[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81560.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
   29::228     4e-37  43%  228 aa  Y274_AQUAE RecName: Full=UPF0001 protein aq_274;
   14::218     6e-29  38%  218 aa  Y556_SYNY3 RecName: Full=UPF0001 protein slr0556;
    4::232     1e-26  36%  233 aa  YPI1_VIBAL RecName: Full=UPF0001 protein in pilT-proC intergenic
   26::231     2e-26  36%  233 aa  Y112_PASMU RecName: Full=UPF0001 protein PM0112;
    1::222     3e-26  35%  230 aa  YLME_BACSU RecName: Full=UPF0001 protein ylmE;
    1::231     2e-25  35%  237 aa  Y090_HAEIN RecName: Full=UPF0001 protein HI0090;
    3::231     3e-24  40%  234 aa  YGGS_ECOLI RecName: Full=UPF0001 protein yggS;
    3::231     3e-24  40%  234 aa  YGGS_ECOL6 RecName: Full=UPF0001 protein yggS;
    3::231     3e-24  40%  234 aa  YGGS_ECO57 RecName: Full=UPF0001 protein yggS;
   27::232     9e-24  43%  236 aa  Y461_VIBCH RecName: Full=UPF0001 protein VC_0461;
   23::223     5e-23  35%  237 aa  YKC9_SCHPO RecName: Full=UPF0001 protein C644.09;
   41::252     7e-22  36%  275 aa  PROSC_HUMAN RecName: Full=Proline synthetase co-transcribed
   41::252     1e-21  36%  275 aa  PROSC_PONAB RecName: Full=Proline synthetase co-transcribed
   24::252     4e-21  31%  274 aa  PROSC_MOUSE RecName: Full=Proline synthetase co-transcribed
   41::252     1e-20  37%  273 aa  PROSC_BOVIN RecName: Full=Proline synthetase co-transcribed
   55::248     2e-20  34%  257 aa  YBD6_YEAST RecName: Full=UPF0001 protein YBL036C;
   29::224     2e-20  34%  229 aa  Y531_BUCAP RecName: Full=UPF0001 protein BUsg_531;
   26::225     6e-20  37%  230 aa  Y394_PSEAE RecName: Full=UPF0001 protein PA0394;
   15::250     8e-20  37%  254 aa  PROSC_DICDI RecName: Full=Proline synthetase co-transcribed
   31::242     7e-19  34%  244 aa  PROSC_CAEEL RecName: Full=Proline synthetase co-transcribed
   28::220     2e-16  33%  222 aa  Y395_HELPY RecName: Full=UPF0001 protein HP_0395;
   28::220     9e-16  32%  222 aa  Y395_HELPJ RecName: Full=UPF0001 protein jhp_0986;
    4::198     5e-14  30%  200 aa  Y549_BUCAI RecName: Full=UPF0001 protein BU549;
   18::218     1e-13  27%  221 aa  Y2153_CORGL RecName: Full=UPF0001 protein Cgl2153/cg2364;
   24::208     7e-13  30%  209 aa  Y1368_DEIRA RecName: Full=UPF0001 protein DR_1368;
