------------------------------------
FTSK_STAEQ      ----------------------------------------------------------------------
FTSK_STRP8      ----------------------------------------------------------------------
FTSK_STRP3      ----------------------------------------------------------------------
FTSK_STRP1      ----------------------------------------------------------------------
FTSK_STRMU      ----------------------------------------------------------------------
FTSK_STRP6      ----------------------------------------------------------------------
FTSK_STRA3      ----------------------------------------------------------------------
FTSK1_NEIMA     ----------------------------------------------------------------------
FTSK_AGRT5      ----------------------------------------------------------------------
FTSK_STRA5      ----------------------------------------------------------------------
FTSK2_NEIMA     ----------------------------------------------------------------------
FTSK2_NEIMB     ----------------------------------------------------------------------
FTSK_PASMU      ----------------------------------------------------------------------
FTSK_XYLFT      ----------------------------------------------------------------------
FTSK_XYLFA      ----------------------------------------------------------------------
FTSK_LACLA      ----------------------------------------------------------------------
FTSKL_DEIRA     ----------------------------------------------------------------------
FTSK_RHIME      ----------------------------------------------------------------------
FTSK_PSEPK      ----------------------------------------------------------------------
FTSK_XANAC      ----------------------------------------------------------------------
FTSK_RHILO      ----------------------------------------------------------------------
FTSK_XANCP      ----------------------------------------------------------------------
FTSK1_NEIMB     ----------------------------------------------------------------------
FTSK_SHEON      ----------------------------------------------------------------------
FTSK_RICPR      ----------------------------------------------------------------------
FTSK_ECOL6      ----------------------------------------------------------------------
FTSK_BIFLO      ----------------------------------------------------------------------
FTSK_HAEDU      ----------------------------------------------------------------------
FTSK_MYCTU      ----------------------------------------------------------------------
FTSK_VIBCH      ----------------------------------------------------------------------
FTSK_RICCN      ----------------------------------------------------------------------
FTSK_SHIFL      ----------------------------------------------------------------------
FTSK_ECOLI      ----------------------------------------------------------------------
FTSK_ECO57      ----------------------------------------------------------------------
FTSK_CORGL      ----------------------------------------------------------------------
FTSK_PSEU2      ----------------------------------------------------------------------
FTSK_RICTY      ----------------------------------------------------------------------
FTSK_PSESM      ----------------------------------------------------------------------
FTSK_HAEIN      ----------------------------------------------------------------------
FTSK_BRAJA      ----------------------------------------------------------------------
FTSK_HELPY      ----------------------------------------------------------------------
FTSK_HELPJ      ----------------------------------------------------------------------
FTSK_BORBU      ----------------------------------------------------------------------
FTSK_RICFE      ----------------------------------------------------------------------
FTSK_MYCLE      ----------------------------------------------------------------------
FTSK1_RALSO     ----------------------------------------------------------------------
FTSK_SALTY      ----------------------------------------------------------------------
FTSK_SALTI      ----------------------------------------------------------------------
FTSK_YERPE      ----------------------------------------------------------------------
FTSK_STRAW      ----------------------------------------------------------------------
FTSK_BRUSU      ----------------------------------------------------------------------
FTSK_BRUME      ----------------------------------------------------------------------
FTSK2_RALSO     ----------------------------------------------------------------------
FTSK_PSEAE      ----------------------------------------------------------------------
FTSK_COXBU      ----------------------------------------------------------------------
FTSK_LEPIN      ----------------------------------------------------------------------
FTSK_LEPIC      ----------------------------------------------------------------------
FTSK_TROWT      ----------------------------------------------------------------------
FTSK_TROW8      ----------------------------------------------------------------------
FTSK_CHLTR      ----------------------------------------------------------------------
FTSK_CHLMU      ----------------------------------------------------------------------
FTSK_RICBR      ----------------------------------------------------------------------
FTSK_STRCO      ----------------------------------------------------------------------
FTSK_CHLTE      ----------------------------------------------------------------------
FTSK_VIBVU      ----------------------------------------------------------------------
FTSK_VIBPA      ----------------------------------------------------------------------
FTSK_COREF      ----------------------------------------------------------------------
FTSK_CAUCR      ----------------------------------------------------------------------
FTSK_CHLPN      ----------------------------------------------------------------------
FTSK_AZOBR      ----------------------------------------------------------------------
FTSKL_ANASP     ----------------------------------------------------------------------
Y3709_CLOAB     ----------------------------------------------------------------------
ESSC_STAAR      ----------------------------------------------------------------------
ESSC_STAAN      ----------------------------------------------------------------------
ESSC_STAAM      ----------------------------------------------------------------------
ESSC_STAAW      ----------------------------------------------------------------------
ESSC_STAAS      ----------------------------------------------------------------------
ESSC_STAAE      ----------------------------------------------------------------------
ESSC_STAAC      ----------------------------------------------------------------------
YUKB_BACSU      ----------------------------------------------------------------------
TRA_STRLI       ----------------------------------------------------------------------
YDCQ_BACSU      ----------------------------------------------------------------------
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     FHNKYIEAKNAEKELRDILESLKDE---------------------------------------------
MYO2_SACBA      LDETLVEHQTLNGDLQNEVKSLKEEIS-------------------------------------------
HST6_CANAL      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      EEEIAKDSKKVKTEKAESECDLDAEIKDEIVA--------------------------------------
FLGE_BUCAI      LNLTTIEQS--NSDVSWEEHS-------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXTLMSFGVEAKILQVTKGPSVTRFELQPKAGIKVSKIVNLADDIALGLAAKGVRIEAPIPGKSAIGI
FTSK_CLOPE      XXXXTLMSFGVEAKILQVTKGPSVTRFELQPKAGIKVSKIVNLADDIALGLAAKGVRIEAPIPGKSAIGI
FTSK_CLOAB      XXXXXXNSFGVDAKVIQVSKGPSVTRYELQPSAGVKVSKIINLSDDIALNLAASGVRIEAPIPGKSAIGI
FTSK_CLOTE      XXXXTLTSFGVEAKVTQVTKGPSVTRFELQPSVGVKVSKIVHLADDIALNLAAQDVRIEAPIPGKSAVGI
FTSK_THETN      ----TLRNFGIEAKVVQVTKGPAITRFELQPSAGVKVSRIVXXXXXXXXXXXXPSVRIEAPIPGKSAIGI
FTSK_SPOUR      ----TFLSFGVKTRVTQVHLGPAVTKYEILPDTGVKVSRIVSXXXXXXXXXXXSGIRIEAPIPGKSAVGI
FTSK_BACSU      ----TFQSFGVKAKVTQVHLGPAVTKYEVYPDVGVKVSKIVNXXXXXXXXXXXKDIRIEAPIPGKSAIGI
FTSK_BACAN      ----TFQSFGVKAKVTKVHRGPAVTKYEVYPDMGVKVSKIVGXXXXXXXXXXXKDIRIEAPIPGKSAVGI
FTSK_BACCR      ----TFQSFGVKAKVTKVHRGPAVTKYEVYPDMGVKVSKIVXXXXXXXXXXXXKDIRIEAPIPGKSAVGI
FTSK_STAAN      EN--TLKDFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGI
FTSK_STAAM      EN--TLKDFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGI
FTSK_STAAW      EN--TLKDFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGI
FTSK_STAAS      EN--TLKDFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGI
FTSK_STAAC      EN--TLKDFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGI
FTSK_STAAR      EN--TLKDFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGI
FTSK_BACHD      ----TLESFGVKAHVSKVHLGPAVTKYEVNPHVGVKVSRIVNXXXXXXXXXXXKDIRIEAPIPGKSAIGI
FTSK_LACPL      ----TLASFGVQVEVKNVSLGPSVTKYELHPAVGVKVSKVVNXXXXXXXXXXXXXXRIEAPIPGKSLIGI
