[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81632.1

[Show Plain Result]


## Summary of Sequence Search
    1::507
  354::576     7e-32  36%  579 aa  PHOR_BACSU RecName: Full=Alkaline phosphatase synthesis sensor
  152::441     3e-30  30%  447 aa  VANS_ENTFA RecName: Full=Sensor protein vanSB;       
  206::254     1e-27  33%  611 aa  YYCG_BACSU RecName: Full=Sensor histidine kinase yycG;       
  181::509     1e-27  26%  907 aa  GACS_PSESY RecName: Full=Sensor protein gacS;         EC=2.7.13.3;
  200::254     3e-27  32%  608 aa  WALK_STAAW RecName: Full=Sensor protein kinase walK;       
    7::61      3e-27  32%  415 aa  WALK_STAAU RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAAT RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAAS RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAAR RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAAN RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAAM RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAAE RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAAC RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAAB RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAA9 RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAA8 RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAA3 RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAA2 RecName: Full=Sensor protein kinase walK;       
  200::254     3e-27  32%  608 aa  WALK_STAA1 RecName: Full=Sensor protein kinase walK;       
  378::595     5e-27  33%  608 aa  WALK_STAHJ RecName: Full=Sensor protein kinase walK;       
  202::256     9e-27  32%  610 aa  WALK_STAES RecName: Full=Sensor protein kinase walK;       
  202::256     9e-27  32%  610 aa  WALK_STAEQ RecName: Full=Sensor protein kinase walK;       
  201::255     2e-26  32%  610 aa  WALK_STAS1 RecName: Full=Sensor protein kinase walK;       
  136::466     5e-26  26%  473 aa  YCLK_BACSU RecName: Full=Sensor histidine kinase yclK;       
  186::405     4e-25  32%  419 aa  WALK_STASR RecName: Full=Sensor protein kinase walK;       
  368::583     7e-25  30%  589 aa  RESE_BACSU RecName: Full=Sensor histidine kinase resE;       
  189::451     7e-25  30%  451 aa  CSSS_BACSU RecName: Full=Sensor histidine kinase cssS;       
  192::251     2e-24  31%  583 aa  SRRB_STAAW RecName: Full=Sensor protein srrB;       
  192::251     2e-24  31%  583 aa  SRRB_STAAU RecName: Full=Sensor protein srrB;       
  192::251     2e-24  31%  583 aa  SRRB_STAAS RecName: Full=Sensor protein srrB;       
  192::251     2e-24  31%  583 aa  SRRB_STAAR RecName: Full=Sensor protein srrB;       
  192::251     2e-24  31%  583 aa  SRRB_STAAC RecName: Full=Sensor protein srrB;       
  192::251     2e-24  31%  583 aa  SRRB_STAA8 RecName: Full=Sensor protein srrB;       
  192::251     3e-24  31%  583 aa  SRRB_STAAN RecName: Full=Sensor protein srrB;       
  192::251     3e-24  31%  583 aa  SRRB_STAAM RecName: Full=Sensor protein srrB;       
  207::421     7e-24  29%  431 aa  PHOR_KLEPN RecName: Full=Phosphate regulon sensor protein phoR;    
  262::514     2e-23  28%  918 aa  BARA_SHIFL RecName: Full=Signal transduction histidine-protein
  262::514     2e-23  28%  918 aa  BARA_ECOLI RecName: Full=Signal transduction histidine-protein
  262::514     2e-23  28%  918 aa  BARA_ECOL6 RecName: Full=Signal transduction histidine-protein
  262::514     2e-23  28%  918 aa  BARA_ECO57 RecName: Full=Signal transduction histidine-protein
  964::1184    4e-22  34% 1969 aa  DHKB_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  235::432     2e-21  39%  454 aa  YKOH_BACSU RecName: Full=Sensor histidine kinase ykoH;       
 1390::1593    2e-21  32% 2150 aa  DHKA_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  161::374     3e-21  28%  443 aa  SEX3_MYCLE RecName: Full=Sensor-like histidine kinase senX3;       
  486::707     3e-21  31%  859 aa  LUXQ_VIBHA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  174::449     3e-21  28%  453 aa  ARLS_STAHJ RecName: Full=Signal transduction histidine-protein
  207::421     6e-21  29%  431 aa  PHOR_ECOLI RecName: Full=Phosphate regulon sensor protein phoR;    
  293::513     8e-21  28%  519 aa  RPRX_BACFR RecName: Full=Sensor protein rprX;         EC=2.7.13.3;
  192::437     8e-21  29%  467 aa  BAES_ECOLI RecName: Full=Signal transduction histidine-protein
  426::652     1e-20  32%  663 aa  DSPA_SYNY3 RecName: Full=Drug sensory protein A;       
  215::444     1e-20  34% 1546 aa  DHKD_DICDI RecName: Full=Hybrid signal transduction histidine
  819::1036    2e-20  27% 1055 aa  PDHS_OCHA4 RecName: Full=Cell-division control histidine kinase pdhS;
 1047::1275    2e-20  31% 1671 aa  DOKA_DICDI RecName: Full=Hybrid signal transduction protein dokA;
  127::346     3e-20  32%  351 aa  SAES_STAAE RecName: Full=Histidine protein kinase saeS;       
  127::346     3e-20  32%  351 aa  SAES_STAAC RecName: Full=Histidine protein kinase saeS;       
  127::346     3e-20  32%  351 aa  SAES_STAA8 RecName: Full=Histidine protein kinase saeS;       
  127::346     3e-20  32%  351 aa  SAES_STAA3 RecName: Full=Histidine protein kinase saeS;       
  143::364     3e-20  30%  677 aa  RPFC_XANCP RecName: Full=Sensory/regulatory protein rpfC;       
  143::364     3e-20  30%  677 aa  RPFC_XANC8 RecName: Full=Sensory/regulatory protein rpfC;       
  788::1056    3e-20  27% 1213 aa  DHKK_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  127::346     4e-20  31%  351 aa  SAES_STAAW RecName: Full=Histidine protein kinase saeS;       
  127::346     4e-20  31%  351 aa  SAES_STAAS RecName: Full=Histidine protein kinase saeS;       
  127::346     4e-20  31%  351 aa  SAES_STAAR RecName: Full=Histidine protein kinase saeS;       
  127::346     4e-20  31%  351 aa  SAES_STAAN RecName: Full=Histidine protein kinase saeS;       
  127::346     4e-20  31%  351 aa  SAES_STAAM RecName: Full=Histidine protein kinase saeS;       
  127::346     4e-20  31%  351 aa  SAES_STAAB RecName: Full=Histidine protein kinase saeS;       
  207::421     4e-20  29%  431 aa  PHOR_SHIDY RecName: Full=Phosphate regulon sensor protein phoR;    
  174::451     4e-20  25%  456 aa  ARLS_STAEQ RecName: Full=Signal transduction histidine-protein
  128::347     5e-20  31%  352 aa  SAES_STAES RecName: Full=Histidine protein kinase saeS;       
  128::347     5e-20  31%  352 aa  SAES_STAEQ RecName: Full=Histidine protein kinase saeS;       
  174::451     5e-20  25%  456 aa  ARLS_STAES RecName: Full=Signal transduction histidine-protein
  161::374     8e-20  27%  410 aa  SENX3_MYCTU RecName: Full=Sensor-like histidine kinase senX3;      
  161::374     8e-20  27%  410 aa  SENX3_MYCBO RecName: Full=Sensor-like histidine kinase senX3;      
  173::448     1e-19  28%  451 aa  ARLS_STAS1 RecName: Full=Signal transduction histidine-protein
  310::576     2e-19  31%  596 aa  CHVG_AGRT5 RecName: Full=Sensor protein chvG;         EC=2.7.13.3;
  173::442     2e-19  31%  451 aa  ARLS_STAAW RecName: Full=Signal transduction histidine-protein
  173::442     2e-19  31%  451 aa  ARLS_STAAS RecName: Full=Signal transduction histidine-protein
  173::442     2e-19  31%  451 aa  ARLS_STAAR RecName: Full=Signal transduction histidine-protein
  173::442     2e-19  31%  451 aa  ARLS_STAAN RecName: Full=Signal transduction histidine-protein
  173::442     2e-19  31%  451 aa  ARLS_STAAM RecName: Full=Signal transduction histidine-protein
  173::442     2e-19  31%  451 aa  ARLS_STAAC RecName: Full=Signal transduction histidine-protein
  173::442     2e-19  31%  451 aa  ARLS_STAAB RecName: Full=Signal transduction histidine-protein
  173::442     2e-19  31%  451 aa  ARLS_STAA8 RecName: Full=Signal transduction histidine-protein
  173::442     2e-19  31%  451 aa  ARLS_STAA3 RecName: Full=Signal transduction histidine-protein
  487::712     3e-19  28%  857 aa  LUXQ_VIBVY RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  487::712     3e-19  28%  857 aa  LUXQ_VIBVU RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  799::1013    4e-19  26% 1035 aa  PDHS_BRUSU RecName: Full=Cell-division control histidine kinase pdhS;
  799::1013    4e-19  26% 1035 aa  PDHS_BRUSI RecName: Full=Cell-division control histidine kinase pdhS;
  799::1013    4e-19  26% 1035 aa  PDHS_BRUO2 RecName: Full=Cell-division control histidine kinase pdhS;
  799::1013    4e-19  26% 1035 aa  PDHS_BRUME RecName: Full=Cell-division control histidine kinase pdhS;
  799::1013    4e-19  26% 1035 aa  PDHS_BRUAB RecName: Full=Cell-division control histidine kinase pdhS;
  799::1013    4e-19  26% 1035 aa  PDHS_BRUA2 RecName: Full=Cell-division control histidine kinase pdhS;
  799::1013    4e-19  26% 1035 aa  PDHS_BRUA1 RecName: Full=Cell-division control histidine kinase pdhS;
  799::1013    5e-19  26% 1035 aa  PDHS_BRUC2 RecName: Full=Cell-division control histidine kinase pdhS;
  150::363     7e-19  28%  384 aa  SENX3_MYCS2 RecName: Full=Signal-transduction histidine kinase
  234::513     7e-19  26%  565 aa  MTRB_MYCPA RecName: Full=Sensor histidine kinase mtrB;       
  116::368     9e-19  32%  384 aa  VANS_ENTFC RecName: Full=Sensor protein vanS;       
  483::708     9e-19  26%  857 aa  LUXQ_VIBCH RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  347::565     9e-19  31%  741 aa  ETR1_MALDO RecName: Full=Ethylene receptor;         EC=2.7.13.3;
  174::365     1e-18  30%  395 aa  DLTS_STRA3 RecName: Full=Sensor protein dltS;         EC=2.7.13.3;
  243::452     2e-18  28%  525 aa  Y1002_RHIME RecName: Full=Uncharacterized sensor-like histidine
  188::455     2e-18  27%  456 aa  HSSS_STAHJ RecName: Full=Heme sensor protein hssS;       
  424::649     2e-18  30% 1225 aa  DHKC_DICDI RecName: Full=Hybrid signal transduction histidine
  485::706     2e-18  28%  858 aa  LUXQ_VIBPA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  174::365     3e-18  30%  395 aa  DLTS_STRA5 RecName: Full=Sensor protein dltS;         EC=2.7.13.3;
  265::478     3e-18  28%  482 aa  CUSS_ECO57 RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
  418::652     4e-18  33%  653 aa  YCF26_PORYE RecName: Full=Uncharacterized sensor-like histidine
  304::527     4e-18  31%  682 aa  TCSA_EMENI RecName: Full=Two-component system protein A;       
  347::565     4e-18  31%  740 aa  ETR1_PELHO RecName: Full=Ethylene receptor 1;       
  266::489     6e-18  25%  497 aa  SILS_SALTY RecName: Full=Probable sensor kinase silS;       
  239::451     6e-18  24%  476 aa  CZCS_RALME RecName: Full=Sensor protein czcS;       
  421::655     8e-18  33%  656 aa  YCF26_PORPU RecName: Full=Uncharacterized sensor-like histidine
  347::565     1e-17  30%  738 aa  ETR1_PRUPE RecName: Full=Ethylene receptor;         EC=2.7.13.3;
  347::564     1e-17  32%  740 aa  ETR1_CUCMR RecName: Full=Ethylene receptor 1;       
  173::381     1e-17  28%  413 aa  SPHS_SYNE7 RecName: Full=Sensor protein sphS;         EC=2.7.13.3;
  234::496     1e-17  29%  567 aa  MTRB_MYCTU RecName: Full=Sensor histidine kinase mtrB;       
  234::496     1e-17  29%  567 aa  MTRB_MYCBO RecName: Full=Sensor histidine kinase mtrB;       
  220::408     1e-17  27%  428 aa  KINC_BACSU RecName: Full=Sporulation kinase C;         EC=2.7.13.3;
  265::478     2e-17  27%  480 aa  CUSS_ECOLI RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
  265::478     2e-17  27%  480 aa  CUSS_ECOL6 RecName: Full=Sensor kinase cusS;         EC=2.7.13.3;
  211::380     3e-17  30%  384 aa  SASA_MICAN RecName: Full=Adaptive-response sensory-kinase sasA;    
  158::378     3e-17  27%  382 aa  SASA_CYAA5 RecName: Full=Adaptive-response sensory-kinase sasA;    
  251::447     3e-17  31%  466 aa  PCOS_ECOLX RecName: Full=Probable sensor protein pcoS;       
  234::487     3e-17  26%  562 aa  MTRB_MYCLE RecName: Full=Sensor histidine kinase mtrB;       
  286::501     3e-17  27%  778 aa  ARCB_SHIFL RecName: Full=Aerobic respiration control sensor protein
  286::501     3e-17  27%  778 aa  ARCB_ECOLI RecName: Full=Aerobic respiration control sensor protein
  286::501     3e-17  27%  778 aa  ARCB_ECO57 RecName: Full=Aerobic respiration control sensor protein
  723::922     4e-17  31% 1238 aa  BVGS_BORBR RecName: Full=Virulence sensor protein bvgS;       
  167::387     5e-17  27%  391 aa  SASA_CYAP8 RecName: Full=Adaptive-response sensory-kinase sasA;    
  361::579     5e-17  34%  754 aa  ETR1_SOLLC RecName: Full=Ethylene receptor 1;         Short=LeETR1;
  347::565     9e-17  31%  741 aa  ETR2_PELHO RecName: Full=Ethylene receptor 2;       
  723::922     9e-17  31% 1238 aa  BVGS_BORPE RecName: Full=Virulence sensor protein bvgS;       
  723::922     9e-17  31% 1238 aa  BVGS_BORPA RecName: Full=Virulence sensor protein bvgS;       
  159::379     1e-16  30%  383 aa  SASA_SYNY3 RecName: Full=Adaptive-response sensory-kinase sasA;    
  288::554     1e-16  27%  577 aa  CHVG_RHIME RecName: Full=Sensor protein chvG;       
  198::413     1e-16  27%  425 aa  PHOR_HAEIN RecName: Full=Phosphate regulon sensor protein phoR;    
  347::600     1e-16  33%  740 aa  ETR1_CUCSA RecName: Full=Ethylene receptor 1;       
  522::733     3e-16  26%  738 aa  KINE_BACSU RecName: Full=Sporulation kinase E;       
  157::369     6e-16  27%  377 aa  SASA_SYNJB RecName: Full=Adaptive-response sensory-kinase sasA;    
  345::563     7e-16  30%  736 aa  ETR2_SOLLC RecName: Full=Ethylene receptor 2;         Short=LeETR2;
  242::446     1e-15  27%  459 aa  SPAK_BACSU RecName: Full=Sensor histidine kinase spaK;       
  332::532     2e-15  25%  597 aa  DIVJ_CAUCR RecName: Full=Histidine protein kinase divJ;       
  259::461     2e-15  26%  474 aa  CREC_ECOLI RecName: Full=Sensor protein creC;         EC=2.7.13.3;
   91::359     2e-15  29%  363 aa  BASS_ECOLI RecName: Full=Sensor protein basS;         EC=2.7.13.3;
 1757::1980    2e-15  27% 2310 aa  MAK2_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