   29::221     1e-12  31%  223 aa  Y497_BUCBP RecName: Full=UPF0001 protein bbp_497;
   40::250     6e-10  24%  257 aa  Y919_MYCLE RecName: Full=UPF0001 protein ML0919;
   40::253     1e-08  23%  258 aa  Y2172_MYCBO RecName: Full=UPF0001 protein Mb2172c;
   40::253     1e-08  23%  258 aa  Y2148_MYCTU RecName: Full=UPF0001 protein Rv2148c/MT2207;
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHL
Y274_AQUAE      ------------------KLLGASKTVPPEVIREFYNCGLKVYGENRVQEFLKKYEALKDDLEWHFIGRL
Y556_SYNY3      -------------LPPSVRLVAVTKTKAIADIEAAYGAGIRDFAESRIQEALPKIEALYQDINWHFIGRL
YPI1_VIBAL      --IQQNIEHITSQIPESVQLLAVSKTKPVEAILEAYQAGQTAFGENYVQEGVSKVQHFAEHIEWHFIGPI
Y112_PASMU      ---------------SAVKLLAVSKTKPVEDIYQAYQAGQTAFGENYVQEGVEKIQYFAQKLEWHFIGPL
YLME_BACSU      MRVVDNLRHINERISDEVTVIAVTKYVSPERAQEAVDAGITCLGENRDAELLRKQELMKGNPEWHFIGSL
Y090_HAEIN      MNIQHNLNLIQQKIETTVKLLAVSKTKPISAILSAYQAGQTAFGENYVQEGVEKIQYFESNLEWHFIGPL
YGGS_ECOLI      -DIAHNLAQVRDKIPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQEGLEWHFIGPL
YGGS_ECOL6      -DIAHNLAQVRDKIPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQEGLEWHFIGPL
YGGS_ECO57      -DIAHNLAQVRDKIPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQEGLEWHFIGPL
Y461_VIBCH      ---------------SSVQLLAVSKTKPVEAILEATQAGQRYFGENYVQEKIRYFAEHHPQLEWHFIGPL
YKC9_SCHPO      ----------------NVLLVAVSKFHPVETLMEAYNAGQRHFGENYMQEFLKKVELMPDDVQWHFIGSL
PROSC_HUMAN     ------------------RLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNLCPEIKWHFIGHL
PROSC_PONAB     ------------------RLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASSLGPEIKWHFIGHL
PROSC_MOUSE     --VQQSVARRPRDLPAQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASSSCPEIKWHFIGHL
PROSC_BOVIN     ------------------RLVAVSKTKPADMVIEAYSHGQRTFGENYVQELLEKASNPQPEIKWHFIGHL
YBD6_YEAST      ------------------------------DIQILYDHGVREFGENYVQELIEKAKLLPDDIKWHFIGGL
Y531_BUCAP      -----------------IKIIAVSKNQGIDKIKLAISSGIHEFGENYVQEGIDKIQKLYQNIIWHFIGKV
Y394_PSEAE      --------------PATVGLLAVSKTKPAAAVREAHAAGLRDFGENYLQEALGKQAELADPLNWHFIGPI
PROSC_DICDI     -NIKDRVEIISNKFDRNVKLVAVSKTKPTEMIRILYDKGHRHFGENYIQXXXXXXXXXXXXIKWHFIGSI
PROSC_CAEEL     ------------------RLVAVSKTKSADLIEACYSQNQRHFGENYVQELEEKSDVLASDIRWHFIGQV
Y395_HELPY      -----------------VKIVAVSKNASPEAIQHYYNCSQRAFGENKVQDLKTKMHSLHLPLEWHMIGSL
