[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81626.1

[Show Plain Result]


## Summary of Sequence Search
    1::116
  629::728     4e-11  32%  926 aa  SPAG1_HUMAN RecName: Full=Sperm-associated antigen 1;AltName:
  132::228     1e-10  35%  639 aa  TOM71_YEAST RecName: Full=Protein TOM71;AltName: Full=71 kDa
   42::134     2e-09  35%  314 aa  STUB1_CHICK RecName: Full=STIP1 homology and U box-containing
  498::583     2e-09  29%  833 aa  IFT88_HUMAN RecName: Full=Intraflagellar transport protein 88
  105::164     3e-09  43%  617 aa  TOM70_YEAST RecName: Full=Mitochondrial import receptor subunit
  105::164     3e-09  43%  617 aa  TOM70_YEAS7 RecName: Full=Mitochondrial import receptor subunit
  611::671     1e-08  43%  893 aa  SPAG1_RAT RecName: Full=Sperm-associated antigen 1;AltName:
   32::123     4e-08  31%  303 aa  STUB1_HUMAN RecName: Full=STIP1 homology and U box-containing
  612::669     6e-08  38%  901 aa  SPAG1_MOUSE RecName: Full=Sperm-associated antigen 1;AltName:
  489::574     6e-08  27%  824 aa  IFT88_MOUSE RecName: Full=Intraflagellar transport protein 88
   85::168     6e-08  47%  385 aa  CNS1_YEAST RecName: Full=Hsp70/Hsp90 co-chaperone CNS1;AltName:
  249::331     8e-08  29%  564 aa  STI1L_PLAF7 RecName: Full=STI1-like protein;
   18::128     1e-07  33%  538 aa  PPP5_ARATH RecName: Full=Serine/threonine protein phosphatase 5;   
  199::276     1e-07  32%  309 aa  TOM34_PONAB RecName: Full=Mitochondrial import receptor subunit
  199::276     1e-07  32%  309 aa  TOM34_HUMAN RecName: Full=Mitochondrial import receptor subunit
   33::124     1e-07  31%  304 aa  STUB1_MOUSE RecName: Full=STIP1 homology and U box-containing
  294::351     1e-07  47%  420 aa  DYXC1_MOUSE RecName: Full=Dyslexia susceptibility 1 candidate gene
  188::286     2e-07  33%  391 aa  RAPI_BACSU RecName: Full=Response regulator aspartate phosphatase
    7::68      3e-07  35%  591 aa  STI1_SCHPO RecName: Full=Heat shock protein sti1 homolog;
   96::189     4e-07  26%  313 aa  SGTA_BOVIN RecName: Full=Small glutamine-rich tetratricopeptide
   69::160     9e-07  27%  387 aa  Y425_SYNP2 RecName: Full=TPR repeat-containing protein
  396::484     9e-07  30% 1390 aa  CYC8_DICDI RecName: Full=General transcriptional corepressor trfA;
   32::137     2e-06  27%  206 aa  YRRB_BACSU RecName: Full=TPR repeat-containing protein yrrB;
   96::189     2e-06  26%  314 aa  SGTA_RAT RecName: Full=Small glutamine-rich tetratricopeptide
   97::190     2e-06  26%  315 aa  SGTA_MOUSE RecName: Full=Small glutamine-rich tetratricopeptide
   96::189     2e-06  26%  313 aa  SGTA_HUMAN RecName: Full=Small glutamine-rich tetratricopeptide
  199::281     2e-06  30%  309 aa  TOM34_RAT RecName: Full=Mitochondrial import receptor subunit
  228::328     2e-06  34%  476 aa  DNJC7_SCHPO RecName: Full=DnaJ homolog subfamily C member 7
  565::648     2e-06  32% 1102 aa  CYC8_SCHPO RecName: Full=General transcriptional corepressor ssn6;
  174::227     2e-06  42% 1173 aa  CTR9_MOUSE RecName: Full=RNA polymerase-associated protein CTR9
  174::227     2e-06  42% 1173 aa  CTR9_HUMAN RecName: Full=RNA polymerase-associated protein CTR9
  204::299     4e-06  24%  567 aa  Y1428_METJA RecName: Full=TPR repeat-containing protein MJ1428;
  199::271     4e-06  32%  309 aa  TOM34_MOUSE RecName: Full=Mitochondrial import receptor subunit
  365::464     4e-06  25%  543 aa  STIP1_CRIGR RecName: Full=Stress-induced-phosphoprotein 1;       
  365::464     5e-06  25%  543 aa  STIP1_RAT RecName: Full=Stress-induced-phosphoprotein 1;       
  365::464     5e-06  25%  543 aa  STIP1_MOUSE RecName: Full=Stress-induced-phosphoprotein 1;       
  365::464     5e-06  25%  543 aa  STIP1_HUMAN RecName: Full=Stress-induced-phosphoprotein 1;       
  365::464     5e-06  25%  543 aa  STIP1_BOVIN RecName: Full=Stress-induced-phosphoprotein 1;       
  186::269     5e-06  29%  382 aa  RAPC_BACSU RecName: Full=Response regulator aspartate phosphatase
   22::129     5e-06  31%  556 aa  PPP5_SOLLC RecName: Full=Serine/threonine protein phosphatase 5;   
  387::444     6e-06  31%  569 aa  STIP_SOYBN RecName: Full=Heat shock protein STI;       
  365::460     6e-06  24%  543 aa  STIP1_MACFA RecName: Full=Stress-induced-phosphoprotein 1;       
  129::233     6e-06  30%  441 aa  F10AL_ARATH RecName: Full=FAM10 family protein At4g22670;
  444::550     8e-06  24% 1025 aa  TFC4_YEAST RecName: Full=Transcription factor tau 131 kDa
   40::115     1e-05  36%  993 aa  Z3H7B_HUMAN RecName: Full=Zinc finger CCCH domain-containing
   85::169     1e-05  32%  520 aa  TTC6_HUMAN RecName: Full=Tetratricopeptide repeat protein 6;       
  112::191     1e-05  33%  577 aa  TTC12_MACFA RecName: Full=Tetratricopeptide repeat protein 12;     
  128::237     1e-05  33%  412 aa  RAPSN_TORCA RecName: Full=43 kDa receptor-associated protein of the
  111::194     1e-05  27%  519 aa  BBS4_BOVIN RecName: Full=Bardet-Biedl syndrome 4 protein homolog;
   12::71      2e-05  37%  929 aa  UN45A_PONAB RecName: Full=Protein unc-45 homolog A;       
  150::243     2e-05  25%  334 aa  SGT_DICDI RecName: Full=Small glutamine-rich tetratricopeptide
