[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81490.1

[Show Plain Result]


## Summary of Sequence Search
    1::142
    5::127     4e-38  56%  157 aa  NIFU_AQUAE RecName: Full=NifU-like protein;
   15::138     4e-37  58%  138 aa  ISU1_TRAHO RecName: Full=Iron sulfur cluster assembly protein
   36::163     2e-36  55%  179 aa  ISU1_DEBHA RecName: Full=Iron sulfur cluster assembly protein 1,
    1::125     2e-36  57%  127 aa  NIFU_BUCAI RecName: Full=NifU-like protein;
    4::122     3e-36  55%  312 aa  NIFU_AZOVI RecName: Full=Nitrogen fixation protein nifU;
    1::124     1e-35  60%  126 aa  NIFU_BUCBP RecName: Full=NifU-like protein;
    1::125     2e-35  56%  128 aa  NIFU_BUCAP RecName: Full=NifU-like protein;
    1::125     3e-35  57%  128 aa  NIFU_SHIFL RecName: Full=NifU-like protein;
    1::125     3e-35  57%  128 aa  NIFU_ECOLI RecName: Full=NifU-like protein;
    1::125     3e-35  57%  128 aa  NIFU_ECOL6 RecName: Full=NifU-like protein;
    1::125     3e-35  57%  128 aa  NIFU_ECO57 RecName: Full=NifU-like protein;
    1::125     1e-34  56%  131 aa  NIFU_RICPR RecName: Full=NifU-like protein;
    4::122     1e-34  54%  274 aa  NIFU_KLEPN RecName: Full=Nitrogen fixation protein nifU;
   37::159     5e-34  53%  181 aa  ISU1_YARLI RecName: Full=Iron sulfur cluster assembly protein 1,
   14::140     8e-34  52%  140 aa  ISU1_ENCCU RecName: Full=Iron sulfur cluster assembly protein
    1::109     3e-33  62%  126 aa  NIFU_HAEIN RecName: Full=NifU-like protein;
   53::176     7e-33  52%  192 aa  ISU1_SCHPO RecName: Full=Iron sulfur cluster assembly protein 1,
   51::174     2e-32  55%  180 aa  ISU1_KLULA RecName: Full=Iron sulfur cluster assembly protein 1,
   34::157     2e-32  53%  167 aa  ISCU_HUMAN RecName: Full=Iron-sulfur cluster assembly enzyme ISCU,
   25::148     3e-32  55%  154 aa  ISU1_ASHGO RecName: Full=Iron sulfur cluster assembly protein 1,
    4::122     1e-31  50%  309 aa  NIFU_AZOCH RecName: Full=Nitrogen fixation protein nifU;
   35::154     1e-31  54%  168 aa  ISCU_MOUSE RecName: Full=Iron-sulfur cluster assembly enzyme ISCU,
   34::158     2e-31  52%  165 aa  ISU1_YEAST RecName: Full=Iron sulfur cluster assembly protein 1,
   82::206     5e-31  51%  213 aa  ISU1_CANGA RecName: Full=Iron sulfur cluster assembly protein 1,
   26::150     9e-31  52%  156 aa  ISU2_YEAST RecName: Full=Iron sulfur cluster assembly protein 2,
    4::128     2e-29  53%  300 aa  NIFU_ANAAZ RecName: Full=Nitrogen fixation protein nifU;
    4::128     6e-29  52%  300 aa  NIFU_ANASP RecName: Full=Nitrogen fixation protein nifU;
    4::124     4e-27  48%  310 aa  NIFU_AZOBR RecName: Full=Nitrogen fixation protein nifU;