Y395_HELPJ      -----------------VKIVAVSKNASPEAIQHYYNCSQRAFGENKVQDLKIKMHSLHLPLEWHMIGSL
Y549_BUCAI      -----------------ITIIAVSKXXXXXXXXXXXXSGINNFGENYLQESLIKIENLYKNITWHFIGKI
Y2153_CORGL     ----------------SVRLLPVTKFHPVEDIKILQEFGVTAVGENREQEARAKALEL-PDMDFHMIGQI
Y1368_DEIRA     -----------------VRLVAVTKGHSLDEIRQVLAHGDFPLAENRGQELRDKVAGL-PGAEWHFIGPL
Y497_BUCBP      -----------------IKLLAVSKNRSVNDIKKAILCGQNSFGENYVQESQPKIKLFN-NIEWHYIGQI
Y919_MYCLE      -----------------IELLPISKFFPATDVAILSRLGCRSVGESRAQEASTKAAEFAESIHWHMVGQI
Y2172_MYCBO     -----------------IELLPITKFFPATDVAILFRLGCRSVGESREQEASAKMXXXXXXVHWHMVGRI
Y2148_MYCTU     -----------------IELLPITKFFPATDVAILFRLGCRSVGESREQEASAKMXXXXXXVHWHMVGRI


                         .         .         *         .         .         .         .:140
query           QTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGXXXXXXXXXXXXXXXC
Y274_AQUAE      QTNKVKYLMGKVVLIHSLDRKNLADEIQKRAFKNNIVQDVLIEVNVGGEETKGGVEPENLKELFEYTLEL
Y556_SYNY3      QSNKARKVVENFTYIHSVDNLAIAVKLDRIAEELNKFPQGLLQIKLLPDENKSGWTRXXXXXXXXXXXXX
YPI1_VIBAL      QSNKSRLVAEHFDWVHTIDRTKIAQRLNDQRPSELKPLQVLIQVNTSGEASKSGVTEAEVFELAELISRL
Y112_PASMU      QSNKTKLVAEHFDWMQTLDRKKIADRLNEQRPHYKKPLNVLIQINISDEDSKSGIQPNEMLDLAKQIQNL
YLME_BACSU      QSRKAKSVVNSVSYIHSLDRLSLAKEIEK---RAEGTVRCFVQVNTSLEPSKHGMKKEEVIPFIQELSGF
Y090_HAEIN      QSNKTRLVAEHFDWMQTLDRAKIADRLNEQRPTNKAPLNVLIQINISDEESKSGIQPEEMLTLAKHIENL
YGGS_ECOLI      QSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQXXXXXXXXXXXXXX
YGGS_ECOL6      QSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQXXXXXXXXXXXXXX
YGGS_ECO57      QSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQXXXXXXXXXXXXXX
Y461_VIBCH      QSNKTRLVAEHFDWVHTIDREKIALRLSEQRPVNMPPLQVLIQVNTSGEASKSGIEPQQLFTLAELISRL
YKC9_SCHPO      QSSKCKKIVKNLYSIETIDTEKKARLVNSAREALQLPLNVYIQVNTSGEENKGGVTPSKVLELCKQVQDM
PROSC_HUMAN     QKQNVNKLVPNLFMLETVDSVKLADKVNSSWQRKGERLKVMVQINTSGEESKHGLPPSETIAIVEHINAC
PROSC_PONAB     QKQNVNKLVPNLFVLETVDSVKLAGKVNSSWQKKGERLKVMVQINTSGEESKHGPPSETIAIVEHINAKC
PROSC_MOUSE     QKQNVNKLVPNLSMLETVDSVKLADKVNSSWQKKTEPLKVMVQINTSGEDSKHGLPSETIAVVEHIKASC
PROSC_BOVIN     QKQNVNKLVPNLSMLETVDSVKLADKVNSAWQKKGERLKVMVQINTSGEASKHGPPAEMAALVEHINAKC
YBD6_YEAST      QTNKCKDLVPNLYSVETIDSLKKAKKLNESRAKFQPDCNPIVQINTSHEDQKSGEAEIFEVIDFFLSEEC
Y531_BUCAP      QSNKTKIIAENFDWCQTIDREKIAILLNKYREKKSFPMNVLMQINISNEVTKNGICIKNYKKLAKTISLM