FTSK_OCEIH      ----TFTSFGVKAKITKVHVGPAVTKYEVYPEAGVKVSKIVNXXXXXXXXXXXXXXXXEAPIPGKSAVGI
FTSK_LISIN      ----TFESFGVKAKITQVHLGPAVTKYEVQPSVGVKVSKIVSXXXXXXXXXXXXXXXXEAPIPGKSAIGI
FTSK_LISMO      ----TFESFGVKAKITQVHLGPAVTKYEVQPSVGVKVSKIVSXXXXXXXXXXXXXXXXEAPIPGKSAIGI
FTSK_CAMJE      -----LRRFKIGGDVISTYVGPVVTTFEFRPSADVKVSRILNLQDDLTMALMAKSIRIQAPIPGKDVVGI
FTSK_CAMJJ      -----LRRFKIGGDVISTYVGPVVTTFEFRPSADVKVSRILNLQDDLTMALMAKSIRIQAPIPGKDVVGI
FTSK_STRR6      ----TFASFGIKVTVERAEIGPSVTKYEVKPAVGVRVNRISNXXXXXXXXXXXKDVRIEAPIPGKSLIGI
FTSK_STRPN      ----TFASFGIKVTVERAEIGPSVTKYEVKPAVGVRVNRISNXXXXXXXXXXXKDVRIEAPIPGKSLIGI
FTSK_TREPA      ----TFSEFNIRVEITGIKKGPVVTMFELLPPPGIKLSKITNLQDNVALKLAASSVRIVAPIPGKHAIGV
FTSK_STAES      ----TLKNFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGI
FTSK_STAEQ      ----TLKNFGVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGI
FTSK_STRP8      ----TFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISNXXXXXXXXXXXKDVRIEAPIPGKSLIGI
FTSK_STRP3      ----TFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISNXXXXXXXXXXXKDVRIEAPIPGKSLIGI
FTSK_STRP1      ----TFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISNXXXXXXXXXXXKDVRIEAPIPGKSLIGI
FTSK_STRMU      ----TFTSFGIKANVERAEIGPSVTKYEVKPAVGVRVNRISNXXXXXXXXXXXQDVRIEAPIPGKSLVGI
FTSK_STRP6      ----TFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISNXXXXXXXXXXXKDVRIEAPIPGKSLIGI
FTSK_STRA3      ----TFRSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISNXXXXXXXXXXXKDVRIEAPIPGKSLIGI
FTSK1_NEIMA     -----LAEFGIGVQVVSATSGPVITRYEIEPAQGVKGSQIVALSKDLARSMSLQSVRIVETIAGKNTMGI
FTSK_AGRT5      -----LEDFGVKGEIIHVRPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAIAARV-AVVPGRNAIGI
FTSK_STRA5      ----TFRSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISNXXXXXXXXXXXKDVRIETPIPGKSLIGI
FTSK2_NEIMA     -----LAEFKVKVKVVDSYSGPVITRYEIEPDVGVRGNSVLNLEKDLARSLGVASIRVVETILGKTCMGL
FTSK2_NEIMB     -----LAEFKVKVKVVDSYSGPVITRYEIEPDVGVRGNSVLNLEKDLARSLGVASIRVVETIPGKTCMGL
FTSK_PASMU      -----LRNFGVKATVKDVLVGPVVTRYELELQPGVKASKVSSIDTDLARALMFRSIRVAEVIPGKPYIGI
FTSK_XYLFT      --------FRIDVQVVGAYPGPVITRFEIEPARGVKVSQISALDKDIARGLSVKSVRVVEVIPGKSVIGL
FTSK_XYLFA      --------FRIDVQVVGAYPGPVITRFEIEPARGVKVSQISALDKDIARGLSVKSVRVVEVIPGKSVIGL
FTSK_LACLA      ----TFKSFGIGANVESAVVGPSITKYEIKLATGTKVSRVVNXXXXXXXXXXXKDIRIEAPIPGKSLVGV
FTSKL_DEIRA     ----TLRQFGLQAKVVDLARGPTVTRYEIEPAPGEKISRIASLSNDLARALAVGGVRVEAPVPGKSVIGL
FTSK_RHIME      -----LEDFGVKGEIIHVRPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAIAARV-AVVPGRNAIGI
FTSK_PSEPK      -----LKEFGVEVAVDSIHPGPVITRYEIQPAAGVKVSRIANLAKDLARSLAVTSVRVVEVIPGKTTVGI
FTSK_XANAC      -----LKDFRIEAQVVGAYPGPVITRFEIEPAPGIKVSQISSLDKDIARGLSVKSVRVVDVIPGKSVIGL
FTSK_RHILO      -----LEDFGVKGEIIAVRPGPVVTLYELEPAPGIKSSRVIGLSDDIARSMSAIACRV-AVVPGRNAIGI
FTSK_XANCP      -----LKDFRIEAQVVGAYPGPVITRFEIEPAPGVKVSQISSLDKDIARGLSVKSVRVVDVIPGKSVVGL
FTSK1_NEIMB     -----LAEFGIGVQVVSATSGPVITRYEIEPAQGVKGSQIVALSKDLARSMSLQSVRIVETIAGKNTMGI
FTSK_SHEON      -----LADFNIVATVVGVYPGPVITRFELELAPGIKASKISNLANDLARSLLAERVRVVEVIPGKSYVGL
FTSK_RICPR      -----LNDFGVKGQIININQGPVVTQYEFEPAAGTKTSRVVGLSDDIARSLSALSTRI-AVIPGKNVLGI
FTSK_ECOL6      -----LADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGL
FTSK_BIFLO      ----TFEQFNVDAKVVGFLRGPSVTQYEVELGPGVKVEKVTNLQRNIAYAVASSDVRILSPIPGKSAIGI
FTSK_HAEDU      -----LANYNVKATVEDVLVGPVVTRYEIKPAAGIKANKVTALANDLARELMFKAIRITEVVPGKPYMGI
FTSK_MYCTU      -----LTQFKVDAAVTGCTRGPTVTRYEVELGPGVKVEKITALQRNIAYAVATESVRMLAPIPGKSAVGI
FTSK_VIBCH      -----LADYKIQAQVVDIFPGPVITRFELDLAPGVKVSRISSLSMDLARSLSAMAVRVVEVIPGKPYVGL
FTSK_RICCN      -----LNDFGVKGQIININQGPVVTQYEFEPAAGTKTSRVVGLSDDIARSLSALSTRI-AVIPGKNVLGI
FTSK_SHIFL      -----LADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGL
FTSK_ECOLI      -----LADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGL
FTSK_ECO57      -----LADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGL
FTSK_CORGL      --------FNVDATVTGFSRGPTVTRYEIELGPGVKVSKITNLQSNIAYAVATENVRLLTPIPGKSAVGI
FTSK_PSEU2      -----LKEFGVEVSVDSIHPGPVITRYEIQPAAGVKVSRISNLAKDLARSLAVTSVRVVEVIPGKTTVGI
FTSK_RICTY      -----LNDFGVKGHIININQGPVVTQYEFEPAAGTKTSRVVGLSDDIARSLSALSTRI-AVIPGKNVLGI
FTSK_PSESM      -----LKEFGVEVSVDSIHPGPVITRYEIQPAAGVKVSRISNLAKDLARSLAVTSVRVVEVIPGKTTVGI
FTSK_HAEIN      -----LRNFNVKASVKDVLVGPVVTRYELELQPGVKASKVTSIDTDLARALMFRSIRVAEVIPGKPYIGI
FTSK_BRAJA      -----LQDFGVRGEIVKANPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSALSARV-AVVPGRNAIGI
FTSK_HELPY      -----LRTFKIDGDIIRTYSGPIVTTFEFRPAPNVKVSRILGLSDDLAMTLCAESIRIQAPIKGKDVVGI
FTSK_HELPJ      -----LRTFKIDGDIIRTYSGPIVTTFEFRPAPSVKVSRILGLSDDLAMTLCAESIRIQAPIKGKDVVGI
FTSK_BORBU      ----TLKEFNINAKLIDIIKGPVVTMYAVRPDKGIKLSKITSISDNXXXXXXXXXXXXXXXXXXXEAVGI
FTSK_RICFE      -----LNDFGVKGHIININQGPVVTQYEFEPAAGTKTSRVVGLSDDIARSLSALSTRI-AVIPGKNVLGI
FTSK_MYCLE      -----LTQFKVDAAVTGCTRGPTVTRYEVELGPGVKVEKITALQKNIAYAVATESVRMLAPIPGKSAVGI
FTSK1_RALSO     -----LAEFKVPVTVAGASAGPVITRFEVDPAIGVRGAQVVGLMKDLARALGVTSIRVVETIPGKTCMGL
FTSK_SALTY      -----LADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGL
FTSK_SALTI      -----LADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGL
FTSK_YERPE      -----LGDYRVKAEVVGISPGPVITRFELDLAPGVKASRISNLSRDLARSLSAIAVRVVEVIPGKPYVGL
FTSK_STRAW      ------MEFKVDAAVTGFTRGPTVTRYEVELGPAVKVERITALTKNIAYAVASPDVRIISPIPGKSAVGI
FTSK_BRUSU      -----LEDFGVRGEIINVKPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAIAARV-AVIPGRNAIGI
FTSK_BRUME      -----LEDFGVRGEIINVKPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAIAARV-AVIPGRNAIGI
FTSK2_RALSO     -----LKDFGVEVTVVAAYPGPVITRYEIEPATGVKGSQIVNLAKDLAXXXXXXXXXXXETIPGKNCMGL
FTSK_PSEAE      -----LKEFGVEVSVDSVHPGPVITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPGKTTVGI
FTSK_COXBU      -----LADFGIQAKVVAVHPGPVVTRFELQLAAGTKASRVTNLAKDLARSLSVISVRIVEVIPGKSVIGL
FTSK_LEPIN      -----IRQYGYESQVVSMERGPIITRYELTPPLGVKLGRITSLSDELRLYLAVKNIRIVAPIPGKSTIGI
FTSK_LEPIC      -----IRQYGYESQVVSMERGPIITRYELTPPLGVKLGRITSLSDELRLYLAVKNIRIVAPIPGKSTIGI
FTSK_TROWT      -----LRQFSVNARFSGFSRGPTVTQYELELGEGVKVERIIALTKNISYAVASDKVSILSPIPGKSAIGI
FTSK_TROW8      -----LRQFSVNARFSGFSRGPTVTQYELELGEGVKVERIIALTKNISYAVASDKVSILSPIPGKSAIGI
FTSK_CHLTR      ----TLASFGIEAAIGNICSGPTLAAFEVLPNTGVKVQKIKALENDIALNLQASSIRIIAPIPGKAAVGI
FTSK_CHLMU      ----TLASFGIDASIGNICSGPTLAAFEVLPNTGVKVQKIKALENDIALNLQASSIRIIAPIPGKAAVGI
FTSK_RICBR      -----LNDFGVKGQIINIGQGPVVTLYEFEPAAGTKTSRVVGLSDDIARSLSALSTRI-AVVPGKNVLGI
FTSK_STRCO      --------FKVDAAVTGFTRGPTVTRYEVELGPAVKVERITALTKNIAYAVASPDVRIISPIPGKSAVGI
FTSK_CHLTE      -----LRIYKIDVIRIATTVGPRVALFELELAPEVKISRIKSLENDLAMAMASSGIRIIAPIPGKNAIGV
FTSK_VIBVU      -----LADYKITAEVVGIFPGPVITRFELDLAPGVKVSRISSLSMDLARSLSAMAVRVVEVIPGKPYVGL
FTSK_VIBPA      -----LADYKIKADVVGIYPGPVITRFELDLAPGVKVSRISGLSMDLARALSAMAVRVVEVIPGKPYVGL
FTSK_COREF      --------FNVDAAVTGFSRGPTVTRYEIELGPGVKVSKITNLQSNIAYAVATENVRLLTPIPGKSAVGI
FTSK_CAUCR      -----LAEFGVKGQIDQIRPGPVVTMYELVPAPGVKTARVVALADDIARSMSVISCRV-AVAQGRNAIGI
FTSK_CHLPN      ----TLTSFGIDADLGNICSGPTLAAFEVLPHSGVKVQKIKSLENDIALKLQASSIRIIAPIPGKAAVGI
FTSK_AZOBR      -----LSDFGVRGEVQKVHPGPVVTLYELEPAPGTKSSRVIGLADDIXXXXXXXXXXXXXXXXXXX-IGI
FTSKL_ANASP     ----TLEDFNINAKYVDAKNGPTFNRIRVKLERGVSYKKVEDIGNDLVLGLGLKVAPMVSVVPG--GVVF
Y3709_CLOAB     ----------------------------------------------------------------------
ESSC_STAAR      ----------------------------------------------------------------------
ESSC_STAAN      ----------------------------------------------------------------------
ESSC_STAAM      ----------------------------------------------------------------------
ESSC_STAAW      ----------------------------------------------------------------------
ESSC_STAAS      ----------------------------------------------------------------------
ESSC_STAAE      ----------------------------------------------------------------------
ESSC_STAAC      ----------------------------------------------------------------------
YUKB_BACSU      ----------------------------------------------------------------------
TRA_STRLI       ----------------------------------------------------------------------
YDCQ_BACSU      ----------------------------------------------------------------------
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
HST6_CANAL      ----TLLSFTISNASILIHQLPEITRGQRAGTFIVKLLKDITSTMEVNDSCGVSSVRKRNSKSGSDSIGT
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      ----------------------------------------------------------------------
FLGE_BUCAI      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EVPNKEQTPVFFREIVESKEFLDNKFKVACALGKDITGKAVVTDLSKMPHVLIAGATGSGKSVCINTLIV
FTSK_CLOPE      EVPNKEQTPVFFREIVESKEFLDNKFKVACALGKDITGKAVVTDLSKMPHVLIAGATGSGKSVCINTLIV
FTSK_CLOAB      EVPNKDLTAVFLSEVIQSETFSNSKSNLAFALGKDIGGNCVVTDLTKMPHLLIAGATGSGKSVCINTLII
FTSK_CLOTE      EVPNRELTPVYLKEVLDSNEFKNCNKNLAFAIGKDIAGNCVVSDLSKMPHLLIAGATGSGKSVCINTLII
FTSK_THETN      EVPNEKITPVYLREVIDSKKFRSFKSELAIGLGKDIAGNIVIADLAKMPHLLIAGATGSGKSVCINSLIV
FTSK_SPOUR      EVPNNAVAMVSLREVLESKENNPPEAKLLVGLGRDVTGQAMMTELNKMPHVLIAGATGSGKSVCVNGIIM
FTSK_BACSU      EVPNAEVAMVSLKEVLESKLNDRPDAKLLIGLGRNISGEAVLAELNKMPHLLVAGATGSGKSVCVNGIIT