   10::140     9e-20  42%  147 aa  NIFU_BACSU RecName: Full=NifU-like protein;
    5::126     4e-17  35%  488 aa  MNMA_RUBXD RecName: Full=Bifunctional protein nifU/mnmA;Includes:
    5::92      4e-15  41%  142 aa  NIFU_THEMA RecName: Full=NifU-like protein;
    7::122     9e-12  30%  246 aa  NIFU_RHOSH RecName: Full=Nitrogen fixation protein nifU;
    1::49      1e-06  49%  205 aa  NIFU_PLEBO RecName: Full=Nitrogen fixation protein nifU;Flags:
    1::39      3e-06  51%   75 aa  NIFU_NOSCO RecName: Full=Nitrogen fixation protein nifU;Flags:
    8::97      7e-04  22%  138 aa  Y337_MYCGE RecName: Full=Uncharacterized protein MG337;
    1::142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGSAIASSSMAT
NIFU_AQUAE      --YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGDAMLFTIKVENDVIEDVRFKTFGCGSAIAVSSMLT
ISU1_TRAHO      --YHSSVIDHFENPRNVGSYKSANGTGLVGAPACGDVMKLQIKVENDIIKDAKFRTFGCGSAIASSSLAT
ISU1_DEBHA      -LYHEKVLDHYSNPRNVGTLNKLDGTGLVGAPACGDVMRLQIQVETGVIKDVKFKTFGCGSAIASSSYLT
NIFU_BUCAI      MAYSKKVMDHYENPRNVGSFSSTDGSGLVGAPACGDVMKLQIKVEKGIIEDACFKTYGCGSAIASSSLVT
NIFU_AZOVI      --YSEKVKEHFYNPKNAGAVEGANAIGDVGSLSCGDALRLTLKVETDVILDAGFQTFGCGSAIASSSALT
NIFU_BUCBP      MAYSKKVIDHYENPRNVGSFKDANGSGLVGAPACGDVMKLQIKVKNGIIQDACFKTYGCGSAIASSSLVT
NIFU_BUCAP      MAYSKKVMDHYENPRNVGSFSNSDGSGLVGAPACGDVMKLQIKVEQGIIEDACFKTYGCGSAIASSSLVT
NIFU_SHIFL      MAYSEKVIDHYENPRNVGSFNDENGSGMVGAPACGDVMKLQIKVDEGIIEDARFKTYGCGSAIASSSLVT
NIFU_ECOLI      MAYSEKVIDHYENPRNVGSFNDENGSGMVGAPACGDVMKLQIKVDEGIIEDARFKTYGCGSAIASSSLVT
NIFU_ECOL6      MAYSEKVIDHYENPRNVGSFNDENGSGMVGAPACGDVMKLQIKVDEGIIEDARFKTYGCGSAIASSSLVT
NIFU_ECO57      MAYSEKVIDHYENPRNVGSFNDENGSGMVGAPACGDVMKLQIKVDEGIIEDARFKTYGCGSAIASSSLVT
NIFU_RICPR      MAYSKKVIDHYENPRNVGSLKKNVGTGLVGAPACGDVMKLQIEVDDEIITDAKFKTFGCGSAIASSSLVT
NIFU_KLEPN      --YSEKVKDHFFNPRNARVVDNANAVGDVGSLSCGDALRLMLRVDSEIIEEAGFQTFGCGSAIASSSALT
ISU1_YARLI      --YHEKVLDHYNNPRNVGSMNKNDGTGLVGAPACGDVMKLQIRVDDNVIQDVKFKTFGCGSAIASSSYVT
ISU1_ENCCU      --YDSSVVDHFENPRNVGSLDKTDGTGMVGAPACGDVMKLQIKVKDNVIEDAKFKTFGCGSAIASSSLAT
NIFU_HAEIN      MAYSEKVIDHYENPRNVGSLKDSNGTGMVGAPACGDVMQLQIKVDDNIIEDAKFKTYGCGSAIASSSLIT
ISU1_SCHPO      -MYHKNVLDHYNNPRNVGTLPKGDGIGLVGAPACGDVMRLAIRVKDGVIEDVKFKTFGCGSAIASSSYVT
ISU1_KLULA      --YHPKVIDHYTNPRNVGSL-DKNGTGLVGAPACGDVMKLQIQVETGVIENVKFKTFGCGSAIASSSYMT
ISCU_HUMAN      -LYHKKVVDHYENPRNVGSLDKTSGTGLVGAPACGDVMKLQIQVEKGKIVDARFKTFGCGSAIASSSLAT
ISU1_ASHGO      --YHPKVIDHYTNPRNVGTLKLTNGTGLVGAPACGDVMRLQIQVDDSVIENVKFKTFGCGSAIASSSYMT
NIFU_AZOCH      --YSEKVKEHFYNPKNAGAVEGANAIGDVGSLSCGDRLRLTLKVETDVILDAGFQTFGCGSAIASSSALT
ISCU_MOUSE      -LYHKKVVDHYENPRNVGSLDKTSGTGLVGAPACGDVMKLQIQVEKGKIVDARFKTFGCGSAIASSSLAT
ISU1_YEAST      -LYHPKVIEHYTHPRNVGSLKLPNGTGLVGAPACGDVMRLQIKVNDSVIEDVKFKTFGCGSAIASSSYMT
ISU1_CANGA      -MYHPKVIEHYTHPRNVGSMDKTLGTGLVGAPACGDVMRLQIKVNDKVIEDVKFKTFGCGSAIASSSYMT
ISU2_YEAST      -LYHPKVIDHYTNPRNVGSMDKANGTGIVGAPACGDVIKLQIQVKSGIIENVKFKTFGCGSAIASSSYMT
NIFU_ANAAZ      --YTDKVLELFYDPKNQGVIED-NGTGEVGSIACGDALRLHIKVESDKIVDSRFQTFGCTSAIASSSALT
NIFU_ANASP      --YTDKVLELFYDPKNQGVIEE-NGTGEVGSIACGDALRLHIKVESDKIVDSRFQTFGCTSAIASSSALT
NIFU_AZOBR      --YTDKVKEHFFNPKNAGALDEADDVGEVGSITCGDALKLMMKVNPDQPRDANFQTFGCGSAIASRSALT
NIFU_BACSU      -LYRQVIMDHYKNPRNKGVLNDSIVV-DMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSISMASASMMT
MNMA_RUBXD      --YGPRVIEHLVNPRNAGEVGGPSGVGEAGNAACGDQVRFTLRVGGDLLQEVXXXXXXXXXXXXXXXXXX
NIFU_THEMA      MMYSEAILDYANSKKFRGKLDDATVIEEGKNISCGDEITLYLKVEDGVVKDAKFEGMGCVISQASASLML
NIFU_RHOSH      -----KALDLFFNPRNAGPLEAADAVGTAGSLEVGDAIRLMLRIEAGRVAEARFLAFGGAHAIACGSALT
NIFU_PLEBO      ----------------------------------------------------------------------
NIFU_NOSCO      ----------------------------------------------------------------------
Y337_MYCGE      -----KIIDIYSNLKYKKPLKSFQKILTTSDSNCEDFFNIGLNIDKNKITAIGFDGDGCIISTIATELSI


                         .         .         *         .         .         .         .:140
query           ELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQRQGLEPWDMKEHSHDxxxxx
NIFU_AQUAE      EMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLMKQG-----------------
ISU1_TRAHO      EWIKGKSISDSLKITNKDIAKKL-SLPPVKLHCSMLAEDAIKAAISDYQKKNGL----------------
ISU1_DEBHA      ELVKGKTIEEAVKIKNTAIAKEL-SLPPVKLHCSMLAEDAIKSAVKDYRSKRSVK---------------
NIFU_BUCAI      EWVKGKSIEEAESIKNTTIVEELD-LPPVKIHCSILAEDAIKAAISDYKRKK------------------
NIFU_AZOVI      EMVKGLTLDEALKISNQDIADYLDGLPPEKMHCSVMGREALQAAVANYR---------------------
NIFU_BUCBP      EWIKGKSLIEAENIKNTNIAEELD-LPPVKIHCSILAEDAIKAAITDYKNK-------------------
NIFU_BUCAP      EWIKGKSITEAEAIKNTSIVEELE-LPPVKIHCSILAEDAIKAAISDYKSKK------------------
NIFU_SHIFL      EWVKGKSLDEAQAIKNTDIAEELE-LPPVKIHCSILAEDAIKAAIADYKSKR------------------
NIFU_ECOLI      EWVKGKSLDEAQAIKNTDIAEELE-LPPVKIHCSILAEDAIKAAIADYKSKR------------------
NIFU_ECOL6      EWVKGKSLDEAQAIKNTDIAEELE-LPPVKIHCSILAEDAIKAAIADYKSKR------------------
NIFU_ECO57      EWVKGKSLDEAQAIKNTDIAEELE-LPPVKIHCSILAEDAIKAAIADYKSKR------------------
NIFU_RICPR      EWIKGKSVEDAKEIKNTEIAKEL-SLPPVKLHCSLLAEDAIKAAIADYKQKR------------------
NIFU_KLEPN      ELIIGHTLAEAGQITNQQIADYLDGLPPEKMHCSVMGQEALRAAIANFR---------------------
ISU1_YARLI      ELVRGKSLAEAGKIKNTVIAKEL-SLPPVKLHCSMLAEDAIKSAISDYNSKR------------------
ISU1_ENCCU      EWIKKKTIDESLKISNRDIAKKL-SLPPIKLHCSMLAEDAIKMAIKDFLDKNKPSP--------------
NIFU_HAEIN      EWVKGKSLEEAGAIKNSQIAEELE-LPPVKVHCSIL----------------------------------
ISU1_SCHPO      TMVKGMTLEEASKIKNTQIAKEL-CLPPVKLHCSMLAEDAIKSAVKHYRSKQ------------------
ISU1_KLULA      ELVRGKTLEDAAKIKNTEIAREL-SLPPVKLHCSMLAEDAIKAAIKDYQAKR------------------
ISCU_HUMAN      EWVKGKTVEEALTIKNTDIAKEL-CLPPVKLHCSMLAEDAIKAALADYKLKQ------------------
ISU1_ASHGO      ELVRGKTLADAEKIKNTEIAREL-SLPPVKLHCSMLAEDAIKAAIKDYRSKR------------------
NIFU_AZOCH      EMVKGADLDDALKISNRDIAHFLGRLPREKMHCSVMGRERLQAAVANYR---------------------
ISCU_MOUSE      EWVKGKTVEEALTIKNTDIAKEL-CLPPVKLHCSMLAEDAIKAALADY----------------------
ISU1_YEAST      ELVQGMTLDDAAKIKNTEIAKEL-SLPPVKLHCSMLAEDAIKAAIKDYKSKR------------------
ISU1_CANGA      ELVHGMTLDDAAKIKNTTIAKEL-SLPPVKLHCSMLAEDAIKAAIKDYKSKR------------------
ISU2_YEAST      ELVRGMSLDEAVKIKNTEIAKEL-SLPPVKLHCSMLAEDAIKAAIKDYKTKR------------------
NIFU_ANAAZ      EMIKGLTLDEALKVSNKDIADYLGGLPEAKMHCSVMGQEALEAAIYNYR---------------------
NIFU_ANASP      EMIKGLTLDEALKVSNKDIADYLGGLPEAKMHCSVMGQEALEAAIYNYR---------------------
NIFU_AZOBR      EMIIGKTVDEAGQVTNRDIAEYLGGLPPEKMDCSVMGAEALPAAIANFK---------------------
NIFU_BACSU      QAIKGKDIETALSMSDLGDIEALQGVSPARIKCATLSWKALEKGV-------------------------
MNMA_RUBXD      XXXXGRSITGAAQISRGDIQEALGGLPPGKEHGATLALDALHRAFEDYWSRQ------------------
NIFU_THEMA      ERIIGERVEEIFSLIEEA----------------------------------------------------
NIFU_RHOSH      VLVTGLDLAAARAVTPEEIEAAVGGLXXXXXXXXXXXWSALQIALAAYEGR-------------------
NIFU_PLEBO      ----------ALNVSNQDIAAFLGGLPEAKMHCSVMGQEALEAAIFKYR---GIE---VEHHEED-----
NIFU_NOSCO      ----------ALKVSMKDIADYLGGLPEAKMHCSVMGQEALEAAIYWYR---------------------
Y337_MYCGE      KAIENKTINQAKKILSDLIATYKD----------------------------------------------


                         +         .         .         .         .         *         .:210
query           xx
NIFU_AQUAE      --
ISU1_TRAHO      --
ISU1_DEBHA      --
NIFU_BUCAI      --
NIFU_AZOVI      --
NIFU_BUCBP      --
NIFU_BUCAP      --
NIFU_SHIFL      --
NIFU_ECOLI      --
NIFU_ECOL6      --
NIFU_ECO57      --
NIFU_RICPR      --
NIFU_KLEPN      --
ISU1_YARLI      --
ISU1_ENCCU      --
NIFU_HAEIN      --
ISU1_SCHPO      --
ISU1_KLULA      --
ISCU_HUMAN      --
ISU1_ASHGO      --
NIFU_AZOCH      --
ISCU_MOUSE      --
ISU1_YEAST      --
ISU1_CANGA      --
ISU2_YEAST      --
NIFU_ANAAZ      --
NIFU_ANASP      --
NIFU_AZOBR      --
NIFU_BACSU      --
MNMA_RUBXD      --
NIFU_THEMA      --
NIFU_RHOSH      --
NIFU_PLEBO      --
NIFU_NOSCO      --
Y337_MYCGE      --