Y394_PSEAE      QSNKTRPIAEHFQWVHSVDRLKIAQRLSEQRPAGLPPLNVCLQVNVSGEASKSGCAPEDLPALAEAVKQL
PROSC_DICDI     QSNKSKILVKNLYVVETVENKKILDKLAKXXXXXXXXXXIMIQVNTSGEESKSGCKPEECLDLVKHCLED
PROSC_CAEEL     QSNKIGKICNSPGLVETVETEKHARIFDKEWSKHGSPLRVLVQVNTSGEDNKGGEIGEAPKLAEFIRKEC
Y395_HELPY      QENKINXXXXXXXXXXXXXXXXXXXXIEKRCEILGVNLNALLQVNSAYEESKSGVVPEEALEIYSQISEC
Y395_HELPJ      QENKINXXXXXXXXXXXXXXXXXXXXIEKRCEILGVNLNALLQVNSAYEESKSGVVPEEALETYSQISEC
Y549_BUCAI      QSNKTKKIAQNFSWCQTVDREKIAVLLNKFRPKNLPPINVLIQINNLKELQN-NRYIDQYQELAQLILSM
Y2153_CORGL     QSKKANSIARWAAAVHSVDSEKIAEALGRALDRGDRTSDELIQLSLDGDPSRGGTPLSQVTQLADCISDT
Y1368_DEIRA     QRNKIKYLRG-VTLVHSIEEPWXXXXXXXXXXXXXXXPAVLLQRHNG-EGQKHGVLPDDLPAVLREVR-A
Y497_BUCBP      QSNKAHIIAKNFSWCHTITNKKTAVLLNKYRPYSLPKLNTLXXXXXXXXXXXXXXXXXXXKQLAKTINSL
Y919_MYCLE      QRNKVRSLAQWAHTAHSIDSLQXXXXXXXXXXXXEQPLQVYVQISLDGDISRGGTAPGAVDRVCAQVEES
Y2172_MYCBO     QRNKAGSLARWAHTAHSVDSSRLVTALDRAVHRRGERLRVYVQVSLDGDGSRGGTTPGAVDRICAQVQES
Y2148_MYCTU     QRNKAGSLARWAHTAHSVDSSRLVTALDRAVHRRGERLRVYVQVSLDGDGSRGGTTPGAVDRICAQVQES


                         +         .         .         .         .         *         .:210
query           NNVNVLGIMTIIPKGTEEECRKYFSKTHXXXXXXXXXXXXNIKMDILSMGMSGDYEIATEEGSNMVRIGQ
Y274_AQUAE      PNVKVLGLMTIPPLENPEDVRPYFRKLR--ELRDELQREYNVALPHLSMGMSHDFEVAIEEGATIVRIGT
Y556_SYNY3      XXXXICGLMTILPLGLSPGDRQ-LTFGELKNLATAINQQSSLSLTELSMGMSGDYPEAIAAGATMIRLGT
YPI1_VIBAL      PNLTLRGLMSIPANVSDYESQLHFQKLATLKQTLEAQFP---EIDTLSMGMSGDMTAAIEAGSTMVRIGT
Y112_PASMU      PHLCLRGLMA-IPAPTDDLAEQAFTQMH-SLFEQLKQALPDAQIDTLSMGMTDDMASAIQCGSTMVRIGT
YLME_BACSU      EHILVAGLMTMAPTDDQDQIRSCFRSLRELRDQVQKLNQPNAPCTELSMGMSNDFEIAIEEGATYIRIGS
Y090_HAEIN      PHLCLRGLMAIAPTDNIAEQENAFRKM-LELFEQLKQVLPNQQIDTLSMGMTDDMPSAIKCGSTMVRIGT
YGGS_ECOLI      PRLRLRGLMAI--PAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGT
YGGS_ECOL6      PRLRLRGLMAI--PAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGT
YGGS_ECO57      PRLRLRGLMAI--PAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGT
Y461_VIBCH      PNLTLRGLMSI-----PENVPDYPXXXXXXXXXXXXXXXXXXKIDTLSMGMSGDMQAAIEAGSTIVRIGT
YKC9_SCHPO      KYLRLKGLMTIGSISNSQ------LSDHNPDFQVLSDLRESLQNELLSMGMSSDYLLAIKYGSDSVRVGS
PROSC_HUMAN     PNLEFVGLMTILSQGPNPDFQLLLSLREELCKKL------NIPADQLSMGMSADFQHAVEVGSTNVRIGS