FTSK_BACAN      EVPNSEVSMVTLREVLDSKANNHPEEKLLIGLGRDITGEAVLARLNKMPHLLVAGATGSGKSVCINGIIV
FTSK_BACCR      EVPNSEVSMVTLREVLDSKANNHPEEKLLIGLGRDITGEAVLARLNKMPHLLVAGATGSGKSVCINGIIV
FTSK_STAAN      EVPNEKISLVSLKEVLDEKFPSNNKLEVG--LGRDISGDPITVPLNEMPHLLVAGSTGSGKSVCINGIIT
FTSK_STAAM      EVPNEKISLVSLKEVLDEKFPSNNKLEVG--LGRDISGDPITVPLNEMPHLLVAGSTGSGKSVCINGIIT
FTSK_STAAW      EVPNEKISLVSLKEVLDEKFPSNNKLEVG--LGRDISGDPITVPLNEMPHLLVAGSTGSGKSVCINGIIT
FTSK_STAAS      EVPNEKISLVSLKEVLDEKFPSNNKLEVG--LGRDISGDPITVPLNEMPHLLVAGSTGSGKSVCINGIIT
FTSK_STAAC      EVPNEKISLVSLKEVLDEKFPSNNKLEVG--LGRDISGDPITVPLNEMPHLLVAGSTGSGKSVCINGIIT
FTSK_STAAR      EVPNEKISLVSLKEVLDEKFPSNNKLEVG--LGRDISGDPITVPLNEMPHLLVAGSTGSGKSVCINGIIT
FTSK_BACHD      EVPNQEVAIVTLREVLDSPQAKADRNVLSVGLGRDISGEPVFAPLNKMPHLLVAGATGSGKSVCINGIIT
FTSK_LACPL      EVPNKQISTVSFRDIVEAQPAHPTK-PLAVPLGRDVSGNLVVADLSKMPHLLIAGSTGSGKSVAINVMIT
FTSK_OCEIH      EVPNKEIAMVSLREVLD-KTWSNKTSKLLYALGRDISGEAVVGELNKMPHLLIAGATGSGKSVCVNGIIT
FTSK_LISIN      EVANQNVAMVSLREVLENNPKNNPDEKLQIALGRDISGEAMMASLDKMPHLLVAGATGSGKSVCINGIIT
FTSK_LISMO      EVANQNVAMVSLREVLENNPKNNPDEKLQIALGRDISGEAMMANLDKMPHLLVAGATGSGKSVCINGIIT
FTSK_CAMJE      EVPNDEIQTIYLREILQSEVFKNAKSPLTIALGKDIVGNAFVTDLKKLPHLLIAGTTGSGKSVGINSMLL
FTSK_CAMJJ      EVPNDEIQTIYLREILQSEVFKNAKSPLTIALGKDIVGNAFVTDLKKLPHLLIAGTTGSGKSVGINSMLL
FTSK_STRR6      EVPNSDIATVSFRELWEQSQTKAENF-LEIPLGKAVNGTARAFDLSKMPHLLVAGSTGSGKSVAVNGIIA
FTSK_STRPN      EVPNSDIATVSFRELWEQSQTKAENF-LEIPLGKAVNGTARAFDLSKMPHLLVAGSTGSGKSVAVNGIIA
FTSK_TREPA      EVPNKKRSLVTFKELLHTRTAGSNRMAIPVILGKDVTGEPQVIDLAQTPHLLIAGATGSGKSVCVNALIL
FTSK_STAES      EVPNDKISLVTLKEVLEDK--FPSKYKLEVGIGRDISGDPISIQLNEMPHLLVAGSTGSGKSVCINGIIT
FTSK_STAEQ      EVPNDKISLVTLKEVLEDK--FPSKYKLEVGIGRDISGDPISIQLNEMPHLLVAGSTGSGKSVCINGIIT
FTSK_STRP8      EVPNSEIATVSFRELWEQSDANPENL-LEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIIS
FTSK_STRP3      EVPNSEIATVSFRELWEQSDANPENL-LEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIIS
FTSK_STRP1      EVPNSEIATVSFRELWEQSDANPENL-LEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIIS
FTSK_STRMU      EVPNSEVATVTFRELWEQAKASPDKL-LEVPLGKAVNGSVRSFDLAKMPHILVAGSTGSGKSVAVNGIIA
FTSK_STRP6      EVPNSEIATVSFRELWEQSDANPENL-LEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIIS
FTSK_STRA3      EVPNSEIATVSFRELWEQSDANPENL-LEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIIS
FTSK1_NEIMA     ELPNDKRQDVMLSEILSSPVFAEAKSKLTVALGKDIAGTPVVGDLAKMPHLLVAGMTGSGKSVGVNGMIM
FTSK_AGRT5      ELPNQTRETVFLRELVGSRDFENSKAKLAMALGKTIGGEPVIADLAKMPHLLVAGTTGSGKSVAINTMIL
FTSK_STRA5      EVPNSEIATVSFRELWEQSDANPENL-LEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIIS
FTSK2_NEIMA     ELPNPKRQMIRLSEIFNSPEFAESKSKLTLALGQDITGQPVVTDLGKAPHLLVAGTTGSGKSVGVNAMIL
FTSK2_NEIMB     ELPNPKRQMIRLSEIFNSPEFAESKSKLTLALGQDITGQPVVTDLGKAPHLLVAGTTGSGKSVGVNAMIL
FTSK_PASMU      ETPNVNRQMVTLREVLDSDVFRQSNSLLSMALGKDISGKPVVVDLAKMPHLLVAGSTGSGKSVGVNTMIL
FTSK_XYLFT      EIPNVNREMIFLSELLRSKEYDKSPSSLTLALGKNIAGRPTVADLARMPHLLVAGTTGSGKSVAVNAMVL
FTSK_XYLFA      EIPNVNREMIFLSELLRSKEYDKSPSSLTLALGKNIAGRPTVADLARMPHLLVAGTTGSGKSVAVNAMVL
FTSK_LACLA      EIPNAEVAMVGFREMWEAGKTNPSKL-LEIPLGKSLDGGIRTFDLTRMPHLLVAGSTGSGKSVAVNGIIT
FTSKL_DEIRA     EVPNAEREPVTFHQATANPAFKNTRAKLPIILGKSIDGSMMVGDLAKMPHLLVAGSTGSGKSVCVNTLIT
FTSK_RHIME      ELPNQRREMVYLRELIGSRDFETTKTKLAMALGKTIGGESVVADLAKMPHLLVAGTTGSGKSVAINTMIL
FTSK_PSEPK      EIPNENRQMVRFSEVLATPQYDEQKSPVTLALGHDIGGKPVITDLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_XANAC      EIPNVSREMIFLSELLRSKEYDKSASPLTLALGKDIAGRPTVADLARMPHLLVAGTTGSGKSVAVNAMVL
FTSK_RHILO      ELPNAKRETVYLREIMASRDFETTKAKLALALGKTINGEAVIVDIAKMPHVLVAGTTGSGKSVAINTMIL
FTSK_XANCP      EIPNVTREMIFLSELLRSKEYDKSASPLTLALGKDIAGRPTVADLARMPHLLVAGTTGSGKSVAVNAMVL
FTSK1_NEIMB     ELPNDKRQDVMLSEILSSPVFAEAKSKLTVALGKDIAGTPVVGDLAKMPHLLVAGMTGSGKSVGVNGMIM
FTSK_SHEON      ELPNKFRETVYMRDVLDCEAFSQSKSNLTMVLGQDISGEPVVVDLGKMPHLLVAGTTGSGKSVGVNVMIT
FTSK_RICPR      ELPNKQREFFCLKELIETNEYQDKSILLPLVLGKDLAGKPLIADLAKMPHLLVAGTTGSGKSVGINAMIV
FTSK_ECOL6      ELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_BIFLO      EIPNEDREIVHLGDVLRSDKAVGDPNPMLSGIGKDVEGHFVTADLTKMPHLLVAGATGSGKSSFINSMLT
FTSK_HAEDU      ETPNTHRQTVWLRDVLDSEAFRHTQATLPMALGKDISGQPIVVDMAKMPHLLVAGQTGGGKSVGINTMIL
FTSK_MYCTU      EVPNTDREMVRLADVLTARETRRDHHPLVIGLGKDIEGDFISANLAKMPHLLVAGSTGSGKSSFVNSMLV
FTSK_VIBCH      ELPNMSRQTVYLSDVIASPQFKESKSPTTVVLGQDIAGDAVVADLSKMPHVLVAGTTGSGKSVGVNVMIL
FTSK_RICCN      ELPNKQREFFCLKELIETPEYQDKSTLLPLVLGKDLAGKPLVADLAKMPHLLVAGTTGSGKSVGINVMIV
FTSK_SHIFL      ELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_ECOLI      ELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_ECO57      ELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_CORGL      EVPNSDREMVRLGDVLNARATVENKDSMLIGLGKDIEGDFVSYSVQKMPHLLVAGSTGSGKSAFVNSLLV
FTSK_PSEU2      EIPNEDRQIVRFSEVLSTPEYDNAKSPVTLALGHDIGGKPVITDLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_RICTY      ELPNKQREFFCLKELIETPEYQDKSILLPLVLGKDLAGKPLIADLARMPHLLVAGTTGSGKSVGINAMIV
FTSK_PSESM      EIPNEDRQIVRFSEVLSTPEYDNAKSPVTLALGHDIGGKPVITDLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_HAEIN      ETPNLHRQMVPLRDVLDSNEFRDSKATLPIALGKDISGKPVIVDLAKMPHLLVAGSTGSGKSVGVNTMIL
FTSK_BRAJA      ELPNAHREKVYLRELLVAKETVDTVAKLPLCLGKTIGGDPVIIDLARTPHMLIAGTTGSGKSVAINTMIL
FTSK_HELPY      EIPNSQSQIIYLREILESELFQKSSSPLTLALGKDIVGNPFITDLKKLPHLLIAGTTGSGKSVGVNAMIL
FTSK_HELPJ      EIPNSQSQIIYLREILESELFQKSSSPLTLALGKDIVGNPFITDLKKLPHLLIAGTTGSGKSVGVNAMIL
FTSK_BORBU      EIPNKRREFILISEIIDSKEFRGD-FRIPFALGKEISGENIVFDLVNSPHLLIAGATGAGKSVCVNSLIA
FTSK_RICFE      ELPNKQREFFCLKELIETPEYQDKSTLLPLVLGKDLAGKPLIADLAKMPHLLVAGTTGSGKSVGINAMIV
FTSK_MYCLE      EVPNTDREAVRLADVLTAPSTRRDHHSLVIGLGKDIEGNFISANLAKMPHLLVAGSTGSGKSSFVNSMLV
FTSK1_RALSO     ELPNARRAMIRLSEVVNAPDFQSHASHLVLAMGKDITGNPVVTDLARAPHLLVAGTTGSGKSVAVNAMIL
FTSK_SALTY      ELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPVVADLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_SALTI      ELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPVVADLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_YERPE      ELPNKHRQTVYLREVLDCAKFRENPSPLAIVLGKDIAGQPVVADLAKMPHLLVAGTTGSGKSVGVNAMIL
FTSK_STRAW      EIPNTDREMVNLGDVLRLADAAEDDHPMLVALGKDVEGGYVMANLAKMPHLLVAGATGSGKSSCINCLIT
FTSK_BRUSU      ELPNPKREMVYLREMLASRDFEQSKAKLALALGKTINGEPVIADIAKMPHVLVAGTTGSGKSVAINTMIL
FTSK_BRUME      ELPNPKREMVYLREMLASRDFEQSKAKLALALGKTINGEPVIADIAKMPHVLVAGTTGSGKSVAINTMIL
FTSK2_RALSO     ELPNPKRQAVRLAEILGSQVYNESASQLTMALGKDIAGKPVVADLAKMPHCMVAGTTGSGKSVGINAMIL
FTSK_PSEAE      EIPNEDRQMVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLL
FTSK_COXBU      ELPNKNREVVTIYEVLATKQYQNARSSLTLALGKDIGGHPVIVDLAKMPHLLVAGTTGSGKSVSLNAMLL
FTSK_LEPIN      EVPNSIREDVFLGDILHQNLSLRPKKDLSILIGKDISGKLVGIDLNKLPHLLVAGTTGSGKSVCLNSMIS
FTSK_LEPIC      EVPNSIREDVFLGDILHQNLSLRPKKDLSILIGKDISGKLVGIDLNKLPHLLVAGTTGSGKSVCLNSMIS
FTSK_TROWT      EIPNKKRELVALGSVLQSIH--PDAHPMTVGLGKDSSGGFVLTNLTTMPHLLVAGATGSGKSSFVNSMIT
FTSK_TROW8      EIPNKKRELVALGSVLQSIH--PDAHPMTVGLGKDSSGGFVLTNLTTMPHLLVAGATGSGKSSFVNSMIT
FTSK_CHLTR      EIPNPDPQPVNFRDLLEDYQKGTQRLQVPLLLGKKANGDNFWTDLATMPHLIIAGTTGSGKSVCINTIVM
FTSK_CHLMU      EIPNPDPQPVNFRDLLEDYQKGTQRLQVPLLLGKKANGDNFWTDLATMPHLIIAGTTGSGKSVCINTIVM
FTSK_RICBR      ELPNKQREFFCLKELIETPEYQDTSTLLPLVLGKDLAGKPLIADLAKMPHLLVAGTTGSGKSVGINAMIV
FTSK_STRCO      EIPNTDREMVNLGDVLRLAESAEDDDPMLVAFGKDVEGGYVMHSLAKMPHMLVAGATGSGKSSCINCLIT
FTSK_CHLTE      EIPISKPRPVVMRSVLQVEKFKNNSMALPIVLGKSISNEVIVDDLAAMPHLLIAGATGAGKSVAINVLLT
FTSK_VIBVU      ELPNMSRQTVYLSDVIDSPQFQNATSPTTVVLGQDIAGEALVADLAKMPHVLVAGTTGSGKSVGVNVMIL
FTSK_VIBPA      ELPNMSRQTVYLSDVISSPQFEQAKSPTTVVLGQDIAGEAVIADIAKMPHVLVAGTTGSGKSVGVNVMIL
FTSK_COREF      EVPNADREMVRLGDVLNAPATVDNLDPMLVGLGKDIEGDFVSYSVQKMPHLLVAGSTGSGKSAFVNSLLV
FTSK_CAUCR      EMPNQRRETVYLRDLLSSADYEKASQILPMALGETIGGEPYIADLAKMPHLLIAGTTGSGKSVGVNAMIL
FTSK_CHLPN      EIPTPFPQAVNFRDLLEDYQKTNRKLQIPLLLGKKANGDNLWADLATMPHLIIAGTTGSGKSVCINTIVM
FTSK_AZOBR      ELPNAKRETVLLRELLAGDVFDKTXXXXXXXXXXDIGGQSVVADLARFPHLLVAGTTGSGKSVAINTMIL
FTSKL_ANASP     DIPRLDRQFAYFRDYF-SFDGEPDIYSVSIPGGVDVDGTYVEIPLDNVTHILGGGRTRGGKSQFEKAAIL
Y3709_CLOAB     ------------------------------------------------PHALVGGTTGSGKSEFLTTYLI
ESSC_STAAR      --------------------------------GKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIL
ESSC_STAAN      --------------------------------GKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIL
ESSC_STAAM      --------------------------------GKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIL
ESSC_STAAW      --------------------------------GKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIL
ESSC_STAAS      --------------------------------GKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIL
ESSC_STAAE      --------------------------------GKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIL
ESSC_STAAC      --------------------------------GKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIL
YUKB_BACSU      ------------------------------------------------PHGLLAGTTGSGKSEFLQTYIL
TRA_STRLI       -----------------------------------VTGEPVQVPLGR--RMLIAGTSGSGKSWSTRALLA
YDCQ_BACSU      --------------------------------------KHISWQFDKLPHMLIAGGTGGGKTYFMLTIIK
