[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81544.1

[Show Plain Result]


## Summary of Sequence Search
    1::216
  211::291     9e-05  36%  428 aa  TIG_CLOPS RecName: Full=Trigger factor;         Short=TF;
  211::291     9e-05  36%  428 aa  TIG_CLOPE RecName: Full=Trigger factor;         Short=TF;
  211::291     9e-05  36%  428 aa  TIG_CLOP1 RecName: Full=Trigger factor;         Short=TF;
  153::347     2e-04  27%  437 aa  DNAA_WOLSU RecName: Full=Chromosomal replication initiator protein
  780::850     3e-04  31%  909 aa  ODO1_BUCAI RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  244::346     3e-04  28%  436 aa  DNAA_CAMC1 RecName: Full=Chromosomal replication initiator protein
   69::245     4e-04  30%  415 aa  SYS_HELP2 RecName: Full=Seryl-tRNA synthetase;       
  108::260     6e-04  27%  318 aa  VG52_ICHV1 RecName: Full=Uncharacterized gene 52 protein;
  751::810     6e-04  33% 1046 aa  ATG11_KLULA RecName: Full=Autophagy-related protein 11;
    1::216

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxDTNDISKLKELKDKRVKFILLNEKIFIEILRVDKKCDVEEKIEQLIRD
TIG_CLOPS       ----------------------------------------------------------------------
TIG_CLOPE       ----------------------------------------------------------------------
TIG_CLOP1       ----------------------------------------------------------------------
DNAA_WOLSU      ------------------------NSIGNYNVAKGKSVIYVFLNDYLYIRNNTMDRFRDKYRACDYLLID
ODO1_BUCAI      --------------------------LDEVDNVNKKEIRLIFCSGKIYYDLLRNRR----EKKINSIILI
DNAA_CAMC1      ----------------------------------------------------------------------
SYS_HELP2       ----------------------DTSDLKK--ELESNKIKLNELSKSVSELEQQIDLKLSVDEKIKKILTP
VG52_ICHV1      ---------------------------TRFRSLTSNGVMLIINQESVLYNIRDIFRACTIDEEWNYLIRG
ATG11_KLULA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RFFNYTPLVHYEVLKYNKSLFLIVYFIGCDERFKSLLYERKDFSLTFPELKNKNILSFKKATFELKNLKI
TIG_CLOPS       --------------------------------------ESKDVNVTFPEAYGKEDLNGKPAKFEV-----
TIG_CLOPE       --------------------------------------ESKDVNVTFPEAYGKEDLNGKPAKFEV-----
TIG_CLOP1       --------------------------------------ESKDVNVTFPEAYGKEDLNGKPAKFEV-----
DNAA_WOLSU      QFFGGKPQIQEEFFHHNKNKQIVLQIAGLEERLKSRFEWGMVSDIQPPELETKINIIKKKCEFD------
ODO1_BUCAI      RIEQLYPFPEGEILKILKNYFYIKDFIWCQE---------------------------------------
DNAA_CAMC1      ---------------------------GFDERLKSRFEQSIMADITPPELDTKIAIIIKKCEFD------
SYS_HELP2       RVFNFKPKEHFELAQQNKSRFSVIRGFGA-KIYRALIYLMLDFNIYTPALVNEKMLKFKEDVFKIENENL
VG52_ICHV1      NII-YSPLLDWDISTENESSVLLLATPAREKSFVRLLEKASDHN---PEIRNRRLRAFTESIFTLFNAMI
ATG11_KLULA     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKDFGVSLKDFTFKIQKEYLKEEIKEWFKGLKLNEIRGEE
TIG_CLOPS       -----------------TVKEIKVKELPALDDEFAKEVSEFD---TLEELKADLKE--KAVKANELRAKR
TIG_CLOPE       -----------------TVKEIKVKELPALDDEFAKEVSEFD---TLEELKADLKE--KAVKANELRAKR
TIG_CLOP1       -----------------TVKEIKVKELPALDDEFAKEVSEFD---TLEELKADLKE--KAVKANELRAKR
DNAA_WOLSU      GIYLSNEIISYIATNMDNNIREIEGIIIKLNAYANLMNQEITLQFAKNVLKEQIKEERENITLENI----
ODO1_BUCAI      ----------------------------------------------------------------------
DNAA_CAMC1      KIYLNKEVIDYIATNMGDNIREIEGAIINLNAYASLMRVEITLEFAKNTLKDLIKEKHENINLETI----
SYS_HELP2       YLIPTAEVTLTNLYNDTII---------------------------------------------------
VG52_ICHV1      PLESCKKLVLLRQLQILQRYFVIKKSTVGFE---------------------------------------
ATG11_KLULA     SIFILASIGLLLSKDQDGNFQIVR--VKGLRKDLDSSLADMNSSMAKSVIAQEIKSTFESIK--------


                         .         .         .         +         .         .         .:280
query           NLYQKI
TIG_CLOPS       EMEEKV
TIG_CLOPE       EMEEKV
TIG_CLOP1       EMEEKV
DNAA_WOLSU      ------
ODO1_BUCAI      ------
DNAA_CAMC1      ------
SYS_HELP2       ------
VG52_ICHV1      ------
ATG11_KLULA     ------