PROSC_PONAB     PNLEFVGLMTILSQGPNPDFQLLLS------LREELCKKLNIPADELSMGMSVDFQHAIEVGSTNVRIGS
PROSC_MOUSE     PSLEFVGLMTIGSFGHDQGPNPDFQRLLTLRRELCEKLGIPVEQVELSMGMSMDFQHAIEVGSTNVRIGS
PROSC_BOVIN     PSLEFVGLMTIGSFGREELCRKLGAPPEQVE---------------LSMGMSVDFQHAIEVGSTNVRIGS
YBD6_YEAST      KYIKLNGLMTIGSWNVSHEDSKEFATLVEWKKKIDAKFGTSLK---LSMGMSADFREAIRQGTAEVRIGT
Y531_BUCAP      PNLNFRGIM-MMPE-VEKKMIKQNDNYKNGNFIFNELKKEYQSIDTLSLGTSFDIENALLFHSNMIRIGR
Y394_PSEAE      PNLRLRGLMAI-----PEPTXXXXXXXXXXXXXXXXXXXXXXXXXXXSMGMSDDLEAAIGEGATWVRIGT
PROSC_DICDI     NNLNFLGLMTINPNATPDQCKNNISKQ------------LNIPLDSLSMGMSHDFEPAIEFGSTSVRVGS
PROSC_CAEEL     QNLKFDGFMTIHASGENPDFEKLF-KVRQTWAEQTGESADSVE---LSMGMSDDFLQAIHQGATSVRVGS
Y395_HELPY      KHLKLKGLMCIAHTDDEKEIEKSFITTKKLFDQIK-------NASVLSMGMSDDFELAIACGANLLRIGS
Y395_HELPJ      KRLKLKGLMCIGAHTDDEKIEKSFTTTKKLFDQIK-------NASVLSMGMSDDFELAIACGANLLRIGS
Y549_BUCAI      PNLNLRGIMAVIKTNVIENNLQY----EKIKTIFNRFKRQYSSVDTLSLGTSVDIKESLLATSNMVRIGR
Y2153_CORGL     THLRFEGLMCVPPLGWGPE--KAFSQARDVLSGLEEHFDRSLEF---SAGMSGDLVAAIKHGSTIVRVGT
Y1368_DEIRA     TGLEVRGLMAMAPYDDEARAAQVFADT--------ARQAQDLGLVELSMGMSGDYPLAVAAGATLVRVGR
Y497_BUCBP      DNLNLRGIMAMYFKNTYLEQIQSYKYIHLYFDILKKKYTY---IDTVSLGTSHDIQAALYSGSTLLRIGS
Y919_MYCLE      KSLELVGLMGIPPLGWNPD--QAFEQLRLEHRRVLRSHPDAIG---LSAGMSNDFEIAVKHGSTCVRVGT
Y2172_MYCBO     EGLELVGLMGIPPLDWDPD--EAFDRLQSEHNRVRAMFPHAIG---LSAGMSNDLEVAVKHGSTCVRVGT
Y2148_MYCTU     EGLELVGLMGIPPLDWDPD--EAFDRLQSEHNRVRAMFPHAIG---LSAGMSNDLEVAVKHGSTCVRVGT


                         .         .         .         +         .         .         .:280
query           GIFGKRLYK
Y274_AQUAE      LLFGERKY-
Y556_SYNY3      ILFGDRL--
YPI1_VIBAL      AIFGARDY-
Y112_PASMU      AIFGARDY-
YLME_BACSU      SLVG-----
Y090_HAEIN      AIFGARNY-
YGGS_ECOLI      AIFGARDY-
YGGS_ECOL6      AIFGARDY-
YGGS_ECO57      AIFGARDY-
Y461_VIBCH      AIFGERDY-
YKC9_SCHPO      SIFGSR---
PROSC_HUMAN     TIFGERDY-
PROSC_PONAB     MIFGERDY-
PROSC_MOUSE     TIFGERDY-
PROSC_BOVIN     TIFGERDY-
YBD6_YEAST      DIFGAR---
Y531_BUCAP      FIF------
Y394_PSEAE      ALFGARDY-
PROSC_DICDI     AIFGERDY-
PROSC_CAEEL     KLFGAREYK
Y395_HELPY      FLF------
Y395_HELPJ      FLF------
Y549_BUCAI      NIF------
Y2153_CORGL     EILGNR---
Y1368_DEIRA     SLF------
Y497_BUCBP      SIF------
Y919_MYCLE      ALLG-----
Y2172_MYCBO     ALLGPR---
Y2148_MYCTU     ALLGPR---