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
HST6_CANAL      IGPVKDNQ--LFKKVTTDNDFNNVSFSYPNKLPYILQLKSISLDVKKFTTIGIVGQSGSGKSTILKILFR
Y1934_STRMU     -------------------EFKDFSFKYDAQA--EPTLKEITLSIEKGEKVLIIGPSGSGKSTCLNGIIP
XRN2_YEAST      ----------------------------------------------------------------------
FLGE_BUCAI      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWAVNEMTRRYKLFADNGVRNIE
FTSK_CLOPE      SILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWAVNEMTRRYKLFADNGVRNIE
FTSK_CLOAB      SLLYKCAPTDVKLLMIDPKVVELSVYNGIPHLLIPVVTNPKKAAGALNWAVNEMTKRYKLFAENNVRNIE
FTSK_CLOTE      SLIYKYSPEDVKLLMVDPKVVELNIYNDIPHLLIPVVTEPKKAAGALYWAVNEMTRRYKLFAETNVRNIE
FTSK_THETN      SLLYKASPKQVKMILIDPKVVELNIYNGIPHLLTPVVTDPKKAAGVLNWAVQEMIRRYSLFADHGVRDIE
FTSK_SPOUR      SIIMRAKPHEVKMMMIDPKMVELNVFNGIPHLLAPVVTDPRKAAQALQRVVSEMERRYELFSHTGTRNIE
FTSK_BACSU      SILMRAKPHEVKMMMIDPKMVELNVYNGIPHLLAPVVTDPKKASQALKKVVNEMERRYELFSHTGTRNIE
FTSK_BACAN      SILMRAKPHEVKLMMIDPKMVELNVYNGVPHLLTPVVTDPKKASQALKKVVSEMERRYELFAHSGTRNIE
FTSK_BACCR      SILMRAKPHEVKLMMIDPKMVELNVYNGVPHLLTPVVTDPKKASQALKKVVSEMERRYELFAHSGTRNIE
FTSK_STAAN      SILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIVAEMERRYDLFQHSSTRNIK
FTSK_STAAM      SILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIVAEMERRYDLFQHSSTRNIK
FTSK_STAAW      SILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIVAEMERRYDLFQHSSTRNIK
FTSK_STAAS      SILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIVAEMERRYDLFQHSSTRNIK
FTSK_STAAC      SILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIVAEMERRYDLFQHSSTRNIK
FTSK_STAAR      SILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIVAEMERRYDLFQHSSTRNIK
FTSK_BACHD      SILLKAKPHEVKLMMIDPKMVELNVYNGIPHLLTPVVTEPKKASQALKKVVAEMERRYDLFSHSGTRNIE
FTSK_LACPL      GLLMNTKPSQVKFMLIDPKKVELGVYNGIPHLLTPVVTEPKKAARALHKVVAEMERRYELFADSKQRNMQ
FTSK_OCEIH      SILMRAKPHEVKMMMIDPKKVELNVYNGIPHLLAPVVTDPKKASRALKKVVAEMERRYDLFSETGTRNIE
FTSK_LISIN      SILLRAKPHEVKMMMIDPKMVELNVYNGIPHLLAPVVTNPXXXXXXXXXXXXEMERRYDLFSHTGTRNMQ
FTSK_LISMO      SILLRAKPHEVKMMMIDPKMVELNVYNGIPHLLAPVVTNPXXXXXXXXXXXXEMERRYDLFSHTGTRNMQ
FTSK_CAMJE      SLLYRNSPKTLRLMMIDPKMLEFSIYNDIPHLLTPVITDPKKAVNALSNMVAEMERRYRLMADAKTKNIE
FTSK_CAMJJ      SLLYRNSPKTLRLMMIDPKMLEFSIYNDIPHLLTPVITDPKKAVNALSNMVAEMERRYRLMADAKTKNIE
FTSK_STRR6      SILMKARPDQVKFMMVDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFAKVGVRNIA
FTSK_STRPN      SILMKARPDQVKFMMVDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFAKVGVRNIA
FTSK_TREPA      SILYHKCPDETKLLLIDPKIVELKLYNDIAHLLTPVITEPKRALQALQYILCEMERRYALLEQLECRDIK
FTSK_STAES      SILLNTKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKASQALEKIVSEMERRYDLFQHSSTRNIE
FTSK_STAEQ      SILLNTKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKASQALEKIVSEMERRYDLFQHSSTRNIE
FTSK_STRP8      SILMKARPDQVKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIE
FTSK_STRP3      SILMKARPDQVKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIE
FTSK_STRP1      SILMKARPDQVKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIE
FTSK_STRMU      SILMKARPDQIKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSHFGVRNIA
FTSK_STRP6      SILMKARPDQVKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIA
FTSK_STRA3      SILMKARPDQVKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIE
FTSK1_NEIMA     SMLFKATPDEVRFIMIDPKMLELSIYDGIPHLLCPVVTDMREAGQALNWCVAEMEKRYRLLSHAGVRNLE
FTSK_AGRT5      SLIYRMSPEQCRLIMIDPKMLELSIYDGIPHLLSPVVTDPKKAVVALKWTVREMEERYKKMSKIGVRNID
FTSK_STRA5      SILMKARPDQVKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIE
FTSK2_NEIMA     SMLFKAAPEDVRMIMIDPKMLELSIYEGIPHLLAPVVTDMKLAANALNWCVNEMEKRYRLMSFMGVRNLA
FTSK2_NEIMB     SMLFKAAPEDVRMIMIDPKMLELSIYEGIPHLLAPVVTDMKLAANALNWCVNEMEKRYRLMSFMGVRNLA
FTSK_PASMU      SLLFRVKPEEVKFIMIDPKVVELSIYDGIPHLLTEVVTDMKKAANALRWCVDEMERRYQLLSALRVRNIE
FTSK_XYLFT      SLLFKASHNDLRMLMIDPKMLELSVYQGIPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSAVGVRNLA
FTSK_XYLFA      SLLFKASHNDLRMLMIDPKMLELSVYQGIPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSVVGVRNLA
FTSK_LACLA      SILMKALPSQVKFLMVDPKMVELSVYNDIPHLLIPVVTNPRKASRALQKVVDQMEERYELFSRYGVRNIA
FTSKL_DEIRA     SLLYRYLPTELRFVMIDPKMVELTPYDGIPHLVRPVVTNPADXXXXXXXXXXHMERRYKMMSQVGAKNLE
FTSK_RHIME      SLLYRLRPDQCRLIMIDPKMLELSVYDGIPHLLSPVVTDPKKAVVALKWTVREMEERYKKMSKIGVRNID
FTSK_PSEPK      SILFKSSPEDARLIMIDPKMLELSIYEGIPHLLCPVVTDMKDAANALRWSVAEMERRYKLMAAMGVRNLA
FTSK_XANAC      SLLFKASHKELRMLMIDPKMLELSVYQGIPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSAVGVRNLA
FTSK_RHILO      SLLYRLTPQECRLIMIDPKMLELSVYDGIPHLLTPVVTDPKKAVVALKWTVREMEDRYRKMSKVGVRNID
FTSK_XANCP      SLLFKASHKELRMLMIDPKMLELSVYQGIPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSAVGVRNLA
FTSK1_NEIMB     SMLFKATPDEVRFIMIDPKMLELSIYDGIPHLLCPVVTDMREAGQALNWCVAEMEKRYRLLSHAGVRNLE
FTSK_SHEON      SLLYKSGPEDVRFIMIDPKMLELSVYEGIPHLLCEVVTDMKEAANALRWCVGEMERRYKLMSMMGVRNIK
FTSK_RICPR      SLLYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPSKAVIALKWAVKEMENRYRMMSNIGVKNIA
FTSK_ECOL6      SMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLA
FTSK_BIFLO      SIIMRATPEQVRLIMVDPKRVELSAYAGIPHLLTPIITDPKKAAQALEWVVKEMDARYSDLEFFGFRHVK
FTSK_HAEDU      SLLFKLTPEQVRFIMIDPKVVELSVYNDIPHLLTPVVTDMKKAANALRWAVGEMERRYLLISHLQVRNIE
FTSK_MYCTU      SLLTRATPEEVRMILIDPKMVELTPYEGIPHLITPIITQPKKAAAALAWLVDEMEQRYQDMQASRVRHID
FTSK_VIBCH      SMLYKASPEDVRFIMIDPKMLELSVYEGIPHLLAEVVTDMKDASNALRWCVGEMERRYKLMSVLGVRNIK
FTSK_RICCN      SLLYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPSKAVVALKWAVKEMENRYRMMSNIGVKNIA
FTSK_SHIFL      SMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLA
FTSK_ECOLI      SMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLA
FTSK_ECO57      SMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLA
FTSK_CORGL      SLLTRAKPEEVRLILVDPKMVELTPYEGIPHLITPIITQPKKAAAALQWLVEEMEQRYMDMKQTRVRHIK
FTSK_PSEU2      SILFKSGPEDAKLIMIDPKMLELSIYEGIPHLLCPVVTDMKDAANALRWSVAEMERRYKLMAKMGVRNLS
FTSK_RICTY      SLLYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPSKAVIALKWAVKEMENRYRMMSNIGVKNIA
FTSK_PSESM      SILFKSGPEDAKLIMIDPKMLELSIYEGIPHLLCPVVTDMKDAANALRWSVAEMERRYKLMAKMGVRNLS
FTSK_HAEIN      SLLYRVQPEDVKFIMIDPKVVELSVYNDIPHLLTPVVTDMKKAANALRWCVDEMERRYQLLSALRVRNIE
FTSK_BRAJA      SLVYRLRPDQCRLIMVDPKMLELSVYDGIPHLLTPVVTDPKKAVVALKWAVREMEERYKNMAKLGVRNID
FTSK_HELPY      SLLYKNPPDQLKLVMIDPKMVEFSIYADIPHLLTPIITDPKKAIGALQSVAKEMERRYSLMSEYKVKTID
FTSK_HELPJ      SLLYKNPPDQLKLVMIDPKMVEFSIYADIPHLLTPIITDPKKAIGALQSVAKEMERRYSLMSEYKVKTID
FTSK_BORBU      SIIFSKSPDEVKLIMIDPKIVELKLFNDIPHLLTPVITDVKRALEALRWCLDEMERRYVLLDNLLVRDIS
FTSK_RICFE      SLLYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPSKAVVALKWAVKEMENRYRMMSNIGVKNIA
FTSK_MYCLE      SLLTRSTPEEVRMILIDPKMVELTPYEGIPHLITPIITQPKKAAAALVWLVEEMEQRYQDMQASRVRHID
FTSK1_RALSO     SMLYKATPEDVRLIMIDPKMLELSVYEGIPHLLAPVVTDMKQAAHALNWCVGEMEKRYRLMSALGVRNLA
FTSK_SALTY      SMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSVNEMERRYKLMSALGVRNLA
FTSK_SALTI      SMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSVNEMERRYKLMSALGVRNLA
FTSK_YERPE      SILYKATPDDVRFIMIDPKMLELSVYEGIPHLLTGVVTDMKDAANALRWCVGEMERRYKLMSALGVRNLA
FTSK_STRAW      SVMVRATPEDVRMVLVDPKRVELTAYEGIPHLITPIITNPKRAAEALQWVVREMDLRYDDLAAFGYRHID
FTSK_BRUSU      SLLYRMTPQECRLIMIDPKMLELSVYDGIPHLLTPVVTDPKKAVVALKWTVREMEDRYRKMSKVGVRNID
FTSK_BRUME      SLLYRMTPQECRLIMIDPKMLELSVYDGIPHLLTPVVTDPKKAVVALKWTVREMEDRYRKMSKVGVRNID
FTSK2_RALSO     SLLYKARADAVRLILIDPKMLELSIYEGIPHLLCPVVTDMRQAGHALNWAVGEMERRYKLMSKMGVRNLA
FTSK_PSEAE      SILFKSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRLMAAMGVRNLA
FTSK_COXBU      SLLYKSTPQQLRLILIDPKMLELSVYEGIPHLLTPVVTDMKDAAAALRWCVVEMERRYRLMASLGVRNIL
FTSK_LEPIN      SLVVHLSPEEVRFIMIDPKMVELTLYEDIPHLLMPVITDPKKATRALAWAIQEMEARYHSVSKLKCRDFK
FTSK_LEPIC      SLVVHLSPEEVRFIMIDPKMVELTLYEDIPHLLMPVITDPKKATRALAWAIQEMEARYHSVSKLKCRDFK
FTSK_TROWT      SILLRAHPSQVRLVLIDPKRVELAIYSGVPHLITPIVTDPKKASEVLQWVVKEMERRYDDLASFGFRHID
FTSK_TROW8      SILLRAHPSQVRLVLIDPKRVELAIYSGVPHLITPIVTDPKKASEVLQWVVKEMERRYDDLASFGFRHID
FTSK_CHLTR      SLIMTSPPTDIKLVIVDPKKVELTGYSQLPHMLTPVITESKEAHSALIWLVREMELRYEILRFLGLRNIQ
FTSK_CHLMU      SLIMTSPPTDVKLVIVDPKKVELTGYSQLPHMLTPVITESKEAHSALIWLVREMELRYEILRFLGLRNIQ
FTSK_RICBR      SLLYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPXXXXXXXXXXXXEMENRYRMMSNIGVKNIA
FTSK_STRCO      SIMMRATPEDVRMILVDPKRVELTAYEGIPHLITPIITNPKRAAEALQWVVREMDLRYDDLAAYGYRHID
FTSK_CHLTE      SLLYSKKPDEVKFVLIDPKRVELKPYKLLKDHFLPIVTDPQKAVSALRSVVREMEHRYELLEQCGVRNIG
FTSK_VIBVU      SMLYKASPEDVRFIMIDPKMLELSVYEGIPHLLAEVVTDMKDASNALRWCVGEMERRYKLMSVMGVRNIK
FTSK_VIBPA      SMLYKASPEDLRFIMIDPKMLELSIYEGIPHLLAEVVTDMKDASNALRWCVGEMERRYKLMSALGVRNVK
FTSK_COREF      SLLTRATPEEVRLILVDPKMVELTPYEGIPHLITPIITQPKKAAAALQWLVEEMEQRYMDMKQTRVRHIK
FTSK_CAUCR      SILYKLPPEKCRFIMVDPKMLELSVYDGIPHLLAPVVTDPKKAVVALKWTVREMEDRYRRMSKIGVRNIG
FTSK_CHLPN      SMIMTTLPSEIKLVIIDPKKVELTGYSQLPHMLSPVITESREVYNALVWLVKEMESRYEILRYLGLRNIQ
FTSK_AZOBR      SLLYRLPPDRCRFIMIDPKMLELSVYEGIPHLLTPVVTDPKKAVVALKWTVREMEDRYRNMSKLGVRNIE
FTSKL_ANASP     YLVRRYPPSVVRLALSDVKRVTFGKFDGLPHLVAPVARDAESTANLLDYLVEEMELRYQEFRHSSIETIA
Y3709_CLOAB     GLAINFSPEDIGMLIIDWKGGGINTLDKLPHFMGSITNDGAGTARALASIKAEMDKRMKEFAKFGVNNIN