  188::454     2e-15  25%  460 aa  HSSS_STAS1 RecName: Full=Heme sensor protein hssS;       
   90::284     4e-15  23%  311 aa  YCBM_BACSU RecName: Full=Sensor histidine kinase ycbM;       
  157::369     4e-15  26%  377 aa  SASA_SYNJA RecName: Full=Adaptive-response sensory-kinase sasA;    
  686::898     5e-15  27%  900 aa  KDPD_CLOAB RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
  345::563     5e-15  30%  738 aa  ETR1_TOBAC RecName: Full=Ethylene receptor;       
  243::431     5e-15  29%  457 aa  CPXA_ECOLI RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  243::431     5e-15  29%  457 aa  CPXA_ECOL6 RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  243::431     5e-15  29%  457 aa  CPXA_ECO57 RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  347::565     8e-15  29%  738 aa  ETR1_PASED RecName: Full=Ethylene receptor;       
  137::404     8e-15  25%  414 aa  CUTS_STRLI RecName: Full=Sensor protein cutS;         EC=2.7.13.3;
  137::404     8e-15  25%  414 aa  CUTS_STRCO RecName: Full=Sensor protein cutS;         EC=2.7.13.3;
  252::447     1e-14  27%  465 aa  ZRAS_SALTY RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  252::447     1e-14  27%  465 aa  ZRAS_SALTI RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  604::826     1e-14  27%  842 aa  PLEC_CAUCR RecName: Full=Non-motile and phage-resistance protein;  
  360::568     2e-14  29%  580 aa  YVRG_BACSU RecName: Full=Sensor histidine kinase yvrG;       
  126::317     2e-14  27%  325 aa  ARCB_HAEIN RecName: Full=Aerobic respiration control sensor protein
  473::687     3e-14  24%  949 aa  RCSC_ECOLI RecName: Full=Sensor kinase protein rcsC;       
  347::559     3e-14  30%  613 aa  ERS1_ARATH RecName: Full=Ethylene response sensor 1;       
  393::584     3e-14  29%  608 aa  ATOS_ECOLI RecName: Full=Signal transduction histidine-protein
  220::389     4e-14  30%  393 aa  SASA_CYAP7 RecName: Full=Adaptive-response sensory-kinase sasA;    
  473::687     4e-14  24%  948 aa  RCSC_SALTI RecName: Full=Sensor protein rcsC;       
 1292::1532    4e-14  25% 2062 aa  DHKJ_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  447::649     5e-14  28%  914 aa  TORS_ECO57 RecName: Full=Sensor protein torS;         EC=2.7.13.3;
  473::687     7e-14  24%  948 aa  RCSC_SALTY RecName: Full=Sensor protein rcsC;       
  198::458     7e-14  23%  484 aa  MPRB_MYCVP RecName: Full=Signal transduction histidine-protein
  379::593     9e-14  27%  595 aa  KINB_PSEAE RecName: Full=Alginate biosynthesis sensor protein kinB;
  401::605     9e-14  25%  606 aa  KINA_BACSU RecName: Full=Sporulation kinase A;       
  347::564     9e-14  26%  738 aa  ETR1_ARATH RecName: Full=Ethylene receptor 1;         Short=AtETR1;
   91::356     9e-14  29%  356 aa  BASS_SALTY RecName: Full=Sensor protein basS;         EC=2.7.13.3;
  899::1109    1e-13  25% 1124 aa  PHY_MOUSC RecName: Full=Phytochrome;
  447::649     2e-13  28%  914 aa  TORS_ECOLI RecName: Full=Sensor protein torS;         EC=2.7.13.3;
  537::749     2e-13  31%  751 aa  PHYB_ANASP RecName: Full=Cyanobacterial phytochrome B;       
  220::413     2e-13  29%  444 aa  CIAH_STRR6 RecName: Full=Sensor protein ciaH;         EC=2.7.13.3;
  220::413     2e-13  29%  444 aa  CIAH_STRPN RecName: Full=Sensor protein ciaH;         EC=2.7.13.3;
  246::458     2e-13  25%  464 aa  IRLS_BURPS RecName: Full=Sensor protein irlS;         EC=2.7.13.3;
  347::565     3e-13  25%  735 aa  ETR1_BRAOL RecName: Full=Ethylene receptor 1;         EC=2.7.13.3;
  290::504     3e-13  30%  505 aa  FIXL_BRAJA RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
  222::396     4e-13  30%  401 aa  SASA_NOSP7 RecName: Full=Adaptive-response sensory-kinase sasA;    
  536::744     4e-13  28%  765 aa  PHYA_ANASP RecName: Full=Cyanobacterial phytochrome A;       
  536::744     6e-13  24%  748 aa  PHY1_SYNY3 RecName: Full=Phytochrome-like protein cph1;       
  194::454     6e-13  22%  522 aa  MPRB_MYCPA RecName: Full=Signal transduction histidine-protein
 2488::2620    8e-13  33% 3432 aa  DHKG_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  253::472     1e-12  25%  475 aa  YFHK_ECOLI RecName: Full=Putative sensor-like histidine kinase
  242::458     1e-12  24%  469 aa  RSSA_SERMA RecName: Full=Swarming motility regulation sensor
   58::322     1e-12  25%  370 aa  GTCS_ANEMI RecName: Full=Sensor protein gtcS;         EC=2.7.13.3;
  544::734     1e-12  25%  769 aa  DIVL_CAUCR RecName: Full=Sensor protein divL;         EC=2.7.13.3;
  194::454     2e-12  22%  522 aa  MPRB_MYCA1 RecName: Full=Signal transduction histidine-protein
  839::1031    2e-12  24% 1709 aa  DHKL_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  212::396     3e-12  32%  401 aa  SASA_ANASP RecName: Full=Adaptive-response sensory-kinase sasA;    
  191::451     3e-12  22%  515 aa  MPRB_MYCSS RecName: Full=Signal transduction histidine-protein
  191::451     3e-12  22%  515 aa  MPRB_MYCSK RecName: Full=Signal transduction histidine-protein
  191::451     3e-12  22%  515 aa  MPRB_MYCSJ RecName: Full=Signal transduction histidine-protein
  284::493     3e-12  29%  505 aa  FIXL_RHIME RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
  495::633     3e-12  32% 1378 aa  DHKH_DICDI RecName: Full=Hybrid signal transduction histidine
  321::541     3e-12  23% 1109 aa  DHKF_DICDI RecName: Full=Hybrid signal transduction histidine
  212::396     4e-12  32%  401 aa  SASA_ANAVT RecName: Full=Adaptive-response sensory-kinase sasA;    
  190::452     4e-12  22%  519 aa  MPRB_MYCLE RecName: Full=Signal transduction histidine-protein
  284::498     4e-12  30%  504 aa  FIXL_AZOC5 RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
  297::478     5e-12  28%  506 aa  KIND_BACSU RecName: Full=Sporulation kinase D;       
  121::297     1e-11  27%  325 aa  YXDK_BACSU RecName: Full=Sensor histidine kinase yxdK;       
  239::429     1e-11  25%  452 aa  YEDV_ECOLI RecName: Full=Putative sensor-like histidine kinase
  159::376     1e-11  25%  380 aa  SASA_THEEB RecName: Full=Adaptive-response sensory-kinase sasA;    
  940::1099    1e-11  28% 1134 aa  PHY1_SELMA RecName: Full=Phytochrome 1;
  134::349     1e-11  29%  349 aa  NTRB_SHIFL RecName: Full=Nitrogen regulation protein NR(II);       
  134::349     1e-11  29%  349 aa  NTRB_ECOLI RecName: Full=Nitrogen regulation protein NR(II);       
  134::349     1e-11  29%  349 aa  NTRB_ECO57 RecName: Full=Nitrogen regulation protein NR(II);       
  675::817     1e-11  28% 1699 aa  DHKE_DICDI RecName: Full=Hybrid signal transduction histidine
  228::498     1e-11  22%  535 aa  AFSQ2_STRCO RecName: Full=Signal transduction histidine-protein
  205::378     2e-11  25%  387 aa  SASA_SYNE7 RecName: Full=Adaptive-response sensory-kinase sasA;    
  136::321     2e-11  25%  356 aa  YVCQ_BACSU RecName: Full=Sensor histidine kinase yvcQ;       
  134::349     3e-11  31%  349 aa  NTRB_SALTY RecName: Full=Nitrogen regulation protein NR(II);       
  134::349     3e-11  31%  349 aa  NTRB_SALTI RecName: Full=Nitrogen regulation protein NR(II);       
  217::402     3e-11  24%  428 aa  KINB_BACSU RecName: Full=Sporulation kinase B;         EC=2.7.13.3;
  190::450     4e-11  22%  504 aa  MPRB_MYCBP RecName: Full=Signal transduction histidine-protein
  190::450     4e-11  22%  504 aa  MPRB_MYCBO RecName: Full=Signal transduction histidine-protein
  149::356     5e-11  29%  372 aa  SASA_PROMP RecName: Full=Adaptive-response sensory-kinase sasA;    
  149::356     5e-11  29%  372 aa  SASA_PROM2 RecName: Full=Adaptive-response sensory-kinase sasA;    
  315::515     5e-11  25%  530 aa  PILS_PSEAE RecName: Full=Sensor protein pilS;         EC=2.7.13.3;
  190::450     5e-11  22%  504 aa  MPRB_MYCTU RecName: Full=Signal transduction histidine-protein
  190::450     5e-11  22%  504 aa  MPRB_MYCTA RecName: Full=Signal transduction histidine-protein
  196::451     5e-11  24%  492 aa  MPRB_MYCS2 RecName: Full=Signal transduction histidine-protein
  471::695     7e-11  30%  829 aa  VIRA_AGRT9 RecName: Full=Wide host range virA protein;       
  471::695     7e-11  30%  829 aa  VIRAW_RHIRD RecName: Full=Wide host range virA protein;       
  213::415     7e-11  27%  443 aa  PHOR_PSEAE RecName: Full=Phosphate regulon sensor protein phoR;    
 1789::1916    1e-10  29% 2344 aa  MAK3_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
  188::431     1e-10  26%  451 aa  HSSS_STAES RecName: Full=Heme sensor protein hssS;       
  997::1218    2e-10  25% 1639 aa  MAK1_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
  891::1105    2e-10  25% 1121 aa  PHY2_CERPU RecName: Full=Phytochrome 2;
  134::349     2e-10  29%  349 aa  NTRB_KLEOX RecName: Full=Nitrogen regulation protein ntrB;       
  190::450     3e-10  22%  511 aa  MPRB_MYCUA RecName: Full=Signal transduction histidine-protein
  255::452     4e-10  28%  465 aa  ZRAS_ECOLI RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  418::638     4e-10  29%  655 aa  Y3689_SHEFN RecName: Full=Putative sensor protein Sfri_3689;       
  233::437     5e-10  24%  447 aa  NISK_LACLA RecName: Full=Nisin biosynthesis sensor protein nisK;   
   92::345     6e-10  29%  364 aa  PMRB_PECCC RecName: Full=Sensor histidine kinase pmrB;       
  304::576     6e-10  28%  599 aa  NTRYL_RICPR RecName: Full=Putative sensor histidine kinase
  316::598     6e-10  27%  610 aa  NTRYL_RICBR RecName: Full=Putative sensor histidine kinase
  188::431     6e-10  25%  451 aa  HSSS_STAEQ RecName: Full=Heme sensor protein hssS;       
  188::432     6e-10  23%  457 aa  HSSS_STAAW RecName: Full=Heme sensor protein hssS;       
  188::432     6e-10  23%  457 aa  HSSS_STAAS RecName: Full=Heme sensor protein hssS;       
  248::443     8e-10  27%  458 aa  ZRAS_ECO57 RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  149::356     8e-10  28%  372 aa  SASA_PROMS RecName: Full=Adaptive-response sensory-kinase sasA;    
  149::356     8e-10  28%  372 aa  SASA_PROM0 RecName: Full=Adaptive-response sensory-kinase sasA;    
  668::892     8e-10  26%  894 aa  KDPD_ECOLI RecName: Full=Sensor protein kdpD;         EC=2.7.13.3;
  188::432     8e-10  23%  457 aa  HSSS_STAAT RecName: Full=Heme sensor protein hssS;       
  188::432     8e-10  23%  457 aa  HSSS_STAAE RecName: Full=Heme sensor protein hssS;       
  188::432     8e-10  23%  457 aa  HSSS_STAAC RecName: Full=Heme sensor protein hssS;       
  188::432     8e-10  23%  457 aa  HSSS_STAA8 RecName: Full=Heme sensor protein hssS;       
  188::432     8e-10  23%  457 aa  HSSS_STAA3 RecName: Full=Heme sensor protein hssS;       
  304::576     1e-09  28%  599 aa  NTRYL_RICTY RecName: Full=Putative sensor histidine kinase
  188::432     1e-09  23%  457 aa  HSSS_STAAN RecName: Full=Heme sensor protein hssS;       
  188::432     1e-09  23%  457 aa  HSSS_STAAM RecName: Full=Heme sensor protein hssS;       
  188::432     1e-09  23%  457 aa  HSSS_STAA9 RecName: Full=Heme sensor protein hssS;       
  188::432     1e-09  23%  457 aa  HSSS_STAA2 RecName: Full=Heme sensor protein hssS;       
  188::432     1e-09  23%  457 aa  HSSS_STAA1 RecName: Full=Heme sensor protein hssS;       
  188::432     1e-09  23%  457 aa  HSSS_STAAR RecName: Full=Heme sensor protein hssS;       
  188::432     1e-09  23%  457 aa  HSSS_STAAB RecName: Full=Heme sensor protein hssS;       
  304::575     2e-09  27%  599 aa  NTRYL_RICFE RecName: Full=Putative sensor histidine kinase
  185::422     3e-09  25%  487 aa  COPS_PSESM RecName: Full=Sensor protein copS;         EC=2.7.13.3;
  547::717     3e-09  21%  728 aa  BPHY_PSEAE RecName: Full=Bacteriophytochrome;       
  156::374     4e-09  26%  381 aa  SASA_PROMA RecName: Full=Adaptive-response sensory-kinase sasA;    
  304::575     4e-09  27%  599 aa  NTRYL_RICCN RecName: Full=Putative sensor histidine kinase
  251::431     5e-09  21%  462 aa  ZRAS_KLEOX RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  942::1113    5e-09  25% 1131 aa  PHY_PINSY RecName: Full=Phytochrome;
  958::1105    9e-09  27% 1136 aa  PHY_PICAB RecName: Full=Phytochrome;
  149::356     1e-08  28%  372 aa  SASA_PROM9 RecName: Full=Adaptive-response sensory-kinase sasA;    
  238::427     1e-08  25%  451 aa  QSEC_HAEIN RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  177::361     1e-08  24%  383 aa  SASA_SYNS9 RecName: Full=Adaptive-response sensory-kinase sasA;    
  154::361     2e-08  23%  370 aa  SASA_PROM3 RecName: Full=Adaptive-response sensory-kinase sasA;    
  899::1088    2e-08  23% 1132 aa  PHY1_PHYPA RecName: Full=Phytochrome 1;
  709::886     2e-08  24%  889 aa  NODV_BRAJA RecName: Full=Nodulation protein V;         EC=2.7.13.3;
  129::334     2e-08  25%  344 aa  GRAS_STAHJ RecName: Full=Sensor histidine kinase graS;       
  957::1145    3e-08  25% 1156 aa  PHYB_SOYBN RecName: Full=Phytochrome B;
  216::420     3e-08  26%  433 aa  RSTB_ECOLI RecName: Full=Sensor protein rstB;         EC=2.7.13.3;
  475::673     4e-08  27%  833 aa  VIRA_AGRT5 RecName: Full=Wide host range virA protein;       
  177::361     4e-08  24%  383 aa  SASA_SYNPX RecName: Full=Adaptive-response sensory-kinase sasA;    
  963::1130    4e-08  22% 1164 aa  PHYD_ARATH RecName: Full=Phytochrome D;
  154::361     6e-08  23%  383 aa  SASA_SYNS3 RecName: Full=Adaptive-response sensory-kinase sasA;    
  154::361     6e-08  21%  370 aa  SASA_PROMM RecName: Full=Adaptive-response sensory-kinase sasA;    
  903::1098    6e-08  25% 1132 aa  PHYB_TOBAC RecName: Full=Phytochrome B;
  901::1101    6e-08  25% 1130 aa  PHYB_SOLTU RecName: Full=Phytochrome B;
  411::622     1e-07  24%  622 aa  DCTB_RHILE RecName: Full=C4-dicarboxylate transport sensor protein
  677::836     2e-07  36% 1065 aa  TCSB_EMENI RecName: Full=Two-component system protein B;       
  970::1158    2e-07  24% 1171 aa  PHYB_ORYSJ RecName: Full=Phytochrome B;
  948::1143    3e-07  25% 1178 aa  PHYB_SORBI RecName: Full=Phytochrome B;
  970::1158    4e-07  24% 1171 aa  PHYB_ORYSI RecName: Full=Phytochrome B;