  196::268     2e-05  31%  381 aa  RAPF_BACSU RecName: Full=Response regulator aspartate phosphatase
  310::390     2e-05  31%  564 aa  EIF3L_PANTR RecName: Full=Eukaryotic translation initiation factor
  310::390     2e-05  31%  564 aa  EIF3L_MOUSE RecName: Full=Eukaryotic translation initiation factor
  310::390     2e-05  31%  564 aa  EIF3L_HUMAN RecName: Full=Eukaryotic translation initiation factor
  310::390     2e-05  31%  564 aa  EIF3L_CHICK RecName: Full=Eukaryotic translation initiation factor
  310::390     2e-05  31%  564 aa  EIF3L_BOVIN RecName: Full=Eukaryotic translation initiation factor
  111::192     2e-05  31%  704 aa  TTC12_MOUSE RecName: Full=Tetratricopeptide repeat protein 12;     
   33::95      2e-05  29%  499 aa  PPP5_RAT RecName: Full=Serine/threonine-protein phosphatase 5;   
   33::95      2e-05  29%  499 aa  PPP5_HUMAN RecName: Full=Serine/threonine-protein phosphatase 5; 
   34::134     2e-05  26%  494 aa  DNJC7_MOUSE RecName: Full=DnaJ homolog subfamily C member
   34::134     2e-05  26%  494 aa  DNJC7_HUMAN RecName: Full=DnaJ homolog subfamily C member
  400::540     2e-05  37%  592 aa  CDC23_DICDI RecName: Full=Anaphase-promoting complex subunit 8;    
  345::455     2e-05  26%  565 aa  APC8_SCHPO RecName: Full=Anaphase-promoting complex subunit
  763::851     3e-05  36% 1316 aa  TT21B_HUMAN RecName: Full=Tetratricopeptide repeat protein 21B;    
  251::353     3e-05  32%  564 aa  STIP1_DICDI RecName: Full=Protein STIP1 homolog;
   34::134     3e-05  27%  494 aa  DNJC7_PONAB RecName: Full=DnaJ homolog subfamily C member 7;
  111::194     3e-05  27%  519 aa  BBS4_HUMAN RecName: Full=Bardet-Biedl syndrome 4 protein;
  221::296     4e-05  31%  334 aa  Y798_METJA RecName: Full=TPR repeat-containing protein MJ0798;
  126::237     4e-05  29%  412 aa  RAPSN_CHICK RecName: Full=43 kDa receptor-associated protein of the
   33::95      4e-05  29%  499 aa  PPP5_MOUSE RecName: Full=Serine/threonine-protein phosphatase 5; 
  308::365     4e-05  32%  562 aa  EIF3L_XENTR RecName: Full=Eukaryotic translation initiation factor
  174::227     4e-05  38% 1172 aa  CTR9_XENTR RecName: Full=RNA polymerase-associated protein CTR9
  174::227     4e-05  38% 1157 aa  CTR9_XENLA RecName: Full=RNA polymerase-associated protein CTR9
  143::253     5e-05  30%  624 aa  TOM70_NEUCR RecName: Full=Mitochondrial import receptor subunit
    8::75      5e-05  39%  513 aa  PPT1_YEAST RecName: Full=Serine/threonine-protein phosphatase T;   
  191::239     5e-05  37%  385 aa  FKBP5_RHIOR RecName: Full=FK506-binding protein 5;       
   27::86      7e-05  38%  944 aa  UN45A_RAT RecName: Full=Protein unc-45 homolog A;       
   27::86      7e-05  38%  944 aa  UN45A_MOUSE RecName: Full=Protein unc-45 homolog A;       
   27::86      7e-05  35%  944 aa  UN45A_HUMAN RecName: Full=Protein unc-45 homolog A;       
  112::191     7e-05  32%  705 aa  TTC12_HUMAN RecName: Full=Tetratricopeptide repeat protein 12;     
  158::268     7e-05  26%  625 aa  TOM70_SCHPO RecName: Full=Probable mitochondrial import receptor
   91::183     7e-05  29%  304 aa  SGTB_RAT RecName: Full=Small glutamine-rich tetratricopeptide
   91::183     7e-05  29%  304 aa  SGTB_MOUSE RecName: Full=Small glutamine-rich tetratricopeptide
   10::113     7e-05  26%  473 aa  PPT1_SCHPO RecName: Full=Serine/threonine-protein phosphatase T;   
  407::513     7e-05  37%  559 aa  FKB70_WHEAT RecName: Full=70 kDa peptidyl-prolyl isomerase;        
  160::233     7e-05  32%  486 aa  BBS4_DROME RecName: Full=Bardet-Biedl syndrome 4 protein homolog;
   64::118     9e-05  33% 2481 aa  TTC28_HUMAN RecName: Full=Tetratricopeptide repeat protein 28;     
  159::230     9e-05  32%  914 aa  SPY_ARATH RecName: Full=Probable UDP-N-acetylglucosamine--peptide
   91::183     9e-05  29%  304 aa  SGTB_HUMAN RecName: Full=Small glutamine-rich tetratricopeptide
  308::365     9e-05  30%  562 aa  EIF3L_XENLA RecName: Full=Eukaryotic translation initiation factor
  309::366     9e-05  30%  576 aa  EIF3L_DANRE RecName: Full=Eukaryotic translation initiation factor
  311::412     9e-05  24%  966 aa  CYC8_YEAST RecName: Full=General transcriptional corepressor
  151::207     1e-04  32%  654 aa  TTC30_ANOGA RecName: Full=Tetratricopeptide repeat protein 30
  573::643     1e-04  34%  920 aa  TMTC3_MOUSE RecName: Full=Transmembrane and TPR repeat-containing
  379::466     1e-04  31%  668 aa  SWA2_YEAST RecName: Full=Auxilin-like clathrin uncoating factor
    1::99      1e-04  21%  387 aa  SUGT1_DICDI RecName: Full=Protein SUGT1 homolog;
  679::756     1e-04  24% 1077 aa  CTR9_YEAST RecName: Full=RNA polymerase-associated protein
  411::494     1e-04  25%  626 aa  CDC23_YEAST RecName: Full=Anaphase-promoting complex subunit
  278::368     1e-04  24%  516 aa  BBS4_XENTR RecName: Full=Bardet-Biedl syndrome 4 protein homolog;
  547::631     1e-04  24%  665 aa  APC3_SCHPO RecName: Full=Anaphase-promoting complex subunit
  267::359     1e-04  28%  589 aa  STI1_YEAST RecName: Full=Heat shock protein STI1;