ESSC_STAAR      SLAINFHPHEVAFLLIDYKGGGMNLFKDLVHLVGTITNDGDEAMRALTSIKAELRKRQRLFGEHDVNHIN
ESSC_STAAN      SLAINFHPHEVAFLLIDYKGGGMNLFKDLVHLVGTITNDGDEAMRALTSIKAELRKRQRLFGEHDVNHIN
ESSC_STAAM      SLAINFHPHEVAFLLIDYKGGGMNLFKDLVHLVGTITNDGDEAMRALTSIKAELRKRQRLFGEHDVNHIN
ESSC_STAAW      SLAINFHPHEVAFLLIDYKGGGMNLFKDLVHLVGTITNDGDEAMRALTSIKAELRKRQRLFGEHDVNHIN
ESSC_STAAS      SLAINFHPHEVAFLLIDYKGGGMNLFKDLVHLVGTITNDGDEAMRALTSIKAELRKRQRLFGEHDVNHIN
ESSC_STAAE      SLAINFHPHEVAFLLIDYKGGGMNLFKDLVHLVGTITNDGDEAMRALTSIKAELRKRQRLFGEHDVNHIN
ESSC_STAAC      SLAINFHPHEVAFLLIDYKGGGMNLFKDLVHLVGTITNDGDEAMRALTSIKAELRKRQRLFGEHDVNHIN
YUKB_BACSU      SLAVHFHPHEAAFLLIDYKGGGMQPFRNIPHLLGTITNSKNFSMRALASIKSELKKRQRLFDQYQVNHIN
TRA_STRLI       E-GSEYA--DHRLVVVDPKRVEAINWQHRARTAISI----EDVLDVTDELVEEMHERLELIPRG------
YDCQ_BACSU      ACVGLGA--DVRIL--DPKNADLADLEEV--LPKKVYSQKNGILMCLRKSVDGMMERM-----DEMKQMS
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
HST6_CANAL      LYDIKISPD-------------------------------------------------------------
Y1934_STRMU     NI---YKGQAEGSLTIDGKVFDLSIYEK-SHLVSTVLQDP------------------------------
XRN2_YEAST      ----------------------------------------------------------------------
FLGE_BUCAI      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           SYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYICRLAQMARAAGMHLVIATQRPSVDVITGVI
FTSK_CLOPE      SYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYICRLAQMARAAGMHLVIATQRPSVDVITGVI
FTSK_CLOAB      GYNDLYTKNKVESKLPWIVIIIDELADLMMVCPNDVEDYIGRLAQMARAAGMHLVIATQRPSVDVITGVI
FTSK_CLOTE      SYNXXXXXXXXXXXXXXIVIVIDELADLMMVCPNDIEDYIGRLAQMARAAGMHLVIATQRPSVDVITGVI
FTSK_THETN      SYNEKYKE----ERLYKIVIIIDELSDLMMVSPAEVEEYIFRLAQMARAAGIHLVIATQRPSVDVITGVI
FTSK_SPOUR      GYNNHIEQDEKHPRMPYIVVIVDELADLMMVASSDVEDSITRLAQMARAAGIHLIIATQRPSVDVITGII
FTSK_BACSU      GYNANNEEGAKQPELPYIVVIVDELADLMMVASSDVEDSITRLSQMARAAGIHLIIATQRPSVDVITGVI
FTSK_BACAN      GYNDYINQSEAKQELPYIVVIVDELADLMMVASSDVEDAIMRLAQMARAAGIHLIIATQRPSVDVITGVI
FTSK_BACCR      GYNDYQSEAKQPE-LPYIVVIVDELADLMMVASSDVEDAIMRLAQMARAAGIHLIIATQRPSVDVITGVI
FTSK_STAAN      GYNELIRKQELDEKLPYIVVIVDELADLMMVAGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGII
FTSK_STAAM      GYNELIRKQELDEKLPYIVVIVDELADLMMVAGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGII
FTSK_STAAW      GYNELIRKQELDEKLPYIVVIVDELADLMMVAGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGII
FTSK_STAAS      GYNELIRKQELDEKLPYIVVIVDELADLMMVAGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGII
FTSK_STAAC      GYNELIRKQELDEKLPYIVVIVDELADLMMVAGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGII
FTSK_STAAR      GYNELIRKQELDEKLPYIVVIVDELADLMMVAGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGII
FTSK_BACHD      GYNEMITRQNEKETLPYIVVIVDELADLMMVASGDVEDSIARLAQMARAAGIHMILATQRPSVDVITGVI
FTSK_LACPL      GYNQYIRQGQSRPVLPYIVVVVDELADLMMVTSSEVEDAIIRLGQMARAAGIHMILATQRPSVDVITGLI
FTSK_OCEIH      GYNEYIRKQNLASELPYIVVLVDELADLMMVASNDVEDSITRLAQMARAAGIHLIIATQRPSVDVITGVI
FTSK_LISIN      GYNDYVKKHEKQPELPFIVVIVDELADLMMVASNDVEDAITRLAQMARAAGIHLIIATQRPSVDVITGVI
FTSK_LISMO      GYNDYVKKHEKQPELPFIVVIVDELADLMMVASNDVEDAITRLAQMARAAGIHLIIATQRPSVDVITGVI
FTSK_CAMJE      NYNEKM-KELGGEKLPFIVVIIDELADLMMTAGKDVEFYIGRLAQMARASGIHLIVATQRPSVDVVTGLI
FTSK_CAMJJ      NYNEKM-KELGGEELPFIVVIIDELADLMMTAGKDVEFYIGRLAQMARASGIHLIVATQRPSVDVVTGLI
FTSK_STRR6      GFNAKVEEFNSQSELPFIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK_STRPN      GFNAKVEEFNSQSELPFIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK_TREPA      TYNKIQEKSIATQPLPFIVIIIDEFADLMVASGKELETSVARLCAMSRAVGIHLVLATQRPSIDVITGLI
FTSK_STAES      GYNQYIRKEELDEKLPYIVVIVDELADLMMVAGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGII
FTSK_STAEQ      GYNQYIRKEELDEKLPYIVVIVDELADLMMVAGKEVENAIQRITQMARAAGIHLIVATQRPSVDVITGII
FTSK_STRP8      EFNASSEQKQIP--LPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK_STRP3      EFNASSEQKQIP--LPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK_STRP1      EFNASSEQKQIP--LPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK_STRMU      GYNAKFNRHSETKHLPLLVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK_STRP6      GYNTKFNASSEQKQIPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK_STRA3      EFNASSEQKQIP--LPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK1_NEIMA     GFNQKVDNPEPLEKLPMIVVVIDELADLMMTERKAVEQQIARLAQKARAAGIHMIVATQRPSVDVVTGLI
FTSK_AGRT5      GFNSALDKGEILTRLPYIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAAGIHVIMATQRPSVDVITGTI
FTSK_STRA5      EFNASSEQKQIP--LPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSK2_NEIMA     GFNQKIAEAEPLEKLPFIVVVVDEFADLMMTAGKKIEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK2_NEIMB     GFNQKIAEAEPLEKLPFIVVVVDEFADLMMTAGKKIEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK_PASMU      GYNEKIEEYEIPEKLSYIVVIVDEFADLMMVAGKQVEELIARLAQKARAIGIHLILATQRPSVDVITGLI
FTSK_XYLFT      GFNKKVDLSEVPQKLPFIVIFIDEFADMMMIVGKKVEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK_XYLFA      GFNKKVDLSEVPQKLPFIVIFIDEFADMMMIVGKKVEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK_LACLA      GYNEKVQRAESDEKLPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLI
FTSKL_DEIRA     QFNAMRAVGEV--ELPHLVIIIDELADLMITSPKEVESAIMRLAQMARATGMHLILATQRPSVDILTSLI
FTSK_RHIME      GFNSRVEKGEAITRMPYIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAAGIHVIMATQRPSVDVITGTI
FTSK_PSEPK      GFNPLYRRESMDDELPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLI
FTSK_XANAC      GFNKKVKDGEAPETLPFIVIFIDEFADMMMIVGKKVEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK_RHILO      GFNAAEKKGEKLEPMPYIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAAGIHVIMATQRPSVDVITGTI
FTSK_XANCP      GFNKKVKDGEAPETLPFIVIFIDEFADMMMIVGKKVEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK1_NEIMB     GFNQKVEAAKAAGKXXXXXXXXDELADLMMTERKAVEQQIARLAQKARAAGIHMIVATQRPSVDVVTGLI
FTSK_SHEON      GYNAKIAEAKVPEKLPSIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLI
FTSK_RICPR      GYNAKIQTGFDPEKLPYIVVIVDEMADLMLVSGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVI
FTSK_ECOL6      GYNEKIAEADVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLI
FTSK_BIFLO      DFNEAVRAGKVVAPYPYILVVVDEMADLMMVAKNDVESSIQRITQLARAAGVHLVLATQRPSVDVVTGLI
FTSK_HAEDU      GYNDKIDQGQLPTKLSYIVLIVDEFADLIMSAGKEVEEYIMRIAQKARAVGIHLILATQRPSTDVITGVI
FTSK_MYCTU      DFNDKVRSGAITAPLPYVVAIVDELADLMMTAPRDVEDAIVRITQKARAAGIHLVLATQRPSVDVVTGLI
FTSK_VIBCH      GFNPLWKDGDLLEKLPYIVVVVDEFADLMMVVGKKVEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK_RICCN      GYNAIYETVTMKEKLPYIVVIVDEMADLMLVAGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVI
FTSK_SHIFL      GYNEKIAEADVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLI
FTSK_ECOLI      GYNEKIAEADVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLI
FTSK_ECO57      GYNEKIAEADVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLI
FTSK_CORGL      DFNRKIKSGEIERAYPYIVCVVDELADLMMTAPKEIEESIVRITQKARAAGIHLVLATQRPSVDVVTGLI
FTSK_PSEU2      GFNSIHDEAPLLSKLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLI
FTSK_RICTY      GYNEKIQTGFDPEKLPYIVVIVDEMADLMLVSGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVI
FTSK_PSESM      GFNSIHDEAPLLTKLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLI
FTSK_HAEIN      GFNEKIDEYEVPKKLSYIVVIVDEFADLMMVAGKQIEELIARLAQKARAIGIHLILATQRPSVDVITGLI
FTSK_BRAJA      GYNTLKAKGEEPDPLPYIVIIVDEMADLMMVAGKDIEGAVQRLAQMARAAGLHVILATQRPSVDVITGTI
FTSK_HELPY      SYNEQAPSNGV-EAFPYLIVVIDELADLMMTGGKEAEFPIARIAQMGRASGLHLIVATQRPSVDVVTGLI
FTSK_HELPJ      SYNEQAQSNGV-EAFPYLIVVIDELADLMMTGGKEAEFPIARIAQMGRASGLHLIVATQRPSVDVVTGLI
FTSK_BORBU      SYNKKIKDENLNLMLPYLVIIIDEFADLILSARKDLENLISRLAAMARAVGIHLVLATQRPSVDVITGVI
FTSK_RICFE      GYNAIYETVTMMEKLPYIVVIVDEMADLMLVAGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVI
FTSK_MYCLE      VFNEKVRSGEITAPLPYILAIVDELADLMMTAPRDVEDAIVRITQKARAAGIHLVLATQRPSVDVVTGLI
FTSK1_RALSO     GYNAAQQAGDAPETLPMIVVVIDELADLMMVAGKKIEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK_SALTY      GYNPYWKPGDVLEKLPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLI
FTSK_SALTI      GYNPYWKPGDVLEKLPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLI
FTSK_YERPE      GYNERVAQAEIPDKLPYIVVMVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLI
FTSK_STRAW      DFNEAIRNGKVPEPYPYLLVIVDELADLMMVAPRDVEDAIVRITQLARAAGIHLVLATQRPSVDVVTGLI
FTSK_BRUSU      GFNAIYETEELDEPMPYIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAAGIHVIMATQRPSVDVITGTI
FTSK_BRUME      GFNAIYETEELDEPMPYIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAAGIHVIMATQRPSVDVITGTI
FTSK2_RALSO     GFNXXXDAPEPLDKLPMIVIVIDELADLMMVVGKKVEELIARIAQKARAAGIHLVLATQRPSVDVITGLI
FTSK_PSEAE      GFNRKVKDAEEASTLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLI
FTSK_COXBU      GYNAKVKEGKPPEELPQLVVIADEFADMMVVVGKKVETLIVRLAQKARAAGIHLIFATQRPSVDVITGLI
FTSK_LEPIN      TYNEKVEQGDGYKKMPYIVIFIDELADLMMVSGKDLEDAITRITQKSRAVGIHLIMATQRPSVDVITGLI
FTSK_LEPIC      TYNEKVEQGDGYKKMPYIVIFIDELADLMMVSGKDLEDAITRITQKSRAVGIHLIMATQRPSVDVITGLI
FTSK_TROWT      DFNLAVRAKKIASDYPYLLVIVDELADLMLVAAKDVEESIVRITQLARASGIHIVLATQRPSVNVVTGLI
FTSK_TROW8      DFNLAVRAKKIASDYPYLLVIVDELADLMLVAAKDVEESIVRITQLARASGIHIVLATQRPSVNVVTGLI