  902::1042    4e-07  24% 1131 aa  PHYB1_SOLLC RecName: Full=Phytochrome B1;
  411::621     4e-07  24%  621 aa  DCTB_RHIME RecName: Full=C4-dicarboxylate transport sensor protein
  939::1114    5e-07  24% 1124 aa  PHYA_CUCPE RecName: Full=Phytochrome A;
  553::882     5e-07  29% 1736 aa  DHKI_DICDI RecName: Full=Hybrid signal transduction histidine
  942::1095    8e-07  25% 1135 aa  PHYC_SORBI RecName: Full=Phytochrome C;
  240::441     1e-06  23%  449 aa  QSEC_SALTY RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  240::441     1e-06  23%  449 aa  QSEC_SALTI RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  267::429     2e-06  26%  507 aa  CSEC_STRCO RecName: Full=Sensor protein cseC;         EC=2.7.13.3;
  175::428     2e-06  21%  450 aa  ENVZ_SALTY RecName: Full=Osmolarity sensor protein envZ;       
  134::341     3e-06  29%  348 aa  NTRB_PROVU RecName: Full=Nitrogen regulation protein NR(II);       
  175::428     3e-06  21%  450 aa  ENVZ_SALTI RecName: Full=Osmolarity sensor protein envZ;       
  887::1087    4e-06  24% 1111 aa  PHYC_ARATH RecName: Full=Phytochrome C;
  297::401     5e-06  27%  410 aa  GLNK_BACSU RecName: Full=Sensor histidine kinase glnK;       
  134::333     7e-06  29%  350 aa  NTRB_VIBAL RecName: Full=Nitrogen regulation protein ntrB;       
  944::1097    9e-06  22% 1137 aa  PHYC_ORYSJ RecName: Full=Phytochrome C;
  944::1097    9e-06  22% 1137 aa  PHYC_ORYSI RecName: Full=Phytochrome C;
  715::920     1e-05  20% 1197 aa  EVGS_ECOLI RecName: Full=Sensor protein evgS;       
  715::920     2e-05  20% 1197 aa  EVGS_ECO57 RecName: Full=Sensor protein evgS;       
  941::1073    2e-05  28% 1122 aa  PHYA_ARATH RecName: Full=Phytochrome A;AltName: Full=Protein FAR RED
  476::697     3e-05  28%  835 aa  VIRAL_RHIRD RecName: Full=Limited host range virA protein;       
  843::932     3e-05  41% 1220 aa  SLN1_YEAST RecName: Full=Osmosensing histidine protein kinase SLN1;
  620::733     3e-05  32%  777 aa  NTRY_AZOBR RecName: Full=Nitrogen regulation protein ntrY homolog; 
  694::775     3e-05  28% 2123 aa  CYAD_DICDI RecName: Full=Adenylate cyclase,
  946::1072    3e-05  25% 1123 aa  PHYA_SOLTU RecName: Full=Phytochrome A;
  129::304     3e-05  22%  346 aa  GRAS_STAAR RecName: Full=Sensor histidine kinase graS;       
  175::428     3e-05  22%  450 aa  ENVZ_SHIFL RecName: Full=Osmolarity sensor protein envZ;       
  175::428     3e-05  22%  450 aa  ENVZ_ECOLI RecName: Full=Osmolarity sensor protein envZ;       
  948::1131    4e-05  21% 1172 aa  PHYB_ARATH RecName: Full=Phytochrome B;
  210::292     4e-05  38%  402 aa  METK_PICTO RecName: Full=S-adenosylmethionine synthetase;       
  299::358     6e-05  32%  662 aa  TLPA_BACSU RecName: Full=Methyl-accepting chemotaxis protein tlpA;
  513::703     6e-05  25%  771 aa  NTRY_AZOC5 RecName: Full=Nitrogen regulation protein ntrY;       
  124::327     8e-05  26%  334 aa  BCES_BACHD RecName: Full=Sensor protein bceS;         EC=2.7.13.3;
  240::441     1e-04  22%  449 aa  QSEC_ECO57 RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  240::441     1e-04  21%  449 aa  QSEC_ECOLI RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  965::1079    2e-04  25% 1131 aa  PHYA_SOYBN RecName: Full=Phytochrome A;
  306::359     2e-04  31%  662 aa  MCPB_BACSU RecName: Full=Methyl-accepting chemotaxis protein
  139::349     2e-04  24%  356 aa  NTRB_RHOCA RecName: Full=Nitrogen regulation protein ntrB;       
  305::354     3e-04  36%  662 aa  TLPB_BACSU RecName: Full=Methyl-accepting chemotaxis protein tlpB;
 1113::1212    4e-04  28% 2388 aa  DHKM_DICDI RecName: Full=Hybrid signal transduction histidine kinase
  958::1072    6e-04  26% 1124 aa  PHYA1_TOBAC RecName: Full=Phytochrome A1;
  945::1099    6e-04  23% 1131 aa  PHYA1_MAIZE RecName: Full=Phytochrome A;
    1::507

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHOR_BACSU      ----------------------------------------------------------------------
VANS_ENTFA      ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAES      ----------------------------------------------------------------------
WALK_STAEQ      ----------------------------------------------------------------------
WALK_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
CSSS_BACSU      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
PHOR_KLEPN      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
ATOS_ECOLI      ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
PHY_MOUSC       ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
HSSS_STAES      ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
PHY2_CERPU      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
NISK_LACLA      ----------------------------------------------------------------------
PMRB_PECCC      ----------------------------------------------------------------------
NTRYL_RICPR     ----------------------------------------------------------------------
NTRYL_RICBR     ----------------------------------------------------------------------
HSSS_STAEQ      ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
NTRYL_RICTY     ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
NTRYL_RICFE     ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
NTRYL_RICCN     ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
QSEC_HAEIN      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
PHYB_SOYBN      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PHYB_TOBAC      ----------------------------------------------------------------------
PHYB_SOLTU      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB_SORBI      ----------------------------------------------------------------------
PHYB_ORYSI      ----------------------------------------------------------------------
PHYB1_SOLLC     ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
PHYA_CUCPE      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
PHYC_SORBI      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
PHYC_ARATH      ----------------------------------------------------------------------
GLNK_BACSU      ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
PHYC_ORYSJ      ----------------------------------------------------------------------
PHYC_ORYSI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
PHYA_ARATH      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
PHYA_SOLTU      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
PHYB_ARATH      ----------------------------------------------------------------------
METK_PICTO      ----------------------------------------------------------------------
TLPA_BACSU      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
PHYA_SOYBN      ----------------------------------------------------------------------
MCPB_BACSU      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
TLPB_BACSU      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
PHYA1_TOBAC     ----------------------------------------------------------------------
PHYA1_MAIZE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHOR_BACSU      ----------------------------------------------------------------------
VANS_ENTFA      ----------------------------------------------------------------------
YYCG_BACSU      ----------------------------------------------------------------------
GACS_PSESY      ----------------------------------------------------------------------
WALK_STAAW      ----------------------------------------------------------------------
WALK_STAAU      ----------------------------------------------------------------------
WALK_STAAT      ----------------------------------------------------------------------
WALK_STAAS      ----------------------------------------------------------------------
WALK_STAAR      ----------------------------------------------------------------------
WALK_STAAN      ----------------------------------------------------------------------
WALK_STAAM      ----------------------------------------------------------------------
WALK_STAAE      ----------------------------------------------------------------------
WALK_STAAC      ----------------------------------------------------------------------
WALK_STAAB      ----------------------------------------------------------------------
WALK_STAA9      ----------------------------------------------------------------------
WALK_STAA8      ----------------------------------------------------------------------
WALK_STAA3      ----------------------------------------------------------------------
WALK_STAA2      ----------------------------------------------------------------------
WALK_STAA1      ----------------------------------------------------------------------
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAES      ----------------------------------------------------------------------
WALK_STAEQ      ----------------------------------------------------------------------
WALK_STAS1      ----------------------------------------------------------------------
YCLK_BACSU      ----------------------------------------------------------------------
WALK_STASR      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
CSSS_BACSU      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
PHOR_KLEPN      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
ARLS_STAHJ      ----------------------------------------------------------------------
PHOR_ECOLI      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------------
DSPA_SYNY3      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
ARLS_STAEQ      ----------------------------------------------------------------------
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
ARLS_STAES      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
ARLS_STAS1      ----------------------------------------------------------------------
CHVG_AGRT5      ----------------------------------------------------------------------
ARLS_STAAW      ----------------------------------------------------------------------
ARLS_STAAS      ----------------------------------------------------------------------
ARLS_STAAR      ----------------------------------------------------------------------
ARLS_STAAN      ----------------------------------------------------------------------
ARLS_STAAM      ----------------------------------------------------------------------
ARLS_STAAC      ----------------------------------------------------------------------
ARLS_STAAB      ----------------------------------------------------------------------
ARLS_STAA8      ----------------------------------------------------------------------
ARLS_STAA3      ----------------------------------------------------------------------
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------------------
VANS_ENTFC      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
HSSS_STAHJ      ----------------------------------------------------------------------
DHKC_DICDI      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------------------
MTRB_MYCBO      ----------------------------------------------------------------------
KINC_BACSU      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------------------
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------------
PHOR_HAEIN      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
BASS_ECOLI      ----------------------------------------------------------------------
MAK2_SCHPO      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
YCBM_BACSU      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
ATOS_ECOLI      ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
MPRB_MYCVP      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
BASS_SALTY      ----------------------------------------------------------------------
PHY_MOUSC       ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
DHKG_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
DIVL_CAUCR      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
DHKL_DICDI      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
MPRB_MYCSS      ----------------------------------------------------------------------
MPRB_MYCSK      ----------------------------------------------------------------------
MPRB_MYCSJ      ----------------------------------------------------------------------
FIXL_RHIME      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
MPRB_MYCLE      ----------------------------------------------------------------------
FIXL_AZOC5      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
AFSQ2_STRCO     ----------------------------------------------------------------------
SASA_SYNE7      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
MPRB_MYCBP      ----------------------------------------------------------------------
MPRB_MYCBO      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
MPRB_MYCTU      ----------------------------------------------------------------------
MPRB_MYCTA      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
VIRA_AGRT9      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
HSSS_STAES      ----------------------------------------------------------------------
MAK1_SCHPO      ----------------------------------------------------------------------
PHY2_CERPU      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
MPRB_MYCUA      ----------------------------------------------------------------------
ZRAS_ECOLI      ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
NISK_LACLA      ----------------------------------------------------------------------
PMRB_PECCC      ----------------------------------------------------------------------
NTRYL_RICPR     ----------------------------------------------------------------------
NTRYL_RICBR     ----------------------------------------------------------------------