  150::221     1e-04  32%  944 aa  SPY_HORVU RecName: Full=Probable UDP-N-acetylglucosamine--peptide
  274::346     1e-04  38%  456 aa  FKBP5_MOUSE RecName: Full=FK506-binding protein 5;       
  237::347     1e-04  25%  539 aa  DNJC7_DICDI RecName: Full=DnaJ homolog subfamily C member 7
  372::476     1e-04  28%  597 aa  CDC23_HUMAN RecName: Full=Cell division cycle protein 23
  372::476     1e-04  28%  597 aa  CDC23_BOVIN RecName: Full=Cell division cycle protein 23
  114::169     2e-04  30%  761 aa  Y1088_AQUAE RecName: Full=Uncharacterized protein aq_1088;
  242::337     2e-04  31%  672 aa  GPSM2_MOUSE RecName: Full=G-protein-signaling modulator 2;AltName:
   14::73      3e-04  25%  252 aa  STI1L_PLAFA RecName: Full=STI1-like protein;Flags: Fragment;
  164::235     3e-04  30%  932 aa  SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide
   89::146     3e-04  31%  317 aa  SGT2_SCHPO RecName: Full=Small glutamine-rich tetratricopeptide
  126::237     3e-04  29%  412 aa  RAPSN_MOUSE RecName: Full=43 kDa receptor-associated protein of the
  535::596     3e-04  31%  645 aa  PEX5_CHICK RecName: Full=Peroxisomal targeting signal 1 receptor;  
  242::337     3e-04  30%  677 aa  GPSM2_HUMAN RecName: Full=G-protein-signaling modulator 2;AltName:
   44::103     3e-04  27%  503 aa  DNJC3_CHICK RecName: Full=DnaJ homolog subfamily C member 3;Flags:
  111::194     3e-04  25%  520 aa  BBS4_MOUSE RecName: Full=Bardet-Biedl syndrome 4 protein homolog;
   34::118     3e-04  28%  158 aa  YCF3_CYAME RecName: Full=Photosystem I assembly protein ycf3;
  164::217     3e-04  33%  931 aa  SPY_SOLLC RecName: Full=Probable UDP-N-acetylglucosamine--peptide
  219::294     3e-04  38%  364 aa  PPID_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
  580::668     3e-04  30%  758 aa  CDC27_YEAST RecName: Full=Anaphase-promoting complex subunit
  372::466     3e-04  26%  597 aa  CDC23_MOUSE RecName: Full=Cell division cycle protein 23
  125::218     4e-04  24%  239 aa  TTC9B_MOUSE RecName: Full=Tetratricopeptide repeat protein 9B;     
  150::221     4e-04  31%  927 aa  SPY_ORYSJ RecName: Full=Probable UDP-N-acetylglucosamine--peptide
  449::517     4e-04  26% 1389 aa  SKI3_SCHPO RecName: Full=Superkiller protein 3;
   52::102     6e-04  38%  173 aa  YCF3_SYNJA RecName: Full=Photosystem I assembly protein ycf3;
   29::101     6e-04  32%  171 aa  YCF3_EMIHU RecName: Full=Photosystem I assembly protein ycf3;
   91::195     6e-04  39%  921 aa  Y8921_DICDI RecName: Full=Putative uncharacterized protein
  217::317     6e-04  28%  342 aa  Y856_MIMIV RecName: Full=Putative TPR repeat-containing protein
   11::74      6e-04  31%  314 aa  Y1345_METJA RecName: Full=TPR repeat-containing protein MJ1345;
  407::511     6e-04  29%  947 aa  TEX11_MOUSE RecName: Full=Testis-expressed sequence 11 protein;
  118::192     6e-04  27%  318 aa  SOLR_CLOAB RecName: Full=Sol locus transcriptional repressor;
  291::397     6e-04  28%  657 aa  RPAP3_XENTR RecName: Full=RNA polymerase II-associated protein 3;
  291::397     6e-04  28%  660 aa  RPAP3_XENLA RecName: Full=RNA polymerase II-associated protein 3;
  126::237     6e-04  29%  412 aa  RAPSN_HUMAN RecName: Full=43 kDa receptor-associated protein of the
  101::171     6e-04  29%  431 aa  RAPH_BACSU RecName: Full=Response regulator aspartate phosphatase
  463::521     6e-04  27%  576 aa  PEX5_PICPA RecName: Full=Peroxisomal targeting signal receptor;    
  409::512     6e-04  31%  551 aa  FKB70_ARATH RecName: Full=70 kDa peptidyl-prolyl isomerase;        
  314::431     7e-04  27%  770 aa  TTC14_HUMAN RecName: Full=Tetratricopeptide repeat protein 14;     
  636::697     7e-04  29%  926 aa  TMTC3_DROME RecName: Full=Transmembrane and TPR repeat-containing
  529::590     7e-04  29%  639 aa  PEX5_MOUSE RecName: Full=Peroxisomal targeting signal 1 receptor;  
  529::590     7e-04  29%  639 aa  PEX5_HUMAN RecName: Full=Peroxisomal targeting signal 1 receptor;  
  490::548     7e-04  31%  603 aa  PEX5_DEBHA RecName: Full=Peroxisomal targeting signal receptor;    
  530::591     7e-04  29%  640 aa  PEX5_CRIGR RecName: Full=Peroxisomal targeting signal 1 receptor;  
  530::591     7e-04  29%  640 aa  PEX5_CAVPO RecName: Full=Peroxisomal targeting signal 1 receptor;  
  530::591     7e-04  29%  640 aa  PEX5_BOVIN RecName: Full=Peroxisomal targeting signal 1 receptor;  
  234::347     7e-04  32%  366 aa  FKBP6_DICDI RecName: Full=FK506-binding protein 6;       
  324::386     7e-04  30%  668 aa  EIF3L_USTMA RecName: Full=Eukaryotic translation initiation factor
  149::205     0.001  28%  659 aa  TTC30_AEDAE RecName: Full=Tetratricopeptide repeat protein 30
    1::65      0.001  33%  111 aa  TAH1_YEAST RecName: Full=TPR repeat-containing protein associated
  462::526     0.001  29%  562 aa  SYR_XANC5 RecName: Full=Arginyl-tRNA synthetase;       
  462::526     0.001  29%  562 aa  SYR_XANAC RecName: Full=Arginyl-tRNA synthetase;       
  120::177     0.001  33%  289 aa  SNAA_VITVI RecName: Full=Alpha-soluble NSF attachment protein;     
  149::211     0.001  32% 2999 aa  LBA1_MOUSE RecName: Full=Lupus brain antigen 1;
  319::346     0.001  46%  457 aa  FKBP5_SAIBB RecName: Full=FK506-binding protein 5;       
  319::346     0.001  46%  457 aa  FKBP5_SAGOE RecName: Full=FK506-binding protein 5;       
  319::346     0.001  46%  457 aa  FKBP5_HUMAN RecName: Full=FK506-binding protein 5;       
  319::346     0.001  46%  457 aa  FKBP5_CERAE RecName: Full=FK506-binding protein 5;       
  319::346     0.001  46%  457 aa  FKBP5_AOTNA RecName: Full=FK506-binding protein 5;       
  276::348     0.001  36%  459 aa  FKBP4_HUMAN RecName: Full=FK506-binding protein 4;       
 1412::1496    0.001  32% 4499 aa  DYHA_CHLRE RecName: Full=Dynein alpha chain, flagellar outer
    1::116

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYF
SPAG1_HUMAN     -----EGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNKAF
TOM71_YEAST     ----NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDSKAL
STUB1_CHICK     -----QGNRLFGGRKYPEAAAAYGRAINRNPLVAVYYTNRALCYLKMQQHDKALADCKRALELGQSVKAH
IFT88_HUMAN     ----NKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNIGLTYEKLNRLDEALDCFLKLHAILRNSEVL
TOM70_YEAST     -----KGNQFFRNKKYDDAIKYYNWALELKEDPVF-YSNLSACYVSVGDLKKVVEMSTKALELKPD----
TOM70_YEAS7     -----KGNQFFRNKKYDDAIKYYNWALELKEDPVF-YSNLSACYVSVGDLKKVVEMSTKALELKPD----
SPAG1_RAT       -----EGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCDKALQI--DSK--
STUB1_HUMAN     -----QGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELGQSVKAH
SPAG1_MOUSE     -----EGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQI-------
IFT88_MOUSE     ----NKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNIGLTYKKLNRLDEALDSFLKLHAILRNSQVL
CNS1_YEAST      --NFKKGNELYKAKRFKDARELYSKGLAV-ECEDKSYANRAACELELKNYRRCIEDCSKALTIYRTSKAF
STI1L_PLAF7     -----KGNEFYKQKKFDEALKEYEEAIQINPNDIMYHYNKAAVHIEMKNYDKAVETCLYAIE----NRYN
PPP5_ARATH      ----SQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLEEYGSAIQDASKAIEV--DSRYY
TOM34_PONAB     -----EGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLGKNVKAF
TOM34_HUMAN     -----EGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLGKNVKAF
STUB1_MOUSE     -----QGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELGQSVKAH
DYXC1_MOUSE     -----KGNKLFATENYLAAVDAYNLAIRLN-CKIPLLYNRAACHLKLKNLHKAIEDSSKALEL-------
RAPI_BACSU      ---FIVAGNLIDSLEYERALEQFLKSLEIEHLIAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHL
STI1_SCHPO      ----AKGNAAFSKKDYKTAIDYFTQAIGLDERNHILYSNRSACYASEKDYADALKDATKCTELKPD----
SGTA_BOVIN      ----TEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPSSKAY
Y425_SYNP2      -----QGNEQLTNRNFAQAVQHYRQALTLEANNARIHGALGYALSQLGNYSEAVTAYRRATELEDDNAEF
CYC8_DICDI      -------NPLFTNQEY--AINYLMRSIDSDSSDAQTWYLLGRCYMTQQKYKKAYDAYQQA--VYRDGRFW
YRRB_BACSU      -------NLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAMENGDLF
SGTA_RAT        ----TEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGIDPGSKAY
SGTA_MOUSE      ----TEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGIDPGSKAY
SGTA_HUMAN      ----TEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPASKAY
TOM34_RAT       -----EGNELVKKGNHKKAIEKYXXXXXXXXXXXATYSNRALCHLVLKQYKEAEKDCTEALKLGKNVKAF
DNJC7_SCHPO     ----NQGNDLFRQGNYQDAYEKYSEALDNKETVAKLYMNRATVLLRLKRPEEALSDSDNALAI--DSSYL
CYC8_SCHPO      --------------NQDLAIQYLTKSLEADDTDAQSWYLIGRCYVAQQKYNKAYEAYQQA--VYRDGRFW
CTR9_MOUSE      ----------FNKKDYRGALAYYKKALTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALEL-------
CTR9_HUMAN      ----------FNKKDYRGALAYYKKALTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALEL-------
Y1428_METJA     --DLNNGLTMIKNKDYIGALKIFNKVLQIDENSDISYYYKSVIAEIFEEYKKALEYIDKSISIFNRSLYY
TOM34_MOUSE     -----EGNDLVKKGNHKKAIEKYXXXXXXXXXXXATYSNRALCHLVLKQYKEAVKDCTEALKLGKNVKAF
STIP1_CRIGR     ----NKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTIKGY
STIP1_RAT       ----NKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTIKGY
STIP1_MOUSE     ----NKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTIKGY
STIP1_HUMAN     ----NKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTIKGY
STIP1_BOVIN     ----NKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTIKGY
RAPC_BACSU      --HFVFGVNLMDERNFEQAARHFKLALNMAQAEQRAYYNLGLCYYNQDLLDPAIDYFEKAVSTFESSRIV
PPP5_SOLLC      -------NEAFKGHKYSQAIDLYTQAIELNGENAVYYANRAFAHTKLEEYGSAIQDGTRAIEIPRYSKGY
STIP_SOYBN      -----KGNELFKQQKYPEATKHYTEAIKRNPKDAKAYSNRAACYTKLGAMPEGLKDAEKCIEL-------
STIP1_MACFA     ----NKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTIKGY
F10AL_ARATH     -----KAMEALSEGNFDEAIEHLTRAITLNPTSAIMYGNRASVYIKLKKPNAAIRDANAALEINPDSKGY
TFC4_YEAST      -----------NTDNLVEALNHFQCLYDETFSDVADYFEAATALTRAEKYKEAIDFFTPLLSLWRTTDVF
Z3H7B_HUMAN     ---FAEGNDLFREKDYKQALVQYMEGLNPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDSES---
TTC6_HUMAN      -----------------DAISHSDKGPDATAISADCLYNLGLCYMEQMTYKLAITDLTTAISMDKNSTAF
TTC12_MACFA     -----KGNEAFAEGNYETAILHYSEGLEKLKDVKVLYTNRAQAYMKLKNYEKALVDCEWALKCDEKTKAY
RAPSN_TORCA     ----SMGNAFLGLSAFQKALECFEKALDDKMLECRVCCSLGAFYVQLKDYEKALFFPCKSAELVADYGRG
BBS4_BOVIN      ---------LFLLGKHKAAIEVYNEAAKLNQKDWEICHNLGVCYIYLKQFDKAQDQLHNALHLNRHDLTY
UN45A_PONAB     -----EGNELFKCGDYGGALAAYTQALGLDQDQAVLHRNRAACYLKLEDYDKAETEASKAIE--------
SGT_DICDI       ----NEGNAKLNEGKHQEALSCYNKAILYDNTNAIYFANRAATYSALQNFEKSIEDCLEAIKRNPNGKAY
RAPF_BACSU      -------------KQYEDAISHFQKAYSMAEAEKQTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNIL
EIF3L_PANTR     ------------------------------ECQVTTYYYVGFAYLTMRRYQDAIRVFANILLYIQRTKSM
EIF3L_MOUSE     ------------------------------ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSM
EIF3L_HUMAN     ------------------------------ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSM
EIF3L_CHICK     ------------------------------ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSM
EIF3L_BOVIN     ------------------------------ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSM
TTC12_MOUSE     -----KGNEAFVRGDYETAIFFYSEGLGKLKDMKVLYTNRAQAFIKLGDYQKALVDCDWALKCDENTKAY
PPP5_RAT        ----TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIEL--DKKY-
PPP5_HUMAN      ----TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIEL--DKKY-
DNJC7_MOUSE     -----QGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFREALGDAQQSVRL-DDSRGH
DNJC7_HUMAN     -----QGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRL-DDSRGH
CDC23_DICDI     ------GHEFLEIKNVSAAINAYRKAVDINPRDYRAWYGAGGCYEFIERIPEAIKCYERAEENYDRERVA
APC8_SCHPO      ------GNYYSLLSEHEKAVTYFKRALQLNRNYLSAWTLMGHEYVELKNTHAAIESYRLAVDVRKDYRAW
TT21B_HUMAN     ------GKALIKTHNYSMAITYYEAALKTGQ-KNYLCYDLAELLLKLKWYDKAEKVLQHALALMEDGRCQ
STIP1_DICDI     ------GNKAYAKKEFEQAIVHYDKAVELDSSDILAMNNKAAVLIEQQKLDEAIETCKKALEKAQESKVY
DNJC7_PONAB     -----QGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRL-DDSFVR
BBS4_HUMAN      ---------LFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTY
Y798_METJA      ------------------AINYFKKALELKPDDIDLILKVAFTYFKLKKYKHALKYFEKALKLFELEQIY
RAPSN_CHICK     --SLSMGNAFLGLSIFQKALECFEKALDDKMLECRVCCSLGNFYAQIKDYEKALFFPCKAAELVND--YG
PPP5_MOUSE      ----TQANDYFKAKDYENAIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYALGDATRAIEL--DKKY-
EIF3L_XENTR     ------------------------------ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSM
CTR9_XENTR      ----------FNKKDYRGALAYYKKALTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDL-------
CTR9_XENLA      ----------FNKKDYRGALAYYKKALTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDL-------
TOM70_NEUCR     ------GNKAYGSKDFNKAIDLYSKAI---ICKPDPVYNRAACHNALAQWEQVVADTTAALKL--DPHYV
PPT1_YEAST      -----------------------------DRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLSTQSIYF
FKBP5_RHIOR     -------------KHYDHAIEVCQKALDRDMTKIKAYYRIGQAYMEKGDYESSLTFIRIGLE--------
UN45A_RAT       -----EGNELFKCGDYEGALTAYTQALSQDQAILHR--NRAACHLKLEDYSKAESEASKAIE--------
UN45A_MOUSE     -----EGNELFKCGDYEGALTAYTQALSQDQAILHR--NRAACHLKLEDYSKAESEASKAIE--------
UN45A_HUMAN     -----EGNELFKCGDYGGALAAYTQALGLDQDQAVLHRNRAACHLKLEDYDKAETEASKAIE--------
TTC12_HUMAN     -----KGNEAFAEGNYETAILRYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWALKCDEKTKAY
TOM70_SCHPO     ------GNKAYGQKEYANAIDYYTQAITCSHDPIF-FSNRAACYAAIGDFEQVIKDTSEALSL--DSSYV
SGTB_RAT        -----EGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAI--DSKYY
SGTB_MOUSE      -----EGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAI--DSKYY
PPT1_SCHPO      ----NEANKFLKEGHIVQAIDLYTKAIELDSTNAILYSNRSLAHLKSEDYGLAINDASKAIECDPEAKAY
FKB70_WHEAT     -----EGNALFKSGKYARASKRYEKAAQSKQLKITCNLNNAACKLKLKDYKQAEKLCTKVLEL--DSR--
BBS4_DROME      ------------SQQQDEARTYFELAVQSGR-KLESYVRLAELYRKDKQYQKAIEILENCLHLTENSEVL
TTC28_HUMAN     -----QSNQACHDGDFHTAIVLYNEALAVDPQNCILYSNRSAAYMKIQQYDKALDDAIKA----------
SPY_ARATH       ------GTSLKLAGNTQEGIQKYYEALKIDPHYAPAYYNLGVVYSEMMQYDNALSCYEKALERPMYAEAY
SGTB_HUMAN      -----EGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIKDCEKAIAI--DSKYY
EIF3L_XENLA     ------------------------------ECQVTTYYYVGFAYLMMRRYQDSIRVFANILLYIQRTKSM
EIF3L_DANRE     ------------------------------ECQITTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTRNM
CYC8_YEAST      --------------DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNYISEVW
TTC30_ANOGA     -----EGCLLYQANMYEDALQRYVSALQAGGFNPHVAYNAALCHYRRKENSQALNYIAEIVE--------
TMTC3_MOUSE     ----SRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVYIELKEPNEALKNFNRALELNPKHKLL
SWA2_YEAST      ----AKGTSLFKNGDYINSLQEYEKSLNNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSKAK
SUGT1_DICDI     MEQLKEGNSYFVDEQYDEALKCYDKACLELSNNAEAFFKRSQCHSKLSNLKEALSDINTSIKLSNNSKYY
CTR9_YEAST      --------------SYLKAIQLYQKVLQVDPFNIFAAQGLAIIFAESKRLGPALEILRKVRDSLDNEDVQ
CDC23_YEAST     -------------QEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICRDFKAW
BBS4_XENTR      ----------YGKKKYVAAISCLKRALYLSPFDWRVLYNLGLVHLSMQQYASAFHFLSAAISLHHNAGLY
APC3_SCHPO      -------------KDYKKALDFYDRACKLDEKSSLARFKKAKVLILLHDHDKALVELEQLKAIAPDANVH
STI1_YEAST      ----AEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEK-GEYETAISTLNDAVEQGRESKSF
SPY_HORVU       ------GTSLKLAGNTEDGIQKYCEALEVDSHYAPAYYNLGVVYSEMMQFDVALTCYEKALERPLYAEAY
FKBP5_MOUSE     -----KGTVYFKGGKYTQAVIQYRKGLSEKESKASAFLNLAMCYLKLREYNKAVECCDKALGL-------
DNJC7_DICDI     -SKKKEGNEYFQSKNYQAAYDSFTEALSIDTMNSQLYSNRAAALVHLNRISEAINDCTSAVTIDPNGKAY
CDC23_HUMAN     ------GHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRNDSRML
CDC23_BOVIN     ------GHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRNDSRML
Y1088_AQUAE     ----------YSQGKLEEAQHYWERALSLNPNKVEILYNLGVLHLNKGELEKALDLFERALRLKPD----
GPSM2_MOUSE     ------GNAYIFLGEFETASEYYKKTLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKAC
STI1L_PLAFA     ------GNKCFQEGKYEEAVKYFSDAITNDPLDHVLYSNLSGAFASLGRFYEALESANKCISIKKD----
SPY_PETHY       ------GTSLKLAGNSQEGIQKYYEAIKIDSHYAPAYYNLGVVYSEMMQYDMALNCYEKAIERPMYAEAY
SGT2_SCHPO      -----EGNNAIAAKDYQKALDLYTKAIEIDPTSPVYYSNRAAAYNQLGQFENAVEDALTCLSL-------
RAPSN_MOUSE     --SLSMGNAFLGLSLFQKALESFEKALDDTMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVND--YG
PEX5_CHICK      ------GATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALHMQQKSR--
GPSM2_HUMAN     ------GNAYIFLGEFETASEYYKKTLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQEGRAC
DNJC3_CHICK     ------GKKLLAAGQLADALSHFHAAIEGDSDNYIAYYRRATVYLAMGKSKAAIRDLSKVVELKQD----
BBS4_MOUSE      ---------LFLLGKHKAATEVYNEAAKLNQKDWEICHNLGVCYTYLKQFNKAQDQLHSALQLNKHDLTY
YCF3_CYAME      --------------------------------KAFSYYREGMAAQAEGEYAQALESYYHALEFEEDSYII
SPY_SOLLC       ------GTSLKLAGNTQEGIQKYYEAIKIDSHYAPAYYNLGVVYSEMMQYDMALNCYEKA----------
PPID_RHIOR      ---FKKGDHANAAKKYLKAIRYLKPAFDENDIKIPCYLNRSMCALKLGEYSECVKVTTTVLE--YDSKY-
CDC27_YEAST     -----QGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVL
CDC23_MOUSE     ------GHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRNDSRML
TTC9B_MOUSE     -----------------------RRLVENTEVECYDSLTACLLQSELVNYERVREYCLKVLEKQQGNKAT
SPY_ORYSJ       ------GTSLKLAGNTEEGIQKYCEALEVDSHYAPAYYNLGVVYSEMMQFDLALTCYEKALERPLYAEAY
SKI3_SCHPO      ------------------AMHYYDILLAADPRNYHALLGKGLVQIENEQYSDAVKTLGLLLDDHENDPSL
YCF3_SYNJA      ---------------YAEALENYREALQDDEDRSYILYNMGLIYQSNGELDKALEYYHQALEL-------
YCF3_EMIHU      -----------------------------EEKKAFSYYRYGMSAQSSGDYAEALENYYEALKLEEDSYIL
Y8921_DICDI     -------NFLTPNKNYDDLIEKFKVILLNDDIKNFNYNGQGIEYYKNKDYGNALKCYNKSLSFHLISKNS
Y856_MIMIV      ------GNDSEALEKYQESIDIFNKIFTSHQAVAFSLYGIGTVYEFRSEYSKALEKYQESLQTYKNEKYH
Y1345_METJA     ----------------------------NESILWDEYFDA----LEKRNYEKALLLIDKILEVRESPDVY
TEX11_MOUSE     ---WGKASRSVKVQKYADALHWYSYSL-----KLYEYDKADLCYLSLKQLDKAKEAIAEVEQ--KDPTHV
SOLR_CLOAB      ------------------ALKYFLRAVELQPNVGISYENLAWFYYLTGKYDKAIENFEKAISMGSTNSVY
RPAP3_XENTR     ------GNAYFKEGKYEIAIDCYSQGMEADTTNALLPANRAMAYLKIQKYKEAETDCTLAISL--DASYF
RPAP3_XENLA     ------GNAYFKEGKYEIAIECYSQGMEADNTNALLPANRAMAYLKIQKYKEAEADCTLAISL--DASYF
RAPSN_HUMAN     --SLSMGNAFLGLSVFQKALESFEKALNNDDAECRVCCSLGSFYAQVKDYEKALFFPCKAAELV--NNYG
RAPH_BACSU      -SLFFRGMYEFDQKEYVEAIGYYREAVSDDIEKAEFHFKVAEAYYHMKQTHVSMYHILQALDIYQN----
PEX5_PICPA      ------GAALANYNKPEEAVEAYSRALQLNPNFVRARYNLGVSFINMGRYKEAVEHLLTGISLHE-----
FKB70_ARATH     -SKFKGGKYSLASKRYEKAVKFYDTSFSEEELKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNKAL
TTC14_HUMAN     ------GVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALETHRNARKY
TMTC3_DROME     ----NRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPE----
PEX5_MOUSE      ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
PEX5_HUMAN      ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
PEX5_DEBHA      ------GASLANSNRSEEAVDAYFKALELKPTFVRARYNLGVSCINIGCYKEAAEHLLSGLSMHQ-----
PEX5_CRIGR      ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
PEX5_CAVPO      ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
PEX5_BOVIN      ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
FKBP6_DICDI     ------GNQFFQKSNYKKSIRHYVKSLNEMENKLLKYLNLASCNIKLKDGKRGISNCEKILELNTTAKFY
EIF3L_USTMA     -----------------------KSGLINRVTACHAYYYVGFAYLMLRRYPDCIKSFTHILVFIMRLRQY
TTC30_AEDAE     -----EGCLLFQANMFEDALQRYVSALQAGGFNPHIAYNAALCHYRKKENSQALNYIAEIVE--------
TAH1_YEAST      MSQFEKGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL---------
SYR_XANC5       ----------------------YDQAHGLAELACLDDEHSLAVMLELSRYPEVVEIAGQALEPYQIAQYL
SYR_XANAC       ----------------------YDQAHGLAELACLDDEHSLAVMLELSRYPEVVEIAGQALEPYQIAQYL
SNAA_VITVI      --------ELYELQNFEQAIIYFEKAADIYQSE-EATTAANQCNAKVAQFAAQLEQYQKAIQIYED----
LBA1_MOUSE      ----NKSNAFYNLGKWNEAFLAAKECLQWDPTYVKGYYRAGYSLLHLLQPYEAARMFFEGLRLLQRS---
FKBP5_SAIBB     -----------------------------------AFLNLAMCYLKLREYTKAVECCDKALGL-------
FKBP5_SAGOE     -----------------------------------AFLNLAMCYLKLREYAKAVECCDKALGL-------
FKBP5_HUMAN     -----------------------------------AFLNLAMCYLKLREYTKAVECCDKALGL-------
FKBP5_CERAE     -----------------------------------AFLNLAMCYLKLREYTKAVECCDKALGL-------
FKBP5_AOTNA     -----------------------------------AFLNLAMCYLKLREYTKAVECCDKALGL-------
FKBP4_HUMAN     -----RGTVYFKEGKYKQALLQYKKSFSNEEARLASHLNLAMCHLKLQAFSAAIESCNKALEL-------
DYHA_CHLRE      ---------------------------------CVSCCNREGLYANLETQERELEICKKALNDYMESKYF


                         .         .         *         .         .         .         .:140
query           FNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK
SPAG1_HUMAN     YRRALAHKGLKNYQKSLIDLNKVILLDPSIIEAK------------
TOM71_YEAST     LRRASANESLGNFTDAM--FDLSVLSLNGDFD--------------
STUB1_CHICK     FFLGQCQMEMENYDEAIRAYNLA-----------------------
IFT88_HUMAN     YQIANIYELMENPSQAIEW---------------------------
TOM70_YEAST     ----------------------------------------------
TOM70_YEAS7     ----------------------------------------------
SPAG1_RAT       ----------------------------------------------
STUB1_HUMAN     FFLGQCQLEMESYDEAIANLQRAYSL--------------------
SPAG1_MOUSE     ----------------------------------------------
IFT88_MOUSE     CQIANIYELMEDPNQAIEW---------------------------
CNS1_YEAST      FQL-------------------------------------------
STI1L_PLAF7     FKAEFIQVAKLYNRLAISYINM------------------------
PPP5_ARATH      YRRGAAYLAMGKFKDALKDFQQVKRLSPNDPDCEKAV---------
TOM34_PONAB     YRRAQAHKALKD----------------------------------
TOM34_HUMAN     YRRAQAHKALKD----------------------------------
STUB1_MOUSE     FFLGQCQLEMESYDEAIANLQRAYSL--------------------
DYXC1_MOUSE     ----------------------------------------------
RAPI_BACSU      FTLTYVEAKQQNYNVALIYF--------------------------
STI1_SCHPO      ----------------------------------------------
SGTA_BOVIN      GRMGLALSSLNKHTEAVAYYRKALELD-------------------
Y425_SYNP2      FNLGFNLAQSGDNRSAINAYQRATQL--------------------
CYC8_DICDI      CSIGVLYYQINQYRDALDAYTRAIRLN-------------------
YRRB_BACSU      YMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLA----
SGTA_RAT        GRMGLALSSLNKHAEAVAYYKKALELD-------------------
SGTA_MOUSE      GRMGLALSSLNKHAEAVAYYKKALELD-------------------
SGTA_HUMAN      GRMGLALSSLNKHVEAVAYYKKALELD-------------------
TOM34_RAT       YRRAQAYKALKDYKSSL-----------------------------
DNJC7_SCHPO     KGLAKAHEALEKWEEAVRDVQSAIELDASD----------------
CYC8_SCHPO      CSIGVLYYQINQYQDALDAYSRAIRLN-------------------
CTR9_MOUSE      ----------------------------------------------
CTR9_HUMAN      ----------------------------------------------
Y1428_METJA     AKKGDILYKLGDEEGAIEAYNKAIKLNS------------------
TOM34_MOUSE     YRRAQAY---------------------------------------
STIP1_CRIGR     TRKAAALEAMKDYTKAMDVYQKALELDSS---CKEA----------
STIP1_RAT       TRKAAALEAMKDYTKAMDVYQKALDLDSS---CKEA----------
STIP1_MOUSE     TRKAAALEAMKDYTKAMDVYQKALDLDSS---CKEA----------
STIP1_HUMAN     TRKAAALEAMKDYTKAMDVYQKALDLDSS---CKEA----------
STIP1_BOVIN     TRKAAALEAMKDYTKAMDVYQKALDLDS---NCKEA----------
RAPC_BACSU      NSLPQAYFLI------------------------------------
PPP5_SOLLC      YRRGAAYLAMGKFKDALKDFQQVKKLCPNDPDCEKAV---------
STIP_SOYBN      ----------------------------------------------
STIP1_MACFA     TRKAAALEAMKDYTKAMDVYQKALDLDSS-----------------
F10AL_ARATH     KSRGMARAMLGEWAEAAKDLHLA-----STIDYDEEISAVLKKV--
TFC4_YEAST      KPLARCYKEIESYETAKEFYELAIKSEPDDLDIRVSLAEVYYRLN-
Z3H7B_HUMAN     ----------------------------------------------
TTC6_HUMAN      YNRALCYTKIRELQMALTDYGIVLLLD-------------------
TTC12_MACFA     FHMGRANLALKNYS--------------------------------
RAPSN_TORCA     WSLKY---------KAMSRYHMAAAMDDAMECCEESMKIAL-----
BBS4_BOVIN      IMLGKIFLLKGDLDKAIEIYKKA-----------------------
UN45A_PONAB     ----------------------------------------------
SGT_DICDI       TRMGSAYTSLGKFSEAMEAYNKAIELE-------------------
RAPF_BACSU      PSLPQAYFLI------------------------------------
EIF3L_PANTR     FRTTYKYEMINKQNEQMHAL-LAIALTMYPMRIDESIHLQL-----
EIF3L_MOUSE     FRTTYKYEMINKQNEQMHAL-LAIALTMYPMRIDESIHLQL-----
EIF3L_HUMAN     FRTTYKYEMINKQNEQMHAL-LAIALTMYPMRIDESIHLQL-----
EIF3L_CHICK     FRTTYKYEMINKQNEQMHAL-LAIALTMYPMRIDESIHLQL-----
EIF3L_BOVIN     FRTTYKYEMINKQNEQMHAL-LAIALTMYPMRIDESIHLQL-----
TTC12_MOUSE     FHMGKAHVALKNYSKA------------------------------
PPP5_RAT        ----------------------------------------------
PPP5_HUMAN      ----------------------------------------------
DNJC7_MOUSE     LREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQ-----------
DNJC7_HUMAN     LREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQ-----------
CDC23_DICDI     INLAKLYQEIQNNEKAAFYYNLYYC-DQEKIDGQEIIDALL-----
APC8_SCHPO      YGLGQTYEVLDMHFYALYYFQRATALRPYDQRMWQALGNCYEKIDR
TT21B_HUMAN     VLLAKVYSKMEKLGDAI-----------------------------
STIP1_DICDI     TRLGNIYLKKNQLDDAYKAYSSAVLEDNAD----------------
DNJC7_PONAB     GRLGKCHLSLGNAMAACRSFQRALELDHKNAQAQQ-----------
BBS4_HUMAN      IMLGKIHLLEGDLDKAIEVYKKA-----------------------
Y798_METJA      ESMGRIYIYLGEDEKAIECF--------------------------
RAPSN_CHICK     AGWSLKYRAMSQYHMAVAYRKLGRLADAMDC-CEESMKIAL-----
PPP5_MOUSE      ----------------------------------------------
EIF3L_XENTR     FRTTYKYEMINKQNEQM-----------------------------
CTR9_XENTR      ----------------------------------------------
CTR9_XENLA      ----------------------------------------------
TOM70_NEUCR     KALANAYDQLSRYRHALLDFTASCIIDGRNEQSAQAVERLLKKFAE
PPT1_YEAST      SNRAFAHFKVDNFQSALN-------------DCDEAIKL-------
FKBP5_RHIOR     ----------------------------------------------
UN45A_RAT       ----------------------------------------------
UN45A_MOUSE     ----------------------------------------------
UN45A_HUMAN     ----------------------------------------------
TTC12_HUMAN     FHMGKANLALKNYS--------------------------------
TOM70_SCHPO     KALSAAYEQLGKLDEALMDSTVSCIFDGANESMTATVERLLKKVAE
SGTB_RAT        GRMGLALTAMNKFEEAVTSYQKALDLD-------------------
SGTB_MOUSE      GRMGLALTAMNKFEEAVTSYQKALDLD-------------------
PPT1_SCHPO      FRRATAHIAIFQPKEAVGDFRKALALAPSDPAARKKL---------
FKB70_WHEAT     -NVKALY------RRAQAYTQLA-DLELAEVDIKKALEI-------
BBS4_DROME      IEISVLYLKINETQKA------------------------------
TTC28_HUMAN     ----------------------------------------------
SPY_ARATH       CNMGVIY---------------------------------------
SGTB_HUMAN      GRMGLALTALNKFEEAVTSYQKALDLD-------------------
EIF3L_XENLA     FRTTYKYEMINKQNEQM-----------------------------
EIF3L_DANRE     FRTTYKYEMINKQNEQM-----------------------------
CYC8_YEAST      YDLGTLYETCNNQSDALDAYKQAARLDVNNVHIRERLEALTKQL--
TTC30_ANOGA     ----------------------------------------------
TMTC3_MOUSE     FNSA------------------------------------------
SWA2_YEAST      WKNKI------SNSDPERSFNDIW----------------------
SUGT1_DICDI     LKKGQLCFELEEFDTALKTFEKGQSIDS------------------
CTR9_YEAST      LNLAHCYLEMREYGKAIENYEL------------------------
CDC23_YEAST     FGLGQAYALLDMHLYSLYYFQKACTL--------------------
BBS4_XENTR      MLLAVALTYLDDIENAKSSYQQAASLDQTD----------------
APC3_SCHPO      FLLGKIFKQMRKKNLALKHFTIAWNLD-------------------
STI1_YEAST      ARIGNAYHKLGDLKKTIEYY--------------------------
SPY_HORVU       CNMGVIY---------------------------------------
FKBP5_MOUSE     ----------------------------------------------
DNJC7_DICDI     IRRAQCQMKQENYEDAVRDYEKAQSLDPENGELQRNI---------
CDC23_HUMAN     VALGECYEKLNQLVEAKKCYWRAYAVG----DVEKMALVKLAKL--
CDC23_BOVIN     VALGECYEKLNQLVEAKKCYWRAYAVG----DVEKMALVKLAKL--
Y1088_AQUAE     ----------------------------------------------
GPSM2_MOUSE     WSLGNAYTALGNHDQAMHF---------------------------
STI1L_PLAFA     ----------------------------------------------
SPY_PETHY       CNMGVIY---------------------------------------
SGT2_SCHPO      ----------------------------------------------
RAPSN_MOUSE     KGWSLKYRAMSQYHMAVAY-RLLGHLGSAMECCEESMKIAL-----
PEX5_CHICK      ----------------------------------------------
GPSM2_HUMAN     WSLGNAYTALGNHDQAMHF---------------------------
DNJC3_CHICK     ----------------------------------------------
BBS4_MOUSE      IMLGKIHLLQGDLDKAIEIYKKA-----------------------
YCF3_CYAME      YNIGLIYASNGEDEQALEYYHQALELNPRLVQALNNIAVIYHK---
SPY_SOLLC       ----------------------------------------------
PPID_RHIOR      ----------------------------------------------
CDC27_YEAST     --ICCCLEKLGYKEKALQYYELA-----------------------
CDC23_MOUSE     VALGECYEKLNQLVEAKKCYWRAYAVGDVE----------------
TTC9B_MOUSE     YRAGIAFYHLGDYARALRYLQEARSREPTDTNVLRYIQLTQLKMNR
SPY_ORYSJ       CNMGVIY---------------------------------------
SKI3_SCHPO      SELSWCYFKTGNLPKAI-----------------------------
YCF3_SYNJA      ----------------------------------------------
YCF3_EMIHU      YNIGLIYGNNGDYSKSLDYYHQALDLNS------------------
Y8921_DICDI     LNLAILYSKLNNGPKAI-----------------------------
Y856_MIMIV      YDIASCYKLSGNDNESTTYLNQA-----------------------
Y1345_METJA     VRKARILRTLGENDKALEYFDKALKL--------------------
TEX11_MOUSE     FTRYYIFKIAIMEGDAFRALQVVSALKKSLMDGE------------
SOLR_CLOAB      RSLGITYAKIGDYKKSEEYLKKA-----------------------
RPAP3_XENTR     ARRGTARIMLGKQKEAKEDFEMVLKLDPGN----KQAVLELEKISR
RPAP3_XENLA     ARRGTASIMLGKQKEAKEDFEMVLKLDPGN----KQAVLELAKISQ
RAPSN_HUMAN     KGWSLKYRAMSQYHMAVAY-RLLGRLGSAMECCEESMKIAL-----
RAPH_BACSU      ----------------------------------------------
PEX5_PICPA      ----------------------------------------------
FKB70_ARATH     YRRAQAYMELSD-------------LDLAEFDVKKALEI-------
TTC14_HUMAN     L----CQTLVERGGQAESYYKKALALDETFKDAEDALQKLHKYMQK
TMTC3_DROME     ----------------------------------------------
PEX5_MOUSE      ----------------------------------------------
PEX5_HUMAN      ----------------------------------------------
PEX5_DEBHA      ----------------------------------------------
PEX5_CRIGR      ----------------------------------------------
PEX5_CAVPO      ----------------------------------------------
PEX5_BOVIN      ----------------------------------------------
FKBP6_DICDI     YRMGQAYSLNKQYDSAKRCLVQAIRLEPND----------------
EIF3L_USTMA     HTRSYQYDQINKTA--------------------------------
TTC30_AEDAE     ----------------------------------------------
TAH1_YEAST      ----------------------------------------------
SYR_XANC5       RELAHAFHTWYHNSKVL-----------------------------
SYR_XANAC       RELAHAFHTWYHNSKVL-----------------------------
SNAA_VITVI      ----------------------------------------------
LBA1_MOUSE      ----------------------------------------------
FKBP5_SAIBB     ----------------------------------------------
FKBP5_SAGOE     ----------------------------------------------
FKBP5_HUMAN     ----------------------------------------------
FKBP5_CERAE     ----------------------------------------------
FKBP5_AOTNA     ----------------------------------------------
FKBP4_HUMAN     ----------------------------------------------
DYHA_CHLRE      VSSADLLDILSNGNNPMRHMNKCFAIDNVRLDSEEVV---------