FTSK_CHLTR      SFNASYDK-EISEKMPFIVGIIDEXXXXXXXXXHDIETPIVRLAQMARAVGIHLILATQRPSRDVITGLI
FTSK_CHLMU      SFNASYDK-EIPEKMPFIVGIIDEXXXXXXXXXHDIETPIVRLAQMARAVGIHLILATQRPSRDVITGLI
FTSK_RICBR      GYNTAVKEGRIMEKLPFIAVIVDEMADLMLVAGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVI
FTSK_STRCO      DFNRAVREGKVKQPYPYLLVIVDELADLMMVAPRDVEDAIVRITQLARAAGIHLVLATQRPSVDVVTGLI
FTSK_CHLTE      EYNRKMKD----EAMFYLVVVVDELADLMITAGREVEEPITRLAQMARAVGIHLIVATQRPSVDIITGII
FTSK_VIBVU      GFNPFWQEGDLLEKLPYIVVVVDEFADLMMVVGKKVEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK_VIBPA      GFNPFWQEGDLLEKLPYIVVVVDEFADLMMVVGKKVEELIARLAQKARAAGIHLILATQRPSVDVITGLI
FTSK_COREF      DFNRKIKSGEIETPLPYIICVVDELADLMMTAPKEIEESIVRITQKARAAGIHLVLATQRPSVDVVTGLI
FTSK_CAUCR      GYRPIYETEQIPEPMPYLVVVIDEVADLMMVAGKDIEGAVQRLAQMARAAGIHLIMATQRPSVDVITGTI
FTSK_CHLPN      AFNASYDR-EIRETMPFMVGIIDEXXXXXXXXXQDIETPIIRLAQMARAVGIHLILATQRPSREVITGLI
FTSK_AZOBR      GYNARLREARADKELPYIVVIVD-----------------------------------------------
FTSKL_ANASP     QYNSRFAPDCI---MPRVICLIDECFDLLSDDNYRIETXXXXXXXXXXXXXIHVLLYTQRPDKNVIDPLI
Y3709_CLOAB     GYMSLYKSTKYPEKIPHLILVSDEFAELKSNVP-EFLDELTSVARIGRSLGVHLILATQKPS-GVVNDQI
ESSC_STAAR      QYHKLFKEGVATEPMPHLFIISDEFAELKSEQPDFMKELV-STARIGRSLGIHLILATQKPS-GVVDDQI
ESSC_STAAN      QYHKLFKEGVATEPMPHLFIISDEFAELKSEQPDFMKELV-STARIGRSLGIHLILATQKPS-GVVDDQI
ESSC_STAAM      QYHKLFKEGVATEPMPHLFIISDEFAELKSEQPDFMKELV-STARIGRSLGIHLILATQKPS-GVVDDQI
ESSC_STAAW      QYHKLFKEGIATEPMPHLFIISDEFAELKSEQPDFMKELV-STARIGRSLGIHLILATQKPS-GVVDDQI
ESSC_STAAS      QYHKLFKEGIATEPMPHLFIISDEFAELKSEQPDFMKELV-STARIGRSLGIHLILATQKPS-GVVDDQI
ESSC_STAAE      QYHKLFKEGIATEPMPHLFIISDEFAELKSEQPDFMKELV-STARIGRSLGIHLILATQKPS-GVVDDQI
ESSC_STAAC      QYHKLFKEGIATEPMPHLFIISDEFAELKSEQPDFMKELV-STARIGRSLGIHLILATQKPS-GVVDDQI
YUKB_BACSU      DYTKLYKQGKAEVAMPHLFLISDEFAELKSEEPDFIRELV-SAARIGRSLGVHLILATQKPG-GIIDDQI
TRA_STRLI       -----QDVIQISPERPRITVFIDEGAEVIAMAPGDIMENLSTLARMARAAEIILIWATQKPTMDAKGGII
YDCQ_BACSU      NYKTGENYAYL--GLKPVFIFFDEYVAFMMKERNEALSYMKQLVMLGRQAGYFLVLGAQRPDAKYLADGI
CAPP_METEA      ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
HST6_CANAL      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      ----------------------------------------------------------------------
FLGE_BUCAI      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           KANIPSRISFAVSSQIDSRTILDSAGAEKLLGRGDMLFYPVGESKPQRVQGAFISEEEVEHVVSFIKESQ
FTSK_CLOPE      KANIPSRISFAVSSQIDSRTILDSAGAEKLLGRGDMLFYPVGESKPQRVQGAFISEEEVEHVVSFIKESQ
FTSK_CLOAB      KANIPSRISFAVSSQIDSRTILDTSGAEKLLGKGDMLFNPVGESKPIRIQGAFINEEEVERVVGFIRNES
FTSK_CLOTE      KANIPSRISFAVSSQIDSRTILDMGGAEKLLGKGDMLFYPSGESKPMRVQGAFISEEEVEKVVGFIKEKQ
FTSK_THETN      KANIPSRISFAVSSQIDSRTILDMTGAEKLLGKGDMLFDPIGASKPIRVQGAFISEEEVEAVVNFLKENY
FTSK_SPOUR      KANIPSRIAFAVSSAIDSRTILDGAGAEKLLGRGDMLFLPAGASKPTRIQGAFVSDEEVEAVVNFVIEQQ
FTSK_BACSU      KANIPSRIAFSVSSQTDSRTILDMGGAEKLLGRGDMLFLPVGANKPVRVQGAFLSDDEVEKVVDHV-ITQ
FTSK_BACAN      KANIPSRIAFAVSSQTDSRTILDGGGAEKLLGRGDMLFIPIGASKPVRVQGAFLSDDEVERVVEYV-IGQ
FTSK_BACCR      KANIPSRIAFAVSSQTDSRTILDGGGAEKLLGRGDMLFIPIGASKPVRVQGAFLSDDEVERVVEYV-IGQ
FTSK_STAAN      KNNIPSRIAFAVSSQTDSRTIIGTGGAEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVE-Q
FTSK_STAAM      KNNIPSRIAFAVSSQTDSRTIIGTGGAEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVE-Q
FTSK_STAAW      KNNIPSRIAFAVSSQTDSRTIIGTGGAEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVE-Q
FTSK_STAAS      KNNIPSRIAFAVSSQTDSRTIIGTGGAEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVE-Q
FTSK_STAAC      KNNIPSRIAFAVSSQTDSRTIIGTGGAEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVE-Q
FTSK_STAAR      KNNIPSRIAFAVSSQTDSRTIIGTGGAEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVE-Q
FTSK_BACHD      KANIPSRIAFGVSSQTDSRTILDTGGAEKLLGRGDMLYLPMGATKPTRVQGAFLSDEEVETIVEFV-VAQ
FTSK_LACPL      KANVPSRMAFAVSSGTDSRTIIDSNGAEKLLGRGDMLYQPMGMNKPLRVQGAYISDHDVEEVVNFIK-AQ
FTSK_OCEIH      KANIPSRIAFSVSSATDSRTILDSGGAEKLLGRGDMLFMPVGSSKPTRVQGAFLSDEEVERIVDHCVEQQ
FTSK_LISIN      KANIPSRIAFAVSSSIDSRTILDMGGAEKLLGRGDMLLLPVGSSKPTRIQGAFLSDKEVEDVVNYV-ISQ
FTSK_LISMO      KANIPSRIAFAVSSSIDSRTILDMGGAEKLLGRGDMLLLPVGSSKPTRIQGAFLSDAEVEDVVNYV-ISQ
FTSK_CAMJE      KANLPSRISYKVGQKIDSKVILDAMGAESLLGRGDCLFTPPGTSSIVRLHAPFASEFEIEKIVDFLKD-Q
FTSK_CAMJJ      KANLPSRISYKVGQKIDSKVILDAMGAESLLGRGDCLFTPPGTSSIVRLHAPFASEFEIEKIVDFLKD-Q
FTSK_STRR6      KANVPSRVAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIK-TQ
FTSK_STRPN      KANVPSRVAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIK-TQ
FTSK_TREPA      KANIPSRIAFMVSSKMDSRIILDEMGAEKLLGRGDMLYMNPSQSFPTRIQGAYVSERELARVIAHVRAWG
FTSK_STAES      KNNIPSRIAFAVSSQTDSRTXXXXXXXXXXXXXXDMLYVGNGESTTTRIQGAFLSDQEVQDVVNYVVEQQ
FTSK_STAEQ      KNNIPSRIAFAVSSQTDSRTXXXXXXXXXXXXXXDMLYVGNGESTTTRIQGAFLSDQEVQDVVNYVVEQQ
FTSK_STRP8      KANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIKD-Q
FTSK_STRP3      KANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIKD-Q
FTSK_STRP1      KANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIKD-Q
FTSK_STRMU      KANVPSRIAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVSFIKE-Q
FTSK_STRP6      KANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIKD-Q
FTSK_STRA3      KANVPSRIAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVGFIKD-Q
FTSK1_NEIMA     KANIPTRMAFTVQSKIDSRTILDQMGADELLKYGDSLFLQPGSAEPTRLQGAFVSDDEVHHVVAFVKE-Q
FTSK_AGRT5      KANFPTRISFQVTSKIDSRTILGEQGAEQLLGMGDML-YMAGGGRIQRVHGPFVSDNEVEEIVAYLK-TQ
FTSK_STRA5      KANVPSRIAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVGFIKD-Q
FTSK2_NEIMA     KANIPTRIAFQVSSKIDSRTILDQMGAENLLGQGDMLFLPPGTAYPQRVHGAFASDEEVHRVVEYLKQF-
FTSK2_NEIMB     KANIPTRIAFQVSSKIDSRTILDQMGAENLLGQGDMLFLLPGTAYPQRVHGAFASDEEVHRVVEYLKQF-
FTSK_PASMU      KANIPSRIAFTVASKIDSRTILDQVGAEALLGRGDMLYSGAGSSDLVRVHGAFMSDDEVARVVDDWK-AR
FTSK_XYLFT      KANIPTRIAFQVSSKIDSRTILDQSGAETLLGHGDMLYLPPGTAMPERVHGAFVSDDEVHRVVEYLKAS-
FTSK_XYLFA      KANIPTRIAFQVSSKIDSRTILDQSGAETLLGHGDMLYLPPGTAMPERVHGAFVSDDEVHRVVEYLKAS-
FTSK_LACLA      KANVPSRIAFAVSSGTDSRTILDTNGAEKLLGRGDMLFKPIDENHPIRLQGAFLSDDDVESVVTFIKD-Q
FTSKL_DEIRA     KVNIPARIAFAVSSSHDSRTILDTTGAERLTGMGDMLFYQPGLVKPLRLQGPYISEAESAR----ITDEL
FTSK_RHIME      KANFPTRISFQVTSKIDSRTILGEQGAEQLLGMGDML-YMAGGGRIQRVHGPFVSDTEVEEVVAYLK-TQ
FTSK_PSEPK      KANIPTRMAFQVSSKIDSRTIIDQGGAEQLLGHGDMLYMPPGTSLPIRVHGAFVSDDEVHRTVEAWK-LR
FTSK_XANAC      KANIPTRVAFQVSSKIDSRTILDQSGAEALLGNGDMLYLPPGTALPDRVHGAFVSDEEVHRVVEHLKAS-
FTSK_RHILO      KANFPTRISFQVTSKIDSRTILGEQGAEQLLGMGDML-YMAGGGRIQRVHGPFVSDDEVEKIVGHLK---
FTSK_XANCP      KANIPTRVAFQVSSKIDSRTILDQSGAEALLGNGDMLYLPPGTALPDRVHGAFVSDEEVHRVVEHLKASG
FTSK1_NEIMB     KANIPTRMAFTVQSKIDSRTILDQMGADELLKYGDSLFLQPGSAEPTRLQGAFVSDDEVHQVVNYVK-SQ
FTSK_SHEON      KANIPTRMAFQVSSRIDSRTILDQQGAETLLGMGDMLYLPPGTAVPNRVHGAFIDDHEVHRVVADWC-AR
FTSK_RICPR      KANFPSRISFKVTSKIDSRTILGEQGSEQLLGMGDMLFMG-NTSKISRVHGPFVNEAEIAKITEYLKETS
FTSK_ECOL6      KANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARG
FTSK_BIFLO      KANIPSRLAFATSSATDSRVILDTVGAETLIGQGDALFLPMGSAKPIRVQGSWVSESEIRKAVEFVR-TQ
FTSK_HAEDU      KANIPSRIAFTVASQIDSRTILDAGGAEALLGRGDMLYSASGSPEIMRIHGAFMSDEEVQRIADNWRARG
FTSK_MYCTU      KTNVPSRLAFATSSLTDSRVILDQAGAEKLIGMGDGLFLPMGASKPLRLQGAYVSDEEIHAVVTACKE-Q
FTSK_VIBCH      KANIPTRVAFTVSTKTDSRTILDQSGAESLLGMGDMLYLPAGSSHTIRVHGAFASDDDVHAVVNNWK-AR
FTSK_RICCN      KANFPSRISFKVTSKIDSRTILGEQGSEQLLGMGDMLFMG-STSKISRVHGPFVNEAEIEQITEYLKES-
FTSK_SHIFL      KANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARG
FTSK_ECOLI      KANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARG
FTSK_ECO57      KANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARG
FTSK_CORGL      KTNVPSRLAFATSSLTDSRVILDQGGAEKLIGMGDALFIPQGAGKPQRIQGAFVTDEEIQAVVDMAK-AQ
FTSK_PSEU2      KANIPTRMAFQVSSKIDSRTIIDQGGAEQLLGHGDMLYMPPGTSLPIRVHGAFVSDEEVHRVVEAWK-LR
FTSK_RICTY      KANFPSRISFKVTSKIDSRTILGEQGSEQLLGMGDMLFMG-NTSKISRVHGPFVNEAEITKITEYLKETS
FTSK_PSESM      KANIPTRMAFQVSSKIDSRTIIDQGGAEQLLGHGDMLYMPPGTSLPIRVHGAFVSDEEVHRVVEAWK-LR
FTSK_HAEIN      KANIPSRIAFTVASKIDSRTILDQGGAEALLGRGDMLYSGQGSSDLIRVHGAYMSDDEVINIADDWR-AR
FTSK_BRAJA      KANFPTRIAFQVTSKIDSRTILGEMGAEQLLGQGDML-YMAGGGRISRVHGPFASDDEVEKVVRHLK-TQ
FTSK_HELPY      KTNLPSRVSFRVGTKIDSKVILDTDGAQSLLGRGDMLFTPPGANGLVRLHAPFATEDEIKKIVDFIK-AQ
FTSK_HELPJ      KTNLPSRVSFRVGTKIDSKVILDTDGAQSLLGRGDMLFTPPGTNGLVRLHAPFATEDEIKKIVDFIK-AQ
FTSK_BORBU      KANFPSRISFMVASSMDSRIILGSSGAEKLLGKGDMLYISSLNPFPXRIQGGFLKEREVYRLVEEVKKFG
FTSK_RICFE      KANFPSRISFKVTSKIDSRTILGEQGSEQLLGMGDMLFMG-NTSKISRVHGPFVNEAEIEKITEYLKET-
FTSK_MYCLE      KTNVPSRLAFATSSLTDSRVILDQAGAEKLIGMGDGLFLPMGASKPVRLQGAFITDEEIHAVVTACKD-Q
FTSK1_RALSO     KANIPTRVAFQVSSKIDSRTILDQMGAETLLGQGDMLFLPPGTGYPQRVHGAFVADEEVHRVVEHWKQF-
FTSK_SALTY      KANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRVHGAFVRDQEVHAVVQDWKARG
FTSK_SALTI      KANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRVHGAFVRDQEVHAVVQDWKARG
FTSK_YERPE      KANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYMAPNSSIPVRVHGAFVRDQEVHAVVNDWKARG
FTSK_STRAW      KANVPSRLAFATSSLADSRVILDQPGAEKLIGKGDGLFLPMGANKPTRMQGAFVTEDEVEAVVQHCKD-Q
FTSK_BRUSU      KANFPTRISFQVTSKIDSRTIXXXXXXXXXXXXXDMLFM-AGGGRIQRVHGPFVGDDEVERIVQHLK-LQ