HSSS_STAEQ      ----------------------------------------------------------------------
HSSS_STAAW      ----------------------------------------------------------------------
HSSS_STAAS      ----------------------------------------------------------------------
ZRAS_ECO57      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
HSSS_STAAT      ----------------------------------------------------------------------
HSSS_STAAE      ----------------------------------------------------------------------
HSSS_STAAC      ----------------------------------------------------------------------
HSSS_STAA8      ----------------------------------------------------------------------
HSSS_STAA3      ----------------------------------------------------------------------
NTRYL_RICTY     ----------------------------------------------------------------------
HSSS_STAAN      ----------------------------------------------------------------------
HSSS_STAAM      ----------------------------------------------------------------------
HSSS_STAA9      ----------------------------------------------------------------------
HSSS_STAA2      ----------------------------------------------------------------------
HSSS_STAA1      ----------------------------------------------------------------------
HSSS_STAAR      ----------------------------------------------------------------------
HSSS_STAAB      ----------------------------------------------------------------------
NTRYL_RICFE     ----------------------------------------------------------------------
COPS_PSESM      ----------------------------------------------------------------------
BPHY_PSEAE      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
NTRYL_RICCN     ----------------------------------------------------------------------
ZRAS_KLEOX      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
QSEC_HAEIN      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
PHYB_SOYBN      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PHYB_TOBAC      ----------------------------------------------------------------------
PHYB_SOLTU      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB_SORBI      ----------------------------------------------------------------------
PHYB_ORYSI      ----------------------------------------------------------------------
PHYB1_SOLLC     ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
PHYA_CUCPE      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
PHYC_SORBI      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
ENVZ_SALTY      ----------------------------------------------------------------------
NTRB_PROVU      ----------------------------------------------------------------------
ENVZ_SALTI      ----------------------------------------------------------------------
PHYC_ARATH      ----------------------------------------------------------------------
GLNK_BACSU      ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
PHYC_ORYSJ      ----------------------------------------------------------------------
PHYC_ORYSI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
PHYA_ARATH      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
PHYA_SOLTU      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
ENVZ_SHIFL      ----------------------------------------------------------------------
ENVZ_ECOLI      ----------------------------------------------------------------------
PHYB_ARATH      ----------------------------------------------------------------------
METK_PICTO      ----------------------------------------------------------------------
TLPA_BACSU      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
PHYA_SOYBN      ----------------------------------------------------------------------
MCPB_BACSU      ----------------------------------------------------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
TLPB_BACSU      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
PHYA1_TOBAC     ----------------------------------------------------------------------
PHYA1_MAIZE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxPFSLNSKNDSIIIAITSFQAIEEASALIKDFYKYXXXXXXXXXXXXSYVFSNLISKPLVKLN
PHOR_BACSU      ----------------------------------------------------------------------
VANS_ENTFA      ------------------------------------------------------AYIFARQMTTPIKALA
YYCG_BACSU      -------------------------------------------------------------ITHPLSDMR
GACS_PSESY      ----------------------------------------------------------SRTINGPMSQIK
WALK_STAAW      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAU      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAT      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAS      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAR      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAN      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAM      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAE      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAC      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAAB      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAA9      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAA8      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAA3      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAA2      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAA1      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAHJ      ----------------------------------------------------------------------
WALK_STAES      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAEQ      -------------------------------------------------------FFIARTITKPITDMR
WALK_STAS1      -------------------------------------------------------FFIARTITKPITDMR
YCLK_BACSU      --------PIFVQNEFKGAVLLISPISGVEQMVNQVNLYMFYAVISTLVITILVSWLLSKFHVKRIQKLR
WALK_STASR      ----------------------------------------------------------------------
RESE_BACSU      ----------------------------------------------------------------------
CSSS_BACSU      -------------------------------------------------------------LSRPLVSFE
SRRB_STAAW      ------------------------------------------------------AFFLSSRITKPLRRLR
SRRB_STAAU      ------------------------------------------------------AFFLSSRITKPLRRLR
SRRB_STAAS      ------------------------------------------------------AFFLSSRITKPLRRLR
SRRB_STAAR      ------------------------------------------------------AFFLSSRITKPLRRLR
SRRB_STAAC      ------------------------------------------------------AFFLSSRITKPLRRLR
SRRB_STAA8      ------------------------------------------------------AFFLSSRITKPLRRLR
SRRB_STAAN      ------------------------------------------------------AFFLSSRITKPLRRLR
SRRB_STAAM      ------------------------------------------------------AFFLSSRITKPLRRLR
PHOR_KLEPN      ----------------------------------------------------------------------
BARA_SHIFL      ----------------------------------------------------------------------
BARA_ECOLI      ----------------------------------------------------------------------
BARA_ECOL6      ----------------------------------------------------------------------
BARA_ECO57      ----------------------------------------------------------------------
DHKB_DICDI      ----------------------------------------------------------------------
YKOH_BACSU      ----------------------------------------------------------------------
DHKA_DICDI      ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
ARLS_STAHJ      ------------------------------------------------------SYIFSTQLTKPLVTMS
PHOR_ECOLI      ----------------------------------------------------------------------
RPRX_BACFR      ----------------------------------------------------------------------
BAES_ECOLI      ----------------------------------------------------------------PVKRLV
DSPA_SYNY3      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
DOKA_DICDI      ----------------------------------------------------------------------
SAES_STAAE      ----------------------------------------------------------------------
SAES_STAAC      ----------------------------------------------------------------------
SAES_STAA8      ----------------------------------------------------------------------
SAES_STAA3      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
DHKK_DICDI      ----------------------------------------------------------------------
SAES_STAAW      ----------------------------------------------------------------------
SAES_STAAS      ----------------------------------------------------------------------
SAES_STAAR      ----------------------------------------------------------------------
SAES_STAAN      ----------------------------------------------------------------------
SAES_STAAM      ----------------------------------------------------------------------
SAES_STAAB      ----------------------------------------------------------------------
PHOR_SHIDY      ----------------------------------------------------------------------
ARLS_STAEQ      ------------------------------------------------------SYIFSSQITKPIVTMS
SAES_STAES      ----------------------------------------------------------------------
SAES_STAEQ      ----------------------------------------------------------------------
ARLS_STAES      ------------------------------------------------------SYIFSSQITKPIVTMS
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
ARLS_STAS1      ------------------------------------------------------SYFFSSQITKPLILMS
CHVG_AGRT5      -------------------------------------------------------------LSAAAIRVR
ARLS_STAAW      ------------------------------------------------------SYVFSTQITKPLVSLS
ARLS_STAAS      ------------------------------------------------------SYVFSTQITKPLVSLS
ARLS_STAAR      ------------------------------------------------------SYVFSTQITKPLVSLS
ARLS_STAAN      ------------------------------------------------------SYVFSTQITKPLVSLS
ARLS_STAAM      ------------------------------------------------------SYVFSTQITKPLVSLS
ARLS_STAAC      ------------------------------------------------------SYVFSTQITKPLVSLS
ARLS_STAAB      ------------------------------------------------------SYVFSTQITKPLVSLS
ARLS_STAA8      ------------------------------------------------------SYVFSTQITKPLVSLS
ARLS_STAA3      ------------------------------------------------------SYVFSTQITKPLVSLS
LUXQ_VIBVY      ----------------------------------------------------------------------
LUXQ_VIBVU      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
MTRB_MYCPA      ----------------------------------------------------------SRQVVVPVRSAS
VANS_ENTFC      ----------------------------------------------------------------------
LUXQ_VIBCH      ----------------------------------------------------------------------
ETR1_MALDO      ----------------------------------------------------------------------
DLTS_STRA3      ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
HSSS_STAHJ      -------------------------------------------------------------IIKPIKILK
DHKC_DICDI      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
DLTS_STRA5      ----------------------------------------------------------------------
CUSS_ECO57      ----------------------------------------------------------------------
YCF26_PORYE     ----------------------------------------------------------------------
TCSA_EMENI      ----------------------------------------------------------------------
ETR1_PELHO      ----------------------------------------------------------------------
SILS_SALTY      ----------------------------------------------------------------------
CZCS_RALME      ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
ETR1_PRUPE      ----------------------------------------------------------------------
ETR1_CUCMR      ----------------------------------------------------------------------
SPHS_SYNE7      ----------------------------------------------------------------------
MTRB_MYCTU      ----------------------------------------------------------SRQVVVPVRSAS
MTRB_MYCBO      ----------------------------------------------------------SRQVVVPVRSAS
KINC_BACSU      ----------------------------------------------------------------------
CUSS_ECOLI      ----------------------------------------------------------------------
CUSS_ECOL6      ----------------------------------------------------------------------
SASA_MICAN      ----------------------------------------------------------------------
SASA_CYAA5      ----------------------------------------------------------------------
PCOS_ECOLX      ----------------------------------------------------------------------
MTRB_MYCLE      ----------------------------------------------------------SRQVVVPVRSAS
ARCB_SHIFL      ----------------------------------------------------------------------
ARCB_ECOLI      ----------------------------------------------------------------------
ARCB_ECO57      ----------------------------------------------------------------------
BVGS_BORBR      ----------------------------------------------------------------------
SASA_CYAP8      ----------------------------------------------------------------------
ETR1_SOLLC      ----------------------------------------------------------------------
ETR2_PELHO      ----------------------------------------------------------------------
BVGS_BORPE      ----------------------------------------------------------------------
BVGS_BORPA      ----------------------------------------------------------------------
SASA_SYNY3      ----------------------------------------------------------------------
CHVG_RHIME      ----------------------------------------------------------------PLRRLS
PHOR_HAEIN      ----------------------------------------------------------------------
ETR1_CUCSA      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
SASA_SYNJB      ----------------------------------------------------------------------
ETR2_SOLLC      ----------------------------------------------------------------------
SPAK_BACSU      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
BASS_ECOLI      -------------------------------------------------------------ITRPLAELQ
MAK2_SCHPO      ----------------------------------------------------------------------
HSSS_STAS1      -------------------------------------------------------------IIKPIQQLK
YCBM_BACSU      ----------------------------------------------------------------------
SASA_SYNJA      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
ETR1_TOBAC      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
ETR1_PASED      ----------------------------------------------------------------------
CUTS_STRLI      -------------------------------------------------------YAMAGRVLSPLGRIT
CUTS_STRCO      -------------------------------------------------------YAMAGRVLSPLGRIT
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
PLEC_CAUCR      ----------------------------------------------------------------------
YVRG_BACSU      ----------------------------------------------------------------------
ARCB_HAEIN      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
ERS1_ARATH      ----------------------------------------------------------------------
ATOS_ECOLI      ----------------------------------------------------------------------
SASA_CYAP7      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
DHKJ_DICDI      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
MPRB_MYCVP      ---------------------------------------------------------------RPVGRLT
KINB_PSEAE      ----------------------------------------------------------------------
KINA_BACSU      ----------------------------------------------------------------------
ETR1_ARATH      ----------------------------------------------------------------------
BASS_SALTY      -------------------------------------------------------------ITRPLAELQ
PHY_MOUSC       ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
PHYB_ANASP      ----------------------------------------------------------------------
CIAH_STRR6      ----------------------------------------------------------------------
CIAH_STRPN      ----------------------------------------------------------------------
IRLS_BURPS      ----------------------------------------------------------------------
ETR1_BRAOL      ----------------------------------------------------------------------
FIXL_BRAJA      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
MPRB_MYCPA      ---------------------------------------------------------------RPVARLT
DHKG_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      ----------------------------------------------------------------------
RSSA_SERMA      ----------------------------------------------------------------------
GTCS_ANEMI      -------------------------------------------------------YLYSRWTSKPLEKIT
DIVL_CAUCR      ----------------------------------------------------------------------
MPRB_MYCA1      ---------------------------------------------------------------RPVARLT
DHKL_DICDI      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
MPRB_MYCSS      ---------------------------------------------------------------RPVGRLT
MPRB_MYCSK      ---------------------------------------------------------------RPVGRLT
MPRB_MYCSJ      ---------------------------------------------------------------RPVGRLT
FIXL_RHIME      ----------------------------------------------------------------------
DHKH_DICDI      ----------------------------------------------------------------------
DHKF_DICDI      ----------------------------------------------------------------------
SASA_ANAVT      ----------------------------------------------------------------------
MPRB_MYCLE      ---------------------------------------------------------------RPVGRLT
FIXL_AZOC5      ----------------------------------------------------------------------
KIND_BACSU      ----------------------------------------------------------------------
YXDK_BACSU      ----------------------------------------------------------------------
YEDV_ECOLI      ----------------------------------------------------------------------
SASA_THEEB      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
NTRB_SHIFL      ----------------------------------------------------------------------
NTRB_ECOLI      ----------------------------------------------------------------------
NTRB_ECO57      ----------------------------------------------------------------------
DHKE_DICDI      ----------------------------------------------------------------------
AFSQ2_STRCO     ---------------------------------------------------------------KPVHRLG
SASA_SYNE7      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
NTRB_SALTY      ----------------------------------------------------------------------
NTRB_SALTI      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
MPRB_MYCBP      ---------------------------------------------------------------RPVGRLT
MPRB_MYCBO      ---------------------------------------------------------------RPVGRLT
SASA_PROMP      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
PILS_PSEAE      ----------------------------------------------------------------------
MPRB_MYCTU      ---------------------------------------------------------------RPVGRLT
MPRB_MYCTA      ---------------------------------------------------------------RPVGRLT
MPRB_MYCS2      --------------------------------------------------------------------LT
VIRA_AGRT9      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
PHOR_PSEAE      ----------------------------------------------------------------------
MAK3_SCHPO      ----------------------------------------------------------------------
HSSS_STAES      -------------------------------------------------------------IIKPVTALK
MAK1_SCHPO      ----------------------------------------------------------------------
PHY2_CERPU      ----------------------------------------------------------------------
NTRB_KLEOX      ----------------------------------------------------------------------
MPRB_MYCUA      ---------------------------------------------------------------RPVGRLT
ZRAS_ECOLI      ----------------------------------------------------------------------
Y3689_SHEFN     ----------------------------------------------------------------------
NISK_LACLA      ----------------------------------------------------------------------
PMRB_PECCC      -------------------------------------------------------------ITRPLSRLQ
NTRYL_RICPR     --------------------------------------------------------LFTAKIVKPIKKLV
NTRYL_RICBR     -------------------------------------------------------------IVNPIKKLV
HSSS_STAEQ      -------------------------------------------------------------IIKPVTALK
HSSS_STAAW      -------------------------------------------------------------IIRPVKKLK
HSSS_STAAS      -------------------------------------------------------------IIRPVKKLK
ZRAS_ECO57      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
KDPD_ECOLI      ----------------------------------------------------------------------
HSSS_STAAT      -------------------------------------------------------------IIRPVKKLK
HSSS_STAAE      -------------------------------------------------------------IIRPVKKLK
HSSS_STAAC      -------------------------------------------------------------IIRPVKKLK
HSSS_STAA8      -------------------------------------------------------------IIRPVKKLK
HSSS_STAA3      -------------------------------------------------------------IIRPVKKLK
NTRYL_RICTY     --------------------------------------------------------LFTAQIVKPIKKLV
HSSS_STAAN      -------------------------------------------------------------IIRPVKKLK
HSSS_STAAM      -------------------------------------------------------------IIRPVKKLK
HSSS_STAA9      -------------------------------------------------------------IIRPVKKLK
HSSS_STAA2      -------------------------------------------------------------IIRPVKKLK
HSSS_STAA1      -------------------------------------------------------------IIRPVKKLK
HSSS_STAAR      -------------------------------------------------------------IIRPVKKLK
HSSS_STAAB      -------------------------------------------------------------IIRPVKKLK
NTRYL_RICFE     --------------------------------------------------------IFTAKIVKPIKKLV
COPS_PSESM      ---------------------------------------------------------------RPVARVT
BPHY_PSEAE      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
NTRYL_RICCN     --------------------------------------------------------IFTAKIVKPIKKLV
ZRAS_KLEOX      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
QSEC_HAEIN      ----------------------------------------------------------------------
SASA_SYNS9      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
PHYB_SOYBN      ----------------------------------------------------------------------
RSTB_ECOLI      ----------------------------------------------------------------------
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PHYB_TOBAC      ----------------------------------------------------------------------
PHYB_SOLTU      ----------------------------------------------------------------------
DCTB_RHILE      ----------------------------------------------------------------------
TCSB_EMENI      ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB_SORBI      ----------------------------------------------------------------------
PHYB_ORYSI      ----------------------------------------------------------------------
PHYB1_SOLLC     ----------------------------------------------------------------------
DCTB_RHIME      ----------------------------------------------------------------------
PHYA_CUCPE      ----------------------------------------------------------------------
DHKI_DICDI      ----------------------------------------------------------------------
PHYC_SORBI      ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CSEC_STRCO      ----------------------------------------------------------------------
ENVZ_SALTY      ------------------------------------------------------AWLFIRIQNRPLVDLE
NTRB_PROVU      ----------------------------------------------------------------------
ENVZ_SALTI      ------------------------------------------------------AWLFIRIQNRPLVDLE
PHYC_ARATH      ----------------------------------------------------------------------
GLNK_BACSU      ----------------------------------------------------------------------
NTRB_VIBAL      ----------------------------------------------------------------------
PHYC_ORYSJ      ----------------------------------------------------------------------
PHYC_ORYSI      ----------------------------------------------------------------------
EVGS_ECOLI      ----------------------------------------------------------------------
EVGS_ECO57      ----------------------------------------------------------------------
PHYA_ARATH      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
PHYA_SOLTU      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
ENVZ_SHIFL      ------------------------------------------------------AWLFIRIQNRPLVDLE
ENVZ_ECOLI      ------------------------------------------------------AWLFIRIQNRPLVDLE
PHYB_ARATH      ----------------------------------------------------------------------
METK_PICTO      ----------------------------------------------------------------------
TLPA_BACSU      -------------------------------------------------------YFVIRSITKPLRRIV
NTRY_AZOC5      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
PHYA_SOYBN      ----------------------------------------------------------------------
MCPB_BACSU      -------------------------------------------------------------ITKPLKRLV
NTRB_RHOCA      ----------------------------------------------------------------------
TLPB_BACSU      -------------------------------------------------------------ITKPLRKLV
DHKM_DICDI      ----------------------------------------------------------------------
PHYA1_TOBAC     ----------------------------------------------------------------------
PHYA1_MAIZE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KSAKKMSAMDFSEKCDIEREDEIGNLAKTLNFLSKNLSNALDDLKIKNXXXXXXXXXXXXXXXXXXXFIA
PHOR_BACSU      -------------------------------------------------------------------FVA
VANS_ENTFA      DSANKMANLK-EVPPPLERKDELGALAHDMHSMYIRLKETIARLEDE-------IAREHELEETQRYFFA
YYCG_BACSU      KQAMELAKGNFSRKVKKYGHDEIGQLATTFNHLTRELEDA---------------------------FVA
GACS_PSESY      QAVSQLKDGNLETRLPPLGSRELDELASGINRMAATLQNALETIEIQNIELDLARKEALEASRIKSEFLA
WALK_STAAW      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAU      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAT      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAS      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAR      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAN      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAM      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAE      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAC      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAAB      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAA9      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAA8      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAA3      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAA2      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAA1      NQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAHJ      -------------------------------------------------------------------FVA
WALK_STAES      NQTVEMSKGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAEQ      NQTVEMSKGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
WALK_STAS1      NQTVEMSKGNYTQRVKIYGNDEIGELALAFNNLSKRVQEA---------------------------FVA
YCLK_BACSU      EATDKVASGDYDIHLENSYGDEIGVLASDFNIMAKKLKQSRDEIE--------------RLEKRRRQFIA
WALK_STASR      -------------------------------------------------------------------FVA
RESE_BACSU      -------------------------------------------------------------------FIA
CSSS_BACSU      KHVKRISEQDWDDPVKVDRKDEIGKLGHTIEEMRQKLVQKDETERT---------------------LLQ
SRRB_STAAW      DQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMSTEIEEHVDAL-----------------------FIA
SRRB_STAAU      DQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMSTEIEEHVDAL-----------------------FIA
SRRB_STAAS      DQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMSTEIEEHVDAL-----------------------FIA
SRRB_STAAR      DQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMSTEIEEHVDAL-----------------------FIA
SRRB_STAAC      DQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMSTEIEEHVDAL-----------------------FIA
SRRB_STAA8      DQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMSTEIEEHVDAL-----------------------FIA
SRRB_STAAN      DQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMSTEIEEHVDAL-----------------------FIA
SRRB_STAAM      DQATRVSEGDYSYKPSVTTKDEIGQLSQAFNQMSTEIEEHVDAL-----------------------FIA
PHOR_KLEPN      -------------------------------------------------------------------FFA
BARA_SHIFL      ---------------------------------TSDLRETLEQMEIQNVELDLAKKRAQEAARIKSEFLA
BARA_ECOLI      ---------------------------------TSDLRETLEQMEIQNVELDLAKKRAQEAARIKSEFLA
BARA_ECOL6      ---------------------------------TSDLRETLEQMEIQNVELDLAKKRAQEAARIKSEFLA
BARA_ECO57      ---------------------------------TSDLRETLEQMEIQNVELDLAKKRAQEAARIKSEFLA
DHKB_DICDI      -------------------------------------------------------------------FLT
YKOH_BACSU      -------------------------------------------------------------------FVQ
DHKA_DICDI      -------------------------------------------------------------------FVA
SEX3_MYCLE      -------------------------------------------------------------------FVA
LUXQ_VIBHA      -------------------------------------------------------------------FLA
ARLS_STAHJ      NKMIQIRRDGFQNKLELKTNEETDNLIDTFNDMMYQIEESFNQQR---------------------QFVE
PHOR_ECOLI      -------------------------------------------------------------------FFA
RPRX_BACFR      -------------------------------------------------------------------FIN
BAES_ECOLI      DGTHKLAAGDFTTRVTPTSEDELGKLAQDFNQLASTLE--------KNQQMRRD-------------FMA
DSPA_SYNY3      -------------------------------------------------------------------FIS
DHKD_DICDI      -------------------------------------------------------------------FFA
PDHS_OCHA4      -------------------------------------------------------------------FLA
DOKA_DICDI      -------------------------------------------------------------------FIT
SAES_STAAE      --------------------------------------------------------------------IQ
SAES_STAAC      --------------------------------------------------------------------IQ
SAES_STAA8      --------------------------------------------------------------------IQ
SAES_STAA3      --------------------------------------------------------------------IQ
RPFC_XANCP      -------------------------------------------------------------------FLA
RPFC_XANC8      -------------------------------------------------------------------FLA
DHKK_DICDI      ------------------------------------IDEAHRETKLKNAQLTIAKDAAIEAYQARQEFLA
SAES_STAAW      --------------------------------------------------------------------IQ
SAES_STAAS      --------------------------------------------------------------------IQ
SAES_STAAR      --------------------------------------------------------------------IQ
SAES_STAAN      --------------------------------------------------------------------IQ
SAES_STAAM      --------------------------------------------------------------------IQ
SAES_STAAB      --------------------------------------------------------------------IQ
PHOR_SHIDY      -------------------------------------------------------------------FFA
ARLS_STAEQ      NKMNQIRRDGFQNKLELTTNEETDNLIDTFNEMMYQIEESFNQQR---------------------QFVE
SAES_STAES      --------------------------------------------------------------------IQ
SAES_STAEQ      --------------------------------------------------------------------IQ
ARLS_STAES      NKMNQIRRDGFQNKLELTTNEETDNLIDTFNEMMYQIEESFNQQR---------------------QFVE
SENX3_MYCTU     -------------------------------------------------------------------FVA
SENX3_MYCBO     -------------------------------------------------------------------FVA
ARLS_STAS1      NKMQQIRRDGFQEKVELSTNEETDNLIVTFNEMMLQLEESFNQQR---------------------QFVE
CHVG_AGRT5      RGARTREEIDFSA-----RQDEIGNLSIALREMTTALYDRIDAIE---------------------SFAA
ARLS_STAAW      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
ARLS_STAAS      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
ARLS_STAAR      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
ARLS_STAAN      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
ARLS_STAAM      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
ARLS_STAAC      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
ARLS_STAAB      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
ARLS_STAA8      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
ARLS_STAA3      NKMIEIRRDGFQNKLQLNTNEEIDNLANTFNEMMSQIEESFNQQR---------------------QFVE
LUXQ_VIBVY      -------------------------------------------------------------------FLA
LUXQ_VIBVU      -------------------------------------------------------------------FLA
PDHS_BRUSU      -------------------------------------------------------------------FLA
PDHS_BRUSI      -------------------------------------------------------------------FLA
PDHS_BRUO2      -------------------------------------------------------------------FLA
PDHS_BRUME      -------------------------------------------------------------------FLA
PDHS_BRUAB      -------------------------------------------------------------------FLA
PDHS_BRUA2      -------------------------------------------------------------------FLA
PDHS_BRUA1      -------------------------------------------------------------------FLA
PDHS_BRUC2      -------------------------------------------------------------------FLA
SENX3_MYCS2     -------------------------------------------------------------------FVA
MTRB_MYCPA      RIAERFAEGHLSERMPVRGEDDMARLAMSFNDMAESLSRQITQLE--------------EFGNLQRRFTS
VANS_ENTFC      -----------NEDKQIELSAEMDVMEQKLNTLKRTLEKREQDAKLAEQRKNDV--------------VM
LUXQ_VIBCH      -------------------------------------------------------------------FLA
ETR1_MALDO      -------------------------------------------------------------------FLA
DLTS_STRA3      -------------------------------------------------------------------FVS
Y1002_RHIME     -------------------------------------------------------------------FLA
HSSS_STAHJ      QATERLMHGDFNSPIYQSRHDEIGTLQYRFEAMRQSLKQ-VDDMR--------------------QHFVQ
DHKC_DICDI      --------------------------------------------------------------------IS
LUXQ_VIBPA      -------------------------------------------------------------------FLA
DLTS_STRA5      -------------------------------------------------------------------FVS
CUSS_ECO57      -------------------------------------------------------------------FSA
YCF26_PORYE     -------------------------------------------------------------------FIS
TCSA_EMENI      -------------------------------------------------------------------FLA
ETR1_PELHO      -------------------------------------------------------------------FLA
SILS_SALTY      -------------------------------------------------------------------FSA
CZCS_RALME      -------------------------------------------------------------------FSA
YCF26_PORPU     -------------------------------------------------------------------FIS
ETR1_PRUPE      -------------------------------------------------------------------FLA
ETR1_CUCMR      -------------------------------------------------------------------FLA
SPHS_SYNE7      -------------------------------------------------------------------WVS
MTRB_MYCTU      RIAERFAEGHLSERMPVRGEDDMARLAVSFNDMAESLSRQIAQLE--------------EFGNLQRRFTS
MTRB_MYCBO      RIAERFAEGHLSERMPVRGEDDMARLAVSFNDMAESLSRQIAQLE--------------EFGNLQRRFTS
KINC_BACSU      ---------------------------------------------------------------------A
CUSS_ECOLI      -------------------------------------------------------------------FSA
CUSS_ECOL6      -------------------------------------------------------------------FSA
SASA_MICAN      ----------------------------------------------------------------------
SASA_CYAA5      --------------------------------------------------------------------LA
PCOS_ECOLX      -------------------------------------------------------------------FSS
MTRB_MYCLE      RIAERFAEGHLSERMPVRGEDDMARLAVSFNDMAESLSRQITQLE--------------EFGNLQRRFTS
ARCB_SHIFL      -------------------------------------------------------------------FIS
ARCB_ECOLI      -------------------------------------------------------------------FIS
ARCB_ECO57      -------------------------------------------------------------------FIS
BVGS_BORBR      -------------------------------------------------------------------FLA
SASA_CYAP8      --------------------------------------------------------------------LA
ETR1_SOLLC      -------------------------------------------------------------------FLA
ETR2_PELHO      -------------------------------------------------------------------FLA
BVGS_BORPE      -------------------------------------------------------------------FLA
BVGS_BORPA      -------------------------------------------------------------------FLA
SASA_SYNY3      --------------------------------------------------------------------LA
CHVG_RHIME      AAAIRVRRGGAKEREEISRQDEIGNLSVALREMTTALYDRIAAIE---------------------NFAA
PHOR_HAEIN      -------------------------------------------------------------------FLS
ETR1_CUCSA      -------------------------------------------------------------------FLA
KINE_BACSU      ---------------------------------------------------------------------A
SASA_SYNJB      ----------------------------------------------------------------------
ETR2_SOLLC      -------------------------------------------------------------------FLG
SPAK_BACSU      --------------------------------------------------------------------IG
DIVJ_CAUCR      -------------------------------------------------------------------FLA
CREC_ECOLI      -------------------------------------------------------------------YVY
BASS_ECOLI      KELEARTADNLTPIAIHSATLEIEAVVSALNDLVSRLTSTLDNERL---------------------FTA
MAK2_SCHPO      -------------------------------------------------------------------FLA
HSSS_STAS1      RATERLMHGNFDEVIHVTRKDEFGTLQYRFDKMRLSLKQ-LDDMR--------------------QHFVQ
YCBM_BACSU      --------------------------------------------------------------------LT
SASA_SYNJA      ----------------------------------------------------------------------
KDPD_CLOAB      ----------------------------------------------------------------------
ETR1_TOBAC      -------------------------------------------------------------------FLA
CPXA_ECOLI      --------------------------------------------------------------------LS
CPXA_ECOL6      --------------------------------------------------------------------LS
CPXA_ECO57      --------------------------------------------------------------------LS
ETR1_PASED      -------------------------------------------------------------------FLA
CUTS_STRLI      RTARAVAGSDLSRRIELDGDDELKELADTFDDMLERLQRAFTAQQ---------------------RFVG
CUTS_STRCO      RTARAVAGSDLSRRIELDGDDELKELADTFDDMLERLQRAFTAQQ---------------------RFVG
ZRAS_SALTY      ---------------------------------------------------------------------A
ZRAS_SALTI      ---------------------------------------------------------------------A
PLEC_CAUCR      -------------------------------------------------------------------FLA
YVRG_BACSU      -------------------------------------------------------------------WIA
ARCB_HAEIN      --------------------------------------------------------------------LA
RCSC_ECOLI      -------------------------------------------------------------------FLA
ERS1_ARATH      -------------------------------------------------------------------FLA
ATOS_ECOLI      --------------------------------------------------------------------MA
SASA_CYAP7      ----------------------------------------------------------------------
RCSC_SALTI      -------------------------------------------------------------------FLA
DHKJ_DICDI      --AKAVTKGDFTRVISVDAKGEVNLLKLIINEMIHNLK----ETTLKNTLAKETAEAASRAKSD---FMA
TORS_ECO57      -------------------------------------------------------------------FLA
RCSC_SALTY      -------------------------------------------------------------------FLA
MPRB_MYCVP      QAAERVARTDDLRPIPVIGNDELARLTETFNMMLRALAESRE---------------------RQARLVT
KINB_PSEAE      -------------------------------------------------------------------FVL
KINA_BACSU      ---------------------------------------------------------------------A
ETR1_ARATH      -------------------------------------------------------------------FLA
BASS_SALTY      KELEARTADNLAPIAIHSSTLEIESVVSAINQLVTRLTTTLDNERL---------------------FTA
PHY_MOUSC       ----------------------------------------------------------------------
TORS_ECOLI      -------------------------------------------------------------------FLA
PHYB_ANASP      ----------------------------------------------------------------------
CIAH_STRR6      -------------------------------------------------------------------FVE
CIAH_STRPN      -------------------------------------------------------------------FVE
IRLS_BURPS      -------------------------------------------------------------------FSS
ETR1_BRAOL      -------------------------------------------------------------------FLA
FIXL_BRAJA      ----------------------------------------------------------------------
SASA_NOSP7      ----------------------------------------------------------------------
PHYA_ANASP      ----------------------------------------------------------------------
PHY1_SYNY3      ----------------------------------------------------------------------
MPRB_MYCPA      EAAERVARTDDLRPIPVFGSDELARLTESFNLMLRALAESRE---------------------RQARLVT
DHKG_DICDI      -------------------------------------------------------------------FIS
YFHK_ECOLI      -------------------------------------------------------------------FLR
RSSA_SERMA      -------------------------------------------------------------------FMA
GTCS_ANEMI      DAIQKMREGEFAQRLCFKADYELTLIQEHFNEMVAHLENKLEQSKQR--------------------MLL
DIVL_CAUCR      -------------------------------------------------------------------FVG
MPRB_MYCA1      EAAERVARTDDLRPIPVFGSDELARLTESFNLMLRALAESRE---------------------RQARLVT
DHKL_DICDI      ----------------------------------------------------------------------
SASA_ANASP      ----------------------------------------------------------------------
MPRB_MYCSS      QAAERVARTDDLRPIPVFGSDELARLTEAFNMMLRALTESRE---------------------RQARLVS
MPRB_MYCSK      QAAERVARTDDLRPIPVFGSDELARLTEAFNMMLRALTESRE---------------------RQARLVS
MPRB_MYCSJ      QAAERVARTDDLRPIPVFGSDELARLTEAFNMMLRALTESRE---------------------RQARLVS
FIXL_RHIME      ----------------------------------------------------------------------
DHKH_DICDI      -------------------------------------------------------------------FLQ
DHKF_DICDI      -------------------------------------------------------------------FLA
SASA_ANAVT      ----------------------------------------------------------------------
MPRB_MYCLE      EAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRE---------------------RQARLVT
FIXL_AZOC5      ----------------------------------------------------------------------
KIND_BACSU      ---------------------------------------------------------------------A
YXDK_BACSU      ----------------------------------------------------------------------
YEDV_ECOLI      -------------------------------------------------------------------FAD
SASA_THEEB      ----------------------------------------------------------------------
PHY1_SELMA      ----------------------------------------------------------------------
NTRB_SHIFL      --------------------------------------------------------------------VR
NTRB_ECOLI      --------------------------------------------------------------------VR
NTRB_ECO57      --------------------------------------------------------------------VR
DHKE_DICDI      -------------------------------------------------------------------FLT
AFSQ2_STRCO     VAARRLGEGKLDTRLRVSGTDELADLSRTFNSAAENLEKRVADMAGREQASRR--------------FVA
SASA_SYNE7      ----------------------------------------------------------------------
YVCQ_BACSU      ----------------------------------------------------------------------
NTRB_SALTY      --------------------------------------------------------------------VR
NTRB_SALTI      --------------------------------------------------------------------VR
KINB_BACSU      ---------------------------------------------------------------------A
MPRB_MYCBP      EAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRE---------------------RQARLVT
MPRB_MYCBO      EAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRE---------------------RQARLVT
SASA_PROMP      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
PILS_PSEAE      ---------------------------------------------------------------------A
MPRB_MYCTU      EAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRE---------------------RQARLVT
MPRB_MYCTA      EAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRE---------------------RQARLVT
MPRB_MYCS2      EAAERVARTDDLRPIPVVGSDELARLTEAFNMMLRALAESRE---------------------RQARLVS
VIRA_AGRT9      ----------------------------------------------------------------------
VIRAW_RHIRD     ----------------------------------------------------------------------
PHOR_PSEAE      -------------------------------------------------------------------FVA
MAK3_SCHPO      -------------------------------------------------------------------FLA
HSSS_STAES      NATTRIMKGDFSTPIKQTRHDEIGTLQSRFNTMRQNLGQ-VDQMR--------------------QHFVQ
MAK1_SCHPO      -------------------------------------------------------------------YLS
PHY2_CERPU      --------------------------------------------------------------------LA
NTRB_KLEOX      --------------------------------------------------------------------VR
MPRB_MYCUA      EAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRE---------------------RQARLVS
ZRAS_ECOLI      ----------------------------------------------------------------------
Y3689_SHEFN     ---------------------------------------------------------------------A
NISK_LACLA      --------------------------------------------------------------------VA
PMRB_PECCC      EELQDRTAENLEPLPQQSDIKEIAAVTHTINQLFQRLDETLK---------------------RDRQFTA
NTRYL_RICPR     TATDKVKDGDLTVQVPENEKDEIGTLYAAFNRMIKQLSRQQRDLVIAQRAMAWSDVAKK-----------
NTRYL_RICBR     IATDKVKSGDLTVQVPENEKDEIGTLYAAFNRMIKQLSRQQRDLVIAQRALAWSDVAKK-----------
HSSS_STAEQ      NATTRIMKGDFSTPIKQTRHDEIGTLQSRFNTMRQNLGQ-VDQMR--------------------QHFVQ
HSSS_STAAW      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAAS      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
ZRAS_ECO57      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
KDPD_ECOLI      --------------------------------------------------------------------LA
HSSS_STAAT      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAAE      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAAC      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAA8      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAA3      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
NTRYL_RICTY     TATDKVKDGDLTVQVPENEKDEIGTLYVAFNRMIKQLSRQQRDLVIAQRAMAWSDVAKK-----------
HSSS_STAAN      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAAM      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAA9      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAA2      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAA1      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAAR      LATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
HSSS_STAAB      LATERLIDGDFKTPIKQTRKDEIGTLQYHFNKMRESLGQ-VDQMR--------------------QHFVQ
NTRYL_RICFE     TATDKVKDGDLTVQVPENEKDEIGTLYAAFNRMIKQLSRQQRDLVIAQRAMAWSDVAKK-----------
COPS_PSESM      QTAASMSAGSLKERIPLEPPDELRALITAFNSMLGRLDDSF--MRLSN-------------------FSA
BPHY_PSEAE      ----------------------------------------------------------------------
SASA_PROMA      ----------------------------------------------------------------------
NTRYL_RICCN     TATDNVKDGDLTVQVPENEKDEIGTLYVAFNRMIKQLSRQQRDLVIAQRAMAWSDVAKK-----------
ZRAS_KLEOX      ----------------------------------------------------------------------
PHY_PINSY       ----------------------------------------------------------------------
PHY_PICAB       ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
QSEC_HAEIN      -------------------------------------------------------------------FTS
SASA_SYNS9      ----------------------------------------------------------------------
SASA_PROM3      ----------------------------------------------------------------------
PHY1_PHYPA      ----------------------------------------------------------------------
NODV_BRAJA      ----------------------------------------------------------------------
GRAS_STAHJ      ----------------------------------------------------------------------
PHYB_SOYBN      ----------------------------------------------------------------------
RSTB_ECOLI      --------------------------------------------------------------------ID
VIRA_AGRT5      ----------------------------------------------------------------------
SASA_SYNPX      ----------------------------------------------------------------------
PHYD_ARATH      ----------------------------------------------------------------------
SASA_SYNS3      ----------------------------------------------------------------------
SASA_PROMM      ----------------------------------------------------------------------
PHYB_TOBAC      --------------------------------------------------------------------LA
PHYB_SOLTU      --------------------------------------------------------------------LA
DCTB_RHILE      ---------------------------------------------------------------------A
TCSB_EMENI      ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------------------------------------------------
PHYB_SORBI      --------------------------------------------------------------------LA
PHYB_ORYSI      ----------------------------------------------------------------------
PHYB1_SOLLC     --------------------------------------------------------------------LA
DCTB_RHIME      ---------------------------------------------------------------------A
PHYA_CUCPE      ----------------------------------------------------------------------
DHKI_DICDI      -------------------------------------------------------------------FLA
PHYC_SORBI      ----------------------------------------------------------------------
QSEC_SALTY      -------------------------------------------------------------------FTS
QSEC_SALTI      -------------------------------------------------------------------FTS
CSEC_STRCO      ---------------------------------------------------------------------A
ENVZ_SALTY      HAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTL---------------------LMA
NTRB_PROVU      --------------------------------------------------------------------VR
ENVZ_SALTI      HAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTL---------------------LMA
PHYC_ARATH      --------------------------------------------------------------------LA
GLNK_BACSU      ----------------------------------------------------------------------
NTRB_VIBAL      --------------------------------------------------------------------VR
PHYC_ORYSJ      ----------------------------------------------------------------------
PHYC_ORYSI      ----------------------------------------------------------------------
EVGS_ECOLI      -------------------------------------------------------------------FLA
EVGS_ECO57      -------------------------------------------------------------------FLA
PHYA_ARATH      ----------------------------------------------------------------------
VIRAL_RHIRD     ----------------------------------------------------------------------
SLN1_YEAST      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------------------------------
PHYA_SOLTU      ----------------------------------------------------------------------
GRAS_STAAR      ----------------------------------------------------------------------
ENVZ_SHIFL      HAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTL---------------------LMA
ENVZ_ECOLI      HAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTL---------------------LMA
PHYB_ARATH      ----------------------------------------------------------------------
METK_PICTO      ----------------------------------------------------------------------
TLPA_BACSU      ASAEKISEGDLTETIEINSKDELGVLSESFNHMAHSLRSLIHGIK-------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
BCES_BACHD      ----------------------------------------------------------------------
QSEC_ECO57      -------------------------------------------------------------------FTS
QSEC_ECOLI      -------------------------------------------------------------------FTS
PHYA_SOYBN      ----------------------------------------------------------------------
MCPB_BACSU      QSSKTISRGDLTETIEIHSKDELGELGESFNEMGQSLRSLISAIQ-------------------------
NTRB_RHOCA      ----------------------------------------------------------------------
TLPB_BACSU      STSAKISSGDLTEVIDIHSKNEFGQLGESFNEMSASLRSVI-----------------------------
DHKM_DICDI      ----------------------------------------------------------------------
PHYA1_TOBAC     ----------------------------------------------------------------------
PHYA1_MAIZE     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GASHELKTPIGIISGYAEGIKDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFS
PHOR_BACSU      NVSHELKTPITSIKGFTETLLDGAMEDKEASEFLSIILKESERXXXXXXXXXXXXKIEQQNFTLSIETFE
VANS_ENTFA      AASHELKTPIAAVSVLLEGMLENIGDYKDHSKYLRECIKMMDRQGKTISEILELVSLNDGRIVPIAEPLD
YYCG_BACSU      NVSHELRTPLTTMRSYLEALAEGAWENKDIAPFLMVTQNETERMIRLVNDLLQLSKFDSKDYQFNREWIQ
GACS_PSESY      NMSHEIRTPLNGILGFTHLLQKSELTPR-QFDYLGTIEKSADNLLSIINEILDFSKIEAGKLVLDNIPFN
WALK_STAAW      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAU      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAT      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAS      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAR      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAN      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAM      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAE      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAC      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAAB      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAA9      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAA8      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAA3      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAA2      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAA1      NVSHELRTPLTSMNSYIEALEEGAKDEELAPQFLSVTREETERMIRLVNDLLQLSKMESDQINKEIIDFN
WALK_STAHJ      NVSHELRTPLTSMNSYIEALEEGV--WKDDNLFLSVTREETERMIRLVNDLLQLSKMESEQITKEIVDFN
WALK_STAES      NVSHELRTPLTSMNSYIEALEEGAWQDKELAPFLSVTREETERMIRLVNDLLQLSKMESDQITKEIIDFN
WALK_STAEQ      NVSHELRTPLTSMNSYIEALEEGAWQDKELAPFLSVTREETERMIRLVNDLLQLSKMESDQITKEIIDFN
WALK_STAS1      NVSHELRTPLTSMNSYIEALESGAKDGELAPQFLSVTREETERMIRLVNDLLQLSKMESEQITKEIVDFN
YCLK_BACSU      DVSHELKTPLTTINGLVEGLNSHTIPEDKKDKCFSLISEETKRMLRLVKENLDYEKIRSQQITLNKLDVP
WALK_STASR      NVSHELRTPLTSMRSYIEALEEGAWDPEVAPTFLNVTREETDRMIRLVNDLLQLSKMDSSSDQMNSELXX
RESE_BACSU      NVSHELRTPISMLQGYSEAIVDDIASEEDRKEIAQIIYDESLRMGRLVNDLLDLARMESGHTGLHYEKIN
CSSS_BACSU      NISHDLKTPVMVIRGYTQSIKDGIFPKGDLENTVDVIECEALKLEXXXXXXXXXXXXXXXXXQKVQHDFS
SRRB_STAAW      NVSHELRTPISLLQGYTESIVDGIVTEPDEKESLAIVLDESKXXXXXXXXXXXXARMDAEGLSVNKEVQP
SRRB_STAAU      NVSHELRTPISLLQGYTESIVDGIVTEPDEKESLAIVLDESKXXXXXXXXXXXXARMDAEGLSVNKEVQP
SRRB_STAAS      NVSHELRTPISLLQGYTESIVDGIVTEPDEKESLAIVLDESKXXXXXXXXXXXXARMDAEGLSVNKEVQP
SRRB_STAAR      NVSHELRTPISLLQGYTESIVDGIVTEPDEKESLAIVLDESKXXXXXXXXXXXXARMDAEGLSVNKEVQP
SRRB_STAAC      NVSHELRTPISLLQGYTESIVDGIVTEPDEKESLAIVLDESKXXXXXXXXXXXXARMDAEGLSVNKEVQP
SRRB_STAA8      NVSHELRTPISLLQGYTESIVDGIVTEPDEKESLAIVLDESKXXXXXXXXXXXXARMDAEGLSVNKEVQP
SRRB_STAAN      NVSHELRTPISLLQGYTESIVDGIVTEPDEKESLAVVLDESKXXXXXXXXXXXXARMDAEGLSVNKEVQP
SRRB_STAAM      NVSHELRTPISLLQGYTESIVDGIVTEPDEKESLAVVLDESKXXXXXXXXXXXXARMDAEGLSVNKEVQP
PHOR_KLEPN      NVSHELRTPLTVLQGYLEMMQEQVLEGATREKALHTMREQTQRMEGLVKQLLTLSRIEAAPA-LAMNDRI
BARA_SHIFL      NMSHELRTPLNGVIGFTRTLKTELTP--TQRDHLNTIERSANNLLAIINDVLDFSKLEAGKLILESIPFP
BARA_ECOLI      NMSHELRTPLNGVIGFTRTLKTELTP--TQRDHLNTIERSANNLLAIINDVLDFSKLEAGKLILESIPFP
BARA_ECOL6      NMSHELRTPLNGVIGFTRTLKTELTP--TQRDHLNTIERSANNLLAIINDVLDFSKLEAGKLILESIPFP
BARA_ECO57      NMSHELRTPLNGVIGFTRTLKTELTP--TQRDHLNTIERSANNLLAIINDVLDFSKLEAGKLILESIPFP
DHKB_DICDI      TVSHELRTPINGVLASADILERTTLD-STQKEFLNCIKLSGXXXXXXXXXXXXXSKIEAGKMEIIKYDFS
YKOH_BACSU      DASHELKTPLTIIESYSSLMKRGAKKPEVLEESIEAIHSEAVHMKKLTNQLLALAKSHQGEVDLKTID--
DHKA_DICDI      TVSHEVRTPLSGVIGVSDLLLETNLS-EEQRDYVQTIQKSSQALLTIINDILDYSKLESRQLKMETLPFS
SEX3_MYCLE      NVSHELKTPVGXXXXXXXXXXXXXXXXXTVSRFAEKVLIEANRLGYMVAELIELSRLQGAERLPNVTDID
LUXQ_VIBHA      KMSHEIRTPINGILGVAQLLKDS-VDTQEQKNQIDVLCHSGEHLLAVLNDILDFSKIEQGKFNIQKHPFS
ARLS_STAHJ      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLEESLNISLEEMNRIXXXXXXXXXXXXXXXNIQALEFE
PHOR_ECOLI      NVSHELRTPLTVLQGYLEMMNEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTHL------
RPRX_BACFR      NMTHEFKTPISTISLAAQMLKDPAVGKSPQMFQSGVINDETKRLRFQVEKVLQMSMFDRQKATLKMKELD
BAES_ECOLI      DISHELRTPLAVLRGELEAIQDGVRKFTPETVAS--LQAEVGTLTKLVDDLHQLSMSDEGALAYQKAPVD
DSPA_SYNY3      NVSHELRTPLFNIKSFIETLSEFGEDEVERKEFLETANHETDRLSRLVNDVLDLSKLESSKIQLDAVD--
DHKD_DICDI      NVSHELRTPLALIVGPTDKLKDENVDRKD----LEIVARNARGLLKIVNNLLDISRLEAGKMNLN---YS
PDHS_OCHA4      RISHEIRTPLNAIIGFSELMADGSIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVS
DOKA_DICDI      NISHELRTPCHGIVGMSQLLLDSQLTNTQRD-NIDSIKRSTDSLISLINDILDFSKLEYGKVTLENESFE
SAES_STAAE      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
SAES_STAAC      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
SAES_STAA8      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
SAES_STAA3      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
RPFC_XANCP      NMSHEFRTPLNGLSGMTEVLATTRLD-AEQKECLNTIQASARSLLSLVEEVLDISAIEAGKIRIDRRDFS
RPFC_XANC8      NMSHEFRTPLNGLSGMTEVLATTRLD-AEQKECLNTIQASARSLLSLVEEVLDISAIEAGKIRIDRRDFS
DHKK_DICDI      TMSHEIRTPLNGLIGMATLLRDSHNLPPEEKTMAKAVKSCGDILLRLVNDILDLSKLEANQMGLEHIPFR
SAES_STAAW      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
SAES_STAAS      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
SAES_STAAR      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
SAES_STAAN      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
SAES_STAAM      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
SAES_STAAB      NLAHDLKTPLASIISYSEGLRDGIIDHEIKESY-DILIKQANRLSTLFDDMTHIITLNTGKTYPPEL-IQ
PHOR_SHIDY      NVSHELRMPLTVLQGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQL------
ARLS_STAEQ      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLEESLNISIEEVNRIXXXXXXXXXXXXDRVNHNVLECE
SAES_STAES      NLAHDLKTPLAGIRSYSEGLRDGVIDPQEVHEAYEILIKQANRLSILFDDITHVINLNTGRYPLELI--Q
SAES_STAEQ      NLAHDLKTPLAGIRSYSEGLRDGVIDPQEVHEAYEILIKQANRLSILFDDITHVINLNTGRYPLELI--Q
ARLS_STAES      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLEESLNISIEEVNRIXXXXXXXXXXXXDRVNHNVLECE
SENX3_MYCTU     NVSHELKTPVGAMXXXXXXXXXXXXXXXTVRRFAEKVLIEANRLGDMVAELIELSRLQGAERLPNMTDVD
SENX3_MYCBO     NVSHELKTPVGAMXXXXXXXXXXXXXXXTVRRFAEKVLIEANRLGDMVAELIELSRLQGAERLPNMTDVD
ARLS_STAS1      DASHELRTPLQIIQGHLNLINRW--GKKDAAXXXXXXXXXXXXMTRIXXXXXXXXXXXXDNNNSRDGEIE
CHVG_AGRT5      DVSHELKNPLTSLRSAVETLPRAKTEESKQRL-TEIIFHDVRRLDRLISDISDASRLDA---ELARADAS
ARLS_STAAW      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
ARLS_STAAS      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
ARLS_STAAR      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
ARLS_STAAN      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
ARLS_STAAM      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
ARLS_STAAC      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
ARLS_STAAB      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
ARLS_STAA8      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
ARLS_STAA3      DASHELRTPLQIIQGHLNLIQRW--GKKDPAVLLNISIEEMNRIIKLVEELLELTKGD------------
LUXQ_VIBVY      KMSHEIRTPLNGILGIAQLLKRSVNDAENLK-QVDVLCNSGEHLLAVLNDILDFSKIEQGKFNIKKRDFN
LUXQ_VIBVU      KMSHEIRTPLNGILGIAQLLKRSVNDAENLK-QVDVLCNSGEHLLAVLNDILDFSKIEQGKFNIKKRDFN
PDHS_BRUSU      RISHEIRTPLNAIIGFSELMADGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVS
PDHS_BRUSI      RISHEIRTPLNAIIGFSELMADGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVS
PDHS_BRUO2      RISHEIRTPLNAIIGFSELMADGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVS
PDHS_BRUME      RISHEIRTPLNAIIGFSELMADGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVS
PDHS_BRUAB      RISHEIRTPLNAIIGFSELMADGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVS
PDHS_BRUA2      RISHEIRTPLNAIIGFSELMADGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVS
PDHS_BRUA1      RISHEIRTPLNAIIGFSELMADGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVS
PDHS_BRUC2      RISHEIRTPLNAIIGFSELMADGPIGNDRYRDYLRDINRSGNYVLALVNDLLDISKIEAGALDMQFEAVS
SENX3_MYCS2     NVSHELKTPVGAMSVLAEALLASADDPDTVRRFAEKMVAESHRLADMIGELIELSRLQGAEPDLDAVD--
MTRB_MYCPA      DVSHELRTPLTTVRMAADLIYDHSADDPTLARSTELMVNELDRFESLLNDLLEISRHDAGVAELSVEAVD
VANS_ENTFC      YLAHDIKTPLTSIIGYLDEAPDMPVDQKAK--YVHITLDKAYRLEQLIDEFFEITRYNLQTITLHILYYM
LUXQ_VIBCH      KMSHELRTPLNGVLGVSQLLKRTPLND-EQREHVAVLCSSGEHLLAVLNDILDFSRLEQGKFRIQKNEFR
ETR1_MALDO      VMNHEMRTPMHAIIALSSLLQETELT-AEQRLMVETILRSSNLLATLINDVLDLSRLEDGSLQLEIATFN
DLTS_STRA3      DASHELKTPIAAIRANVQVLEQQIPGNR----YLDHVVSETKRMEFLIEDLLNLSRLDEKRSKVNFKKLN
Y1002_RHIME     AVSHELRTPLNAILGFSDGEYFGKLENDRQREYVSLIHQSGTHLLSVVNTMLDMSKIEAGRYELLLEPFR
HSSS_STAHJ      NVSHEIKTPLTHIHRLLSTLQSNV----NQGERDQIIHEIHEEVTHXXXXXXXXXXXXXXDNATHLKDVH
DHKC_DICDI      HLSHELRTPIHSVIASIQLFRSTILT-VTQNEYLSIIDTSANTLLELVSNVLDYKRIRSGKLTLNNVDFN
LUXQ_VIBPA      KMSHEIRTPINGILGVAQLLKDS-VEAEEQKNQIDVLRHSGEHLLAVLNDILDFSKIEQGKFNIHPFSFA
DLTS_STRA5      DASHELKTPIAAIRANVQVLEQQIPGNR----YLDHVVSETKRMEFLIEDLLNLSRLDEKRSKVNFKKLN
CUSS_ECO57      DIAHEIRTPITNLITQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQL---IPEKK
YCF26_PORYE     NVSHELRTPLFNIRSFLETLYEDSLDNRQKLEFLAIANKETERLTRLVNDVLDLSRLESDQMDL-VSAIE
TCSA_EMENI      NISHEIRTPMNGMQIALTMLTDTGLS-EEQREHANIVQDSMSLLLQIVNDVLDYSKLSSGSFSLHADMLD
ETR1_PELHO      VMNHEMRTPMHAIIALSSLLQETDLT-SEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDIATFN
SILS_SALTY      DIAHEIRTPITNLVTQTEIALSQDRTQKELEDVLYSSLEEYNRMTKMVSDMLFLAQADNNQLIPDRVRFD
CZCS_RALME      DLAHDLRTPLNNLIGHAEVALSRDRTGPEYVALVEESLVEYQRLARMIDAMLFLARADSANVALELTELQ
YCF26_PORPU     NVSHELRTPLFNIRSFLETLYEDSLDDSQKLEFLAIANKETGRLTRLVNDVLDLSRLESDQ-EYTLQPTD
ETR1_PRUPE      VMNHEMRTPMHAIIALSSLLQETELT-PEQRLMVETILKSSHLLATLINDVLDLSRLEDGSLQLEIATFN
ETR1_CUCMR      VMNHEMRTPMHAIIALSSLLQETELT-PEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDIGTFN
SPHS_SYNE7      DVAHELKTPLTSIRLLAEALRDRLQDEPQ--VWVDRLLGETQRLGQLVQDLLELSRLEQGPSGLQKLE-A
MTRB_MYCTU      DVSHELRTPLTTVRMAADLIYDHSADDPTLRRSTELMVSELDRFETLLNDLLEISRHDAGVAELSVVDLR
MTRB_MYCBO      DVSHELRTPLTTVRMAADLIYDHSADDPTLRRSTELMVSELDRFETLLNDLLEISRHDAGVAELSVVDLR
KINC_BACSU      GIAHEVRNPLTSVSGFLQIMKTQYPDRKD---YFDIIFSEIKRIDLVLSELLLLAKPQAITFKTH----Q
CUSS_ECOLI      DIAHEIRTPITNLITQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQL---IPEKK
CUSS_ECOL6      DIAHEIRTPITNLITQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQL---IPEKK
SASA_MICAN      -------------------------------------------MNRLITDILQASKSMAAQFTLHQSKFY
SASA_CYAA5      MLAHDLRSPLTAASIAVETLKNQDPTEKQQKLTAQLFNQTRNQMNRLITDILQASKSMNAQLQVHQTEVF
PCOS_ECOLX      DIAHELRTPV---SNLMMQTQFALAKERDVSHYREILLEELKRLSRMTSDMLFLARSEHGRLDKHDVDLA
MTRB_MYCLE      DVSHELRTPLTTVRMAADLIYDHSSDDPTLRRSTELMVSELDRFETLLNDLLEISRHDAGVAELSVEAVD
ARCB_SHIFL      TISHELRTPLNGIVGLSRILLDTELT-AEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVD
ARCB_ECOLI      TISHELRTPLNGIVGLSRILLDTELT-AEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVD
ARCB_ECO57      TISHELRTPLNGIVGLSRILLDTELT-AEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVD
BVGS_BORBR      TMSHEIRTPMNAIIGMLELALLRPADQEPDRQSIQVAYDSARSLLELIGDILDIAKIEAGKFDLAPVRTA
SASA_CYAP8      MLAHDLRSPLTAASIAVETLEQKQEDTERRAQLREQLYHQARKMNRLITDILQASKTMTAQLSVYYHDLF
ETR1_SOLLC      VMNHEMRTPMHAIIALSSLLQETDLT-PEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDIGTFN
ETR2_PELHO      VMNHEMRTPMHAIIALSSLLQETELT-PEQRLMVETVLKSSNLLATLINDVLDLSRLEDGSLQLDIGTFN
BVGS_BORPE      TMSHEIRTPMNAIIGMLELALLRPTDQEPDRQSIQVAYDSARSLLELIGDILDIAKIEAGKFDLAPVRTA
BVGS_BORPA      TMSHEIRTPMNAIIGMLELALLRPADQEPDRQSIQVAYDSARSLLELIGDILDIAKIEAGKFDLAPVRTA
SASA_SYNY3      MLAHDLRSPLTAASIAVDTLE--LLQHKQKPALRSQLLYQARKMDRLIEDILQASKNLNSQFQVHGRPLA
CHVG_RHIME      DVSHELKNPLTSLRSAVETLPLARNEESKKRL-MDVIQHDVRRLDRLISDIAELARADAKKVDLEKLLGD
PHOR_HAEIN      NINHELRTPLTVLQGYLEILADNNIQNPLQKKAIXAMQEQSQRMEHLLQQFNFLAKIETTS-DKDFRKFD
ETR1_CUCSA      VMNHEMRTPMHAIIALSSLLQETELT-PEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDIGTFN
KINE_BACSU      GIAHEIRNPMTALKGFIQLLKGSV--EGDYALYFNVITSELKRIESIITEFLILAKPQAIMYE----EKH
SASA_SYNJB      ---HDLRSPLTATALAVETLREGSLDKALERQLFDHARQQLRKMDSMITDILESARGAASELRIRAVETQ
ETR2_SOLLC      VMNHEMRTPMHAVVALSSLLQESELI-PEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDVGTFN
SPAK_BACSU      ALAHEIKIPITIIKGNAELLSLSM-QNEEQAEYTKYILGAGNQIEQYIYQLIHLSKTEDA-LTIHLEKAS
DIVJ_CAUCR      NMSHELRTPLNAIMGFSDIMRARMFGPLSDAEYAELIHESGGHLLDLINDVLDMSKIEAERFELQRGVFD
CREC_ECOLI      ALTHELKSPLAAIRGAAEILREG-PPPEVVARFTDNILTQNARMQALVETLLRQARLE-NRQEVVLTAVD
BASS_ECOLI      DVAHELRTPLAGVRLHLELLA------KTHHIDVAPLVARLDQMMESVSQLLQLAR--AGQ-SFSSGNYQ
MAK2_SCHPO      NMSHELRTPFSSFYGMLSLLSDTKLNEEQY----DIVSTAKQSCTSLVQDLLNFSELKSGKMKLEPDKFD
HSSS_STAS1      NVSHEIKTPLTHIHHLLDLLKFAKTDNAREQ-YIEEIYEVTTQXXXXXXXXXXXXXIDNGAHLDFDDDIQ
YCBM_BACSU      NMSHDLKTPLTVILGYIEAIQDPNMPDEERERLLGKLRQKTNELIQMINSFFDLAKLESEDKEIPITKVH
SASA_SYNJA      ---HDLRSPLTATALAVETLQQGREGSLDKAVERQLFEQQLRKMDSMITDILESARGSASELRIRAVETQ
KDPD_CLOAB      ---HDLRSPLAGIKGAASTILENLIDEKRKQELINGIYEDTEWLIRLIENLLSMTKFDEGNTKIKK-DXX
ETR1_TOBAC      VMNHEMRTPMHAIIALSSLLQETELT-PEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDVGTFN
CPXA_ECOLI      DISHELRTPLTRLQLGTALLRRRSGESKE----LERIETEAQRLDSMINDLLVMSRNQQ-KNALVSETIK
CPXA_ECOL6      DISHELRTPLTRLQLGTALLRRRSGESKE----LERIETEAQRLDSMINDLLVMSRNQQ-KNALVSETIK
CPXA_ECO57      DISHELRTPLTRLQLGTALLRRRSGESKE----LERIETEAQRLDSMINDLLVMSRNQQ-KNALVSETIK
ETR1_PASED      VMNHEMRTPMHAVIALSSLLQETELT-PEQRLMVETILKSSNLLATLINDVLDLSKLEDGSLQLDSGTFN
CUTS_STRLI      NASHELRTPLAINRTLLE------VHLSDPGAPVEL-----QQLGKTLLATNERSXXXXARSDNQIVEVD
CUTS_STRCO      NASHELRTPLAINRTLLE------VHLSDPGAPVEL-----QQLGKTLLATNERSXXXXARSDNQIVEVD
ZRAS_SALTY      GVAHEIRNPLSSIKGLAKYFAERTPAGGESHELAQVMAKEADRLNRVVSELLELVK----PAHLTLQTVN
ZRAS_SALTI      GVAHEIRNPLSSIKGLAKYFAERTPAGGESHELAQVMAKEADRLNRVVSELLELVK----PAHLTLQAVN
PLEC_CAUCR      NMSHELRTPLNAINGFSEIMMNEMFDQRYKG-YSQDIHSSGQHLLALINDILDMSKIEAGKMNLKFESMH
YVRG_BACSU      GLSHDLKTPLSSIYGYSMMLESKQYDWSPEEVMGQVVREKSEYMSKLIEDLNLTYRL---KNDALPIERK
ARCB_HAEIN      TISHEFRTPLNGIVGLSQ-IXXXXXXXXXQRNYLKTINISAVSLGYIFSDIIDLEKIDASRIELNRQPTD
RCSC_ECOLI      TVSHELRTPLYGIIGNLD-----LLQTKELPKGVDRLVTAMNNXXXXXXXXXXFSKIESEQLKIEPREFS
ERS1_ARATH      VMNHEMRTPMHAIIXXXXXXXXXXXX-PEQRVMIETILKSSNLVATLISDVLDLSRLEDGSLLLENEPFS
ATOS_ECOLI      GVAHEVRNPLTAIRGYVQILRQQTSDPIHQE-YLSVVLKEIDSINKVIQQLLEFSRPRHSQWQ----QVS
SASA_CYAP7      -------------------------------------------MNRLITDILQASKSINAXXXXXXXXXX
RCSC_SALTI      TVSHELRTPLYGIIGNLD-----LLQTKELPKGVDRLVTAMNNXXXXXXXXXXFSKIESEQLKIEPREFS
DHKJ_DICDI      NMSHEIRTPMNGIIGMXXXXXXXXXX-AEQREYLSMVQSSAGSLLTIINDILDFSKIEAGRLELDQAEFS
TORS_ECO57      AMSHEIRTPLYGILGTAQLLADNPALNAQRDD-LRAITDSGESLLTILNDILDYSAIEAGGKNVSVSDFE
RCSC_SALTY      TVSHELRTPLYGIIGNLDLLQ---TKELPKGVLVTAMNNXXXXXXXXXXXXXXFSKIESEQLKIEPREFS
MPRB_MYCVP      DAGHELRTPLTSLRTNVELLMESMIPEEDMAELRTDVIAQIEEMSTLVGDLVDLTRDDAGNAVHETVE--
KINB_PSEAE      RASHELRTPVTGMQMAFSLLRERL-DFPAESREADLIQTVDEEMSRLVLDLLNFSRYQTGMQKLELASCD
KINA_BACSU      GIAHEIRNPLTAIKGFLQLMKPTMEGNEH---YFDIVFXXXXXXXXXXXXXXXXAKPQQNAVKEYL---N
ETR1_ARATH      VMNHEMRTPMHAIIALSSLLQETELT-PEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFN
BASS_SALTY      DVAHELRTPLSGVRLHLELLS------KTHNVDVAPLIARLDQMMDSVSQLLQLARVGQS---FSSGNYQ
PHY_MOUSC       ----EIQNPLDGIH-FARSFMEHTVLSEDQKQLIETSATCEKQLRRILADM-DLASIEKGYLELETGEFS
TORS_ECOLI      AMSHEIRTPLYGILGTAQLLADNPALNAQRDD-LRAITDSGESLLTILNDILDYSAIEAGGKNVSVSDFE
PHYB_ANASP      -ASHDLKEPLRGIHNYSNFLMEDIIDAPGKEKLLTLI-RLTQRMEDLIDSLLHFSRL--GRVDLSMQDTD
CIAH_STRR6      NASHELRTPLAVLQNRLETLF-----RKPEATIMDVSLEEVRNMRFLTTSLLNLARRDDGKPELAEVPTS
CIAH_STRPN      NASHELRTPLAVLQNRLETLF-----RKPEATIMDVSLEEVRNMRFLTTSLLNLARRDDGKPELAEVPTS
IRLS_BURPS      NLAHDMRTPLTNLLAEAQV---ALSKPRTADEYRDVIIDEYQRLSRMIEDMLFLARSDNAQSHLAIRTLD
ETR1_BRAOL      VMNHEMRTPMHAIIALSSLLQETELT-PEQRLMVETVLKSSSLLATLMNDVLDLSRLEDGSLQLELGTFN
FIXL_BRAJA      --AHELNQPLAAISNYMKGSRRLLAGSSDPNTKVESALDRAAE-----------