[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81533.1

[Show Plain Result]


## Summary of Sequence Search
    1::194
   36::224     4e-10  31%  229 aa  SP3AG_BACSU RecName: Full=Stage III sporulation protein AG;
    1::194

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxMFYLVVSYFTGVNNITKSEKTNLEKVSKEDMNSNSQKDSEVLSYQEKQE
SP3AG_BACSU     ---------------------VFVLGVSFMLVSQLFSSPEKTENAKVSSQHSADSKEKTAEVFXYEKEYE


                         .         .         *         .         .         .         .:140
query           KDLERILGKINGVGSVDVVINFQSSEVKVPAVDNSSQKXXXXXXXXXXXXRVNSQETDGDKIVMSNSSNG
SP3AG_BACSU     NQLKEILETIIGXXXXXXXXXXXATSLKVYXXXXXXXXXXXXXXXXXGGKRSVTDQSSEEEIVMIKNGDK


                         +         .         .         .         .         *         .:210
query           SEPVILKTEKPEVLGVMVVAEGAEDSKIKYEITKAISSLYNISVDKVNVLAMKx
SP3AG_BACSU     ETPVVVQTKKPDIRGVLVVAQGVDNVQIKQTIIEAVTRVLDVPSHRVAVAPKK-