FTSK_BRUME      KANFPTRISFQVTSKIDSRTIXXXXXXXXXXXXXDMLFM-AGGGRIQRVHGPFVGDDEVERIVQHLK-LQ
FTSK2_RALSO     KANVPTRIAFQVSSKIDSRTILDQQGAEALLGMGDMLYLAPGTGLPVRVHGAFVSDDEVHRVVENLK-SQ
FTSK_PSEAE      KANIPTRIAFQVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWK-LR
FTSK_COXBU      KANIPTRVAFQVSSKIDSRTILDQQGAEQLLGHGDLLYLAPGSGVPVRVHGPYVKDEEVHRVAEYLRESS
FTSK_LEPIN      KANCPARMAFHVAQKTDSKIILDQNGAESLLGKGDFLYKSPTAADLIRIQSPYVSXXXXXXXXXXARKFG
FTSK_LEPIC      KANCPARMAFHVAQKTDSKIILDQNGAESLLGKGDFLYKSPTAADLIRIQSPYVSXXXXXXXXXXARKFG
FTSK_TROWT      KANVPSRLAFAVSSLVDSRVILDRPGAEKLVGQGDGLFLPISAGKPIRIQSSWVTENEILRVVEYVKSQA
FTSK_TROW8      KANVPSRLAFAVSSLVDSRVILDRPGAEKLVGQGDGLFLPISAGKPIRIQSSWVTENEILRVVEYVKSQA
FTSK_CHLTR      KANFPSRIAFKVANKVNSQIIIDEPGAENLMGNGDMLVVSPGSFAPVRVQGAYICDDDINKVIKDLC-SR
FTSK_CHLMU      KANFPSRIAFKVANKVNSQIIIDEPGAENLMGNGDMLVVSPGSFAPLRVQGAYICDDDINKVIKDLC-SR
FTSK_RICBR      KANFPSRISFKVTSKIDSRTILGEQGSEQLLGMGDMLFMG-NTSKITRVHGPFVNESEIEQITEYLKET-
FTSK_STRCO      KANVPSRLAFATSSLADSRVILDQPGAEKLIGKGDGLFLPMGANKPTRMQGAFXXXXXXXXXXQHCKD-Q
FTSK_CHLTE      KANFPSRIAFQVASKVDSRTILDVSGAEQLLGSGDMLFQSAKMSKPQRIQCPYISLSEVDAITEFIGQ-Q
FTSK_VIBVU      KANIPTRVAFTVSTKTDSRTILDQGGAESLLGMGDMLYLPPGSSHTIRVHGAFASDDDVHAVVNNWK-AR
FTSK_VIBPA      KANIPTRVAFTVSTKTDSRTILDQGGAESLLGMGDMLYLPPGSSHTIRVHGAFASDDDVHAVVNNWK-AR
FTSK_COREF      KTNVPSRLAFATSSLTDSRVILDQGGAEKLIGMGDALFIPQGAGKPQRIQGAFVT-DXXXXXXXXXXXXX
FTSK_CAUCR      KANFPTRISFQVTSKIDARTIXXXXXXXXXXXXXDML-YMAGGGRITRLHGPFVSDGEVEAVARFLRD-Q
FTSK_CHLPN      KANFPSRISFKVSNKVNSQIIIDEPGAENLMGNGDMLVLLPSVFGTIRAQGAYICDEDINKVIQDLC-SR
FTSK_AZOBR      ----------------------------------------------------------------------
FTSKL_ANASP     RSNFPAKTAFVTTRPEDSCIILKDKRAVYLLGYGDFLY---KTTEVLRLQALYVADDE------------
Y3709_CLOAB     EANSTSKIALKMASEQDSNELLKTHDAAHITGRG---YIKVGENE-------------------------
ESSC_STAAR      WSNSKFKLALKVQDRQDSNEILKTPDA-------------------------------------------
ESSC_STAAN      WSNSKFKLALKVQDRQDSNEILKTPDA-------------------------------------------
ESSC_STAAM      WSNSKFKLALKVQDRQDSNEILKTPDA-------------------------------------------
ESSC_STAAW      WSNSKFKLALKVQDRQDSNEILKTPDA-------------------------------------------
ESSC_STAAS      WSNSKFKLALKVQDRQDSNEILKTPDA-------------------------------------------
ESSC_STAAE      WSNSKFKLALKVQDRQDSNEILKTPDA-------------------------------------------
ESSC_STAAC      WSNSKFKLALKVQDRQDSNEILKTPDA-------------------------------------------
YUKB_BACSU      WSNSRFKVALKVQDATDSKEILKNSDAANITGRG------------------------------------
TRA_STRLI       SAQITYRAALALSTSGESRVVFGEDATEK-----------------------------------------
YDCQ_BACSU      RDQFSFRVSLGLMS--------------------------------------------------------
CAPP_METEA      ----------------------------------------IAAQPPGSIQGRFRITEQGE-VVSFKYANR
RAD50_PYRHO     ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
HST6_CANAL      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      ----------------------------------------------------------------------
FLGE_BUCAI      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           RDAQYEEDILEHINSATIASEGNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE
FTSK_CLOPE      RDAQYEEDILEHINSATIASEGNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE
FTSK_CLOAB      TETQYKEEIIEQINS----NVSKSXXXXXXXXXXXXXXXXXTKQASTSLIQRKLRIGYNRAARIMDQLEE
FTSK_CLOTE      GEVEYEDSIIDEINTSI---EINNE-DRDELLEEAIKIVVDVDQASTSLLQRKLRIGYNRAARIMDQMEE
FTSK_THETN      -SSHYEEIKVEEKTNGK-----NXXXXXXXXXXXAVSVILETGQASISLLQRKLRIGYARAARIIDQLEQ
FTSK_SPOUR      K-AQYQEEMIPTEVEVVAPHE-----ETDELYDEAVQMVVDMQTASVSMIQRRFRVGYARAARIVDQMEA
FTSK_BACSU      QKAQYQEEMIPEETTETHSEV------TDELYDEAVELIVGMQTASVSMLQRRFRIGYTRAARLIDAMEE
FTSK_BACAN      QKAQYQEDMIPQDVPDTKQEV------EDELYDEAVQLVVEMQTASVSMLQRRFRVGYTRAARLIDAMEM
FTSK_BACCR      QKAQYQEDMIPQDVLDTKQEV------EDELYDEAVQLVVEMQTASVSMLQRRFRVGYTRAARLIDAMEM
FTSK_STAAN      QQANYVKEMEPDVDKSEMKSE-------DALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLER
FTSK_STAAM      QQANYVKEMEPDVDKSEMKSE-------DALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLER
FTSK_STAAW      QQANYVKEMEPDVDKSEMKSE-------DALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLER
FTSK_STAAS      QQANYVKEMEPDVDKSEMKSE-------DALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLER
FTSK_STAAC      QQANYVKEMEPDVDKSEMKSE-------DALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLER
FTSK_STAAR      QQANYVKEMEPDVDKSEMKSE-------DALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLER
FTSK_BACHD      QKAQYA------XXXXXXXXXXXXXXXXXXLYDDAVNLVIEMNSASVSMLQRRFRIGYTRAARLIDEMEA
FTSK_LACPL      QTADYDDSMLVKDDETDAAGSGDPRDGEDEYYAEAVELVTDQQSASVSMLQRRFRIGYNRAARIVDEMEE
FTSK_OCEIH      K-ATYQEEMI------PXXXXXXXXXXXXXXXXXXXQLISEMQSASVSMLQRRFRIGYTRAARLIDAMED
FTSK_LISIN      QKAQYNEEMI-----PDDIPEVEGE-VTDELYHEAVELVVEMQTASVSMLQRKFRIGYNRAARLIDEMEQ
FTSK_LISMO      QKAQYSEEMI-----PDDIPEVEGE-VTDELYHEAVELVVEMQTASVSMLQRKFRIGYNRAARLIDEMEQ
FTSK_CAMJE      QSVEYDESFLKDQQSVGVTTNESFDGEADELYEEAKRVILEDGKTSISYLQRRLKIGYNRSANIIEQLTQ
FTSK_CAMJJ      QSVEYDESFLKDQQSVGVTTNESFDGEVDELYEEAKRVILEDGKTSISYLQRRLKIGYNRSANIIEQLTQ
FTSK_STRR6      ADADYDESFDPGEVSENEGEFSDGDAGGDPLFEEAKSLVIETQKASASMIQRRLSVGFNRATRLMEELEI
FTSK_STRPN      ADADYDESFDPGEVSENEGEFSDGDAGGDPLFEEAKSLVIETQKASASMIQRRLSVGFNRATRLMEELEI
FTSK_TREPA      TPEYLDEEIFFDDDDASIS--GNFVDESDPLYEQAVQVVQYAGKASTSYVQRKLKIGYNRAARLIEEMEA
FTSK_STAES      K-ANYVKEMEPDVDKSEMKSE-------DALYDEAYLFVIEKQKASTSLLQRQFRIGYNRASRLMDDLER
FTSK_STAEQ      K-ANYVKEMEPDVDKSEMKSE-------DALYDEAYLFVIEKQKASTSLLQRQFRIGYNRASRLMDDLER
FTSK_STRP8      AEADYDDDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLETQKASASMIQRRLSVGFNRATRLMDELEE
FTSK_STRP3      AEADYDDDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLETQKASASMIQRRLSVGFNRATRLMDELEE
FTSK_STRP1      TEADYDDDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLETQKASASMIQRRLSVGFNRATRLMDELEE
FTSK_STRMU      AEADYDESFPGEVXXXXXXXXXXXXXXXXPLFEDAKALVLETQKASASMLQRRLSVGFNRATRLMEELEE
FTSK_STRP6      AEADYDDDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLETQKASASMIQRRLSVGFNRATRLMDELEE
FTSK_STRA3      AEADYDDDPGEVSETDNXXXXXXXVPESDPLFEEAKGLVLETQKASASMIQRRLSVGFNRATRLMEELEA
FTSK1_NEIMA     APANYVEGLLTGEAAQETANIVSPNADSDELFDQAVAYVLESKKTSISSLQRQLRIGYNRAANLMEALEN
FTSK_AGRT5      GSPEYLEAITEEEDEDGAGSGPAGAGDSEDPYDQAVAVVLRDGKASTSYVQRRLGIGYNRAASLIERMEQ
FTSK_STRA5      AEADYDDDPGEVSETDNXXXXXXXVPESDPLFEEAKGLVLETQKASASMIQRRLSVGFNRATRLMEELEA
FTSK2_NEIMA     GEPDYVDDILSGMSDDLLGISRSGDGETDPMYDEAVSVVLKTRKASISGVQRALRIGYNRAARLIDQMEA
FTSK2_NEIMB     GEPDYVDDILSGGGSEELPGIGSGDDETDPMYDEAVSVVLKTRKASISGVQRALRIGYNRAARLIDQMEA
FTSK_PASMU      GKPNYIEGILDSEDEATESNGANSDGELDDLFDEVVEFVTSTGTTSTSYIQRKFRVGFNRAARIMDQLEE
FTSK_XYLFT      APVQYVDGVLDEIQTAGFPESASGGGDEDPLYDEALRIVTETRRASISSVQRRLRIGYNRAARLIEAMET
FTSK_XYLFA      APVQYVDGVLDEIQTAGFPESASGGGDEDPLYDEALRIVTETRRASISSVQRRLRIGYNRAARLIEAMET
FTSK_LACLA      SEAQYDESFPGEVDESQVGTGASNTGSGDPLFEEARNMVIMAQKASTAQLQRALKVGFNRASDLMNELEA
FTSKL_DEIRA     RRMMFDDDFIEAYGAGMISSSGPG-GDRDPLLRQAALVCIEEGQGSVSRLQRRLSVGHARAGKLMDLLEA
FTSK_RHIME      GVPQYLDAITXXXXXXXXXXXPAGTADSEDPYDQAVAIVLRDGKASTSYVQRRLGIGYNRAASLIERMEQ
FTSK_PSEPK      GAPDYNDDILNXXXXXXXXXXXXXXXXXXXLYDEAVQFVLESRRASISAVQRKLKIGYNRAARMIESMEM
FTSK_XANAC      GPVSYVEGVLDEVQTM-------GDGXXXXXYDEALRIVTETRRASISGVQRRLKIGYNRAARLIEAMEA
FTSK_RHILO      -----LQGVPEYLDAITXXXXXXXXXDSDDPYDQAVAVVLRDGKASTSYIQRRLGIGYNRAASIIEKMEK
FTSK_XANCP      PVA-YVDGVLDEVQTM-------GDGXXXXXYDEALRIVTETRRASISGVQRRLKIGYNRAARLIEAMEA
FTSK1_NEIMB     APADYIEGLLSGEAALETANIVNPNADSDELFDQAVAYVLESKKTSISSLQRQLRIGYNRAANLMEALEN
FTSK_SHEON      GKPQYIDEILNGVSEGLPGETAESDEEYDPLYDEAVAFVTETRRGSISSVQRKFKIGYNRAARIIEQMEM
FTSK_RICPR      MPV--------YISAVTEQPEENGDGSIDEVLKKAVQIVRNERKSSISYIQRSLRIGYNKAANLVEKMEK
FTSK_ECOL6      R-PQYVDGITSDSESEGGVGGFDGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEA
FTSK_BIFLO      RKPKYREDIEQMAKEAEKKDSMEPDGDDMDVLLQAAELVVTSQFGSTSMLQRKLRVGFAKAGRLMDLLES
FTSK_HAEDU      KPQYLDSVVASHEDEND--SRTNTITELDPLFDEIVAYVIESGVTSISGIQRRFSLGFNRAGRIIDQMEA
FTSK_MYCTU      AEPEYTEGVTTAKPTAERTXXXXXXXXXXXVFLQAVELVVSSQFGSTSMLQRKLRVGFAKAGRLMDLMET
FTSK_VIBCH      GKPNYISEIIDHGPEALLPGESESDEELDPLFDQVVEHVVETRRGSVSGVQRRFKIGYNRAARIVEQLEA
FTSK_RICCN      GTPEYISAVTEQPXXXXXXXXXXXXXXXXVLYKKAVQIVRDERKSSISYIQRSLRIGYNKAANLVEKMEK
FTSK_SHIFL      R-PQYVDGITXXXXXXXXXXXXXXXXXLDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEA
FTSK_ECOLI      R-PQYVDGITXXXXXXXXXXXXXXXXXLDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEA
FTSK_ECO57      R-PQYVDGITXXXXXXXXXXXXXXXXXLDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEA
FTSK_CORGL      RQPEYTDGVTE--DKASEAKKIDADGNXXXXXXXXXXXXXTSQMGSTSMLQRKLRIGFAKAGRLMDLMET
FTSK_PSEU2      GSPDYNDDILAGVXXXXXXXXXXXXXXXXALYDEAVKFVLESRRASISAVQRKLKIGYNXXXXXXXXXXX
FTSK_RICTY      MPSEVTEQPEENYSSIDIV-----DGSIDEVLKKAVQIVRNERKASISYIQRSLRIGYNKAANLVEKMEK
FTSK_PSESM      GSPDYNDDILAGVXXXXXXXXXXXXXXXXALYDEAVKFVLESRRASISAVQRKLKIGYNXXXXXXXXXXX
FTSK_HAEIN      GKPDYIDGILESADDXXXXXXXXXXXXXDPLFDEVMDFVINTGTTSVSSIQRKFSVGFNRAARIMDQMEE
FTSK_BRAJA      GQPEYEEPTEDEDGGAVFXXXXXXXXXXXXLFQQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERMEL
FTSK_HELPY      KEVQYDKDFLLE-ESRMPLDTPNYQG--DDILERAKAVILEKKITSTSFLQRQLKIGYNQAATITDELEA
FTSK_HELPJ      KEVEYDKDFLLE-ESRMPLDTPNYQG--DDILERAKAVILEKKITSTSFLQRQLKIGYNQAATITDELEA
FTSK_BORBU      SPNYIDDEIIDSVKEPDLVALGPSD---EPMFDEALEIVKTTRKASASYLQRRLKIGYNRAARIIEIMED
FTSK_RICFE      GTPEYISAVTEQPXXXXXXXXXXXXXXXXVLYKKAVQIVRDERKSSISYIQRSLRIGYNKAANLVEKMEK
FTSK_MYCLE      AEPEYTEGVTTAKTTGERTXXXXXXXXXXXVFLQAVELVVSSQFGSTSMLQRKLRVGFAKAGRLMDLMET
FTSK1_RALSO     GEPEYDEAILPXXXXXXXXXXXXXXXXXDPLYDEAAAFVLNTRRASISAVQRQLRIGYNRAARLIEQMEA
FTSK_SALTY      R-PQYVXXXXXXXXXXXXXXXXXXXXXLDALFDQAVNFVTQKRKASISGVQRQFRIGYNRAARIIEQMEA
FTSK_SALTI      R-PQYVXXXXXXXXXXXXXXXXXXXXXLDALFDQAVNFVTQKRKASISGVQRQFRIGYNRAARIIEQMEA
FTSK_YERPE      RPQYXXXXXXXXXXXXXXXXXXXXXXXXXPLFDQAVNFVLEKRRASISGVQRQFRIGYNRAARIIEQMEA
FTSK_STRAW      MAPVFRDDVT--VGTKQKKXXXXXXXXXXXXXCQAAELVVSTQFGSTSMLQRKLRVGFAKAGRLMDLMES
FTSK_BRUSU      GVPEYLDAITXXXXXXXGGSGPAGTGDSDDPYDQAVAVVLRDKKASTSYIQRRLGIGYNRAASIIERMED
FTSK_BRUME      GVPEYLDAITXXXXXXXGGSGPAGTGDSDDPYDQAVAVVLRDKKASTSYIQRRLGIGYNRAASIIERMED
FTSK2_RALSO     GEPNYIEXXXXXXXXXXXXXXXXXXXXXXPLYDQAVDVVLKNRRASISLVQRHLRIGYNRAARLLEDMEK
FTSK_PSEAE      GAPDYIEDILXXXXXXXXXXXXXXXXXXXPLYDEAVRFVTESRRASISAVQRKLKIGYNXXXXXXXXXXX
FTSK_COXBU      -EPNYVEGILDEMGAAALXXXXXXXXXXDPLYDXXXXXXXXXXXXXXXXXXXXFKIGYNRAARIVEAMEA
FTSK_LEPIN      KPS-YVDFNLDEETESSVVDEGD-----EELFEQAWEIVRTDRKASASYLQRRMRIGYNKAARLMELMEE
FTSK_LEPIC      KPS-YVDFNLDEETESSVVDEGD-----EELFEQAWEIVRTDRKASASYLQRRMRIGYNKAARLMELMEE
FTSK_TROWT      HPDYY---VLEVQNQGNIDSH---IGDDMPLLLKATELVINSQLGSTSMLQRKLRVGFAKAGRLMDLMES
FTSK_TROW8      HPDYY---VLEVQNQGNIDSH---IGDDMPLLLKATELVINSQLGSTSMLQRKLRVGFAKAGRLMDLMES
FTSK_CHLTR      FPCKY---VIPSFN--TYDDPGSMDEDLDPLFNQAKTLVLQTGNASTTFLQRKLKIGYARAASIIDQLEE
FTSK_CHLMU      FPCKY---VIPSFDTYDDSSSMDPE-SLDPLFNQAKTLVLQTGNASTTFLQRKLKIGYARAASIIDQLEE
FTSK_RICBR      GTPEYISAVTEQXXXXXXXXXXXXXXXXXVLYKKAVQIVRDERKSSISYIQRSLRIGYNKAANLVEKMEK
FTSK_STRCO      MAPVFREDVT--VGTKQKKXXXXXXXXXXXXXCQAAELVVSTQFGSTSMLQRKLRVGFAKAGRLMDLMES
FTSK_CHLTE      PPLRAECMLPEPPXXXXXXXXXXFDGRRDSMFEEAARLVVMHQQASVSLLQRRLRLGFSRAGRVMDQLEQ
FTSK_VIBVU      GKPNYIDEIIQGPESLLPGEQMESDEDLDPLFDQVVEHXXXXXXXXXXXXXXXFKIGYNRAARIVEQLEA
FTSK_VIBPA      GKPNYIDEIIQGPESLLPGEQMESDEEMDPLFDQVVEHXXXXXXXXXXXXXXXFKIGYNRAARIVEQLEA
FTSK_COREF      XXPDYTDGVTED-KGGDSKKXXXXXXXXXXXXXXXXXXXXTSQIGSTSMLQRKLRIGFAKAGRLMDLMET
FTSK_CAUCR      GIPQYLDEVTDEEQEEAIEGAFSGEGGANDLYDHAVAVVTRDRKASTSYIQRRLQIGYNRAASLMERMEK
FTSK_CHLPN      FPTQYVIPSFHAFDD----SDSDNSGEKDPLFAQAKTLILQTGNASTTFLQRKLKIGYARAASLIDQLEE
FTSK_AZOBR      ----------------------------------------------------------------------
FTSKL_ANASP     ----------------------------------------------------------------------
Y3709_CLOAB     ----------------------------------------------------------------------
ESSC_STAAR      ----------------------------------------------------------------------
ESSC_STAAN      ----------------------------------------------------------------------
ESSC_STAAM      ----------------------------------------------------------------------
ESSC_STAAW      ----------------------------------------------------------------------
ESSC_STAAS      ----------------------------------------------------------------------
ESSC_STAAE      ----------------------------------------------------------------------
ESSC_STAAC      ----------------------------------------------------------------------
YUKB_BACSU      ----------------------------------------------------------------------
TRA_STRLI       ----------------------------------------------------------------------
YDCQ_BACSU      ----------------------------------------------------------------------
CAPP_METEA      GTAAYQMELLASVFEHALLSEGNGNGSRAE-FDDALEAL--SGASRAAYLQAEGLVDYFQAASPLDEISL
RAD50_PYRHO     ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
HST6_CANAL      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------------------------------------------
XRN2_YEAST      ----------------------------------------------------------------------
FLGE_BUCAI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           CGVISRRDGSKPRQVLLSKDELENMK
FTSK_CLOPE      CGVISRRDGSKPRQVLLSKDELENMK
FTSK_CLOAB      KGYISAKDGTKPRNILVDKDDL----
FTSK_CLOTE      RGIISQKDGSKPRQVLISKDDI----
FTSK_THETN      KGIISGYDGAKPRQIILPREEIQKI-
FTSK_SPOUR      RGVVGPPEGSKPRHVLLTKSKLE---
FTSK_BACSU      RGVVGPYEGSKPREVLLSKEKYDEL-
FTSK_BACAN      NGVVGPYEGSKPREVLIN--------
FTSK_BACCR      NGVVGPYEGSKPREVLIN--------
FTSK_STAAN      NQVIGPQKGSKPRQVLLNNDEV----
FTSK_STAAM      NQVIGPQKGSKPRQVLLNNDEV----
FTSK_STAAW      NQVIGPQKGSKPRQVLLNNDEV----
FTSK_STAAS      NQVIGPQKGSKPRQVLLNNDEV----
FTSK_STAAC      NQVIGPQKGSKPRQVLLNNDEV----
FTSK_STAAR      NQVIGPQKGSKPRQVLLNNDEV----
FTSK_BACHD      RGIVGPYEGSKPREVLVQAQDDE---
FTSK_LACPL      RGVVGPSEGSKPRKVYRQK-------
FTSK_OCEIH      RGIVGPYEGSKPRSVLVPK-------
FTSK_LISIN      RGVVGPHEGSKPRRV-----------
FTSK_LISMO      RGVVGPHEGSKPRRV-----------
FTSK_CAMJE      NGILSEPDAKGQREIL----------
FTSK_CAMJJ      NGILSEPDAKGQREIL----------
FTSK_STRR6      AGVIGPAEGTKPRKVL----------
FTSK_STRPN      AGVIGPAEGTKPRKVL----------
FTSK_TREPA      RGVVGPPNGSKPRDVLRS--------
FTSK_STAES      NQVIGPQKGSKPRQILV---DLEN--
FTSK_STAEQ      NQVIGPQKGSKPRQILV---DLEN--
FTSK_STRP8      AGVIGPAEGTKPRKVL----------
FTSK_STRP3      AGVIGPAEGTKPRKVL----------
FTSK_STRP1      AGVIGPAEGTKPRKVL----------
FTSK_STRMU      AGVIGPAEGTKPRKVLQS--------
FTSK_STRP6      AGVIGPAEGTKPRKVL----------
FTSK_STRA3      AGVIGPAEGTKPRKVLMT--------
FTSK1_NEIMA     AGVVSPSDLNGSRKILAHKDHL----
FTSK_AGRT5      EGIIGPANHAGKREILV---------
FTSK_STRA5      AGVIGPAEGTKPRKVLMT--------
FTSK2_NEIMA     EGIVSAPEHNGNRTILVPLD------
FTSK2_NEIMB     EGIVSAPEHNGNRTILVPLD------
FTSK_PASMU      QGIVSAMQNGK-REVL----------
FTSK_XYLFT      AGVVSPPEHNGDRAVL----------
FTSK_XYLFA      AGVVSPPEHNGDRAVL----------
FTSK_LACLA      QGIVGPAKGTTPRKVLVSPD------
FTSKL_DEIRA     MNIVGPHQGSKPREVLIHEADL----
FTSK_RHIME      EGIISPANHAGKREILV---------
FTSK_PSEPK      AGVVTPMNSNGSREVI----------
FTSK_XANAC      AGVVSPPEHNGDRTVL----------
FTSK_RHILO      EGIVGPANHAGKREILVPTED-----
FTSK_XANCP      AGVVSPPEHNGDRTVL----------
FTSK1_NEIMB     AGVVSSTDLNGSRKILAHKDHL----
FTSK_SHEON      QGVVSAQGHNGNREVL----------
FTSK_RICPR      DGIVSSPNHTGKREILL---------
FTSK_ECOL6      QGIVSEQGHNGNREVL----------
FTSK_BIFLO      RGVVGPSEGSKAREVLVQPQDL----
FTSK_HAEDU      QAIISEPGKGGKREVL----------
FTSK_MYCTU      RGIVGPSEGSKAREVLVKPDEL----
FTSK_VIBCH      QGIVSAPGHNGNRDVL----------
FTSK_RICCN      EGIVSPPNHTGKREILL---------
FTSK_SHIFL      QGIVSEQGHNGNREVL----------
FTSK_ECOLI      QGIVSEQGHNGNREVL----------
FTSK_ECO57      QGIVSEQGHNGNREVL----------
FTSK_CORGL      RGVVGPSEGSKAREVLVKPEELETI-
FTSK_PSEU2      XGVVTSMNTNGSREVL----------
FTSK_RICTY      DGIVSPPNHTGKREILL---------
FTSK_PSESM      XGVVTSMNTNGSREVL----------
FTSK_HAEIN      QGIVSPMQNGK-REILSHRPE-----
FTSK_BRAJA      EGIVGPANHAGKREILVEEED-----
FTSK_HELPY      QGFLSPRNAKGNREIL----------
FTSK_HELPJ      QGFLSPRNAKGNREIL----------
FTSK_BORBU      MGYVGPVNGSKPREVLI---------
FTSK_RICFE      EGIVSPPNHTGKREILL---------
FTSK_MYCLE      RSIVGPSEGSKAREVLVKADEL----
FTSK1_RALSO     AGLVSPMGRNGSREVI----------
FTSK_SALTY      QGIVSAQGHNGNREVL----------
FTSK_SALTI      QGIVSAQGHNGNREVL----------
FTSK_YERPE      QQIVSTPGHNGNREVL----------
FTSK_STRAW      RNIVGPSEGSKARDVLVKADELDGV-
FTSK_BRUSU      EGIVGPANHAGKREILV---------
FTSK_BRUME      EGIVGPANHAGKREILV---------
FTSK2_RALSO     AGLVSAMSGNGNREIL----------
FTSK_PSEAE      XGVVTPMNTNGSREVI----------
FTSK_COXBU      AGVVSPMENNGAREVLAPSKE-----
FTSK_LEPIN      RGYVSPQIGSKGREIL----------
FTSK_LEPIC      RGYVSPQIGSKGREIL----------
FTSK_TROWT      MGIVGPGQGSKAREVLVTPQDLDS--
FTSK_TROW8      MGIVGPGQGSKAREVLVTPQDLDS--
FTSK_CHLTR      ARIVGPSEGAKPRQILV---------
FTSK_CHLMU      ARIVGPSEGAKPRQILVQLSNQED--
FTSK_RICBR      EGIVSPPNHTGKREILL---------
FTSK_STRCO      RSIVGPSEGSKARDVLVKPDELDGV-
FTSK_CHLTE      SGIVSAGDGSKPREVLVNEDSLE---
FTSK_VIBVU      QGIVS---------------------
FTSK_VIBPA      QGIVSAPGHNGNREVL----------
FTSK_COREF      RGVVGPSEGSKAREVLVKPEELDTI-
FTSK_CAUCR      EGVVGAANHAGKREIL----------
FTSK_CHLPN      ARIIGPSEGAKPRQILI---------
FTSK_AZOBR      --------------------------
FTSKL_ANASP     --------------------------
Y3709_CLOAB     --------------------------
ESSC_STAAR      --------------------------
ESSC_STAAN      --------------------------
ESSC_STAAM      --------------------------
ESSC_STAAW      --------------------------
ESSC_STAAS      --------------------------
ESSC_STAAE      --------------------------
ESSC_STAAC      --------------------------
YUKB_BACSU      --------------------------
TRA_STRLI       --------------------------
YDCQ_BACSU      --------------------------
CAPP_METEA      LNIGSR--------------------
RAD50_PYRHO     --------------------------
MYO2_SACBA      --------------------------
HST6_CANAL      --------------------------
Y1934_STRMU     --------------------------
XRN2_YEAST      --------------------------
FLGE_BUCAI      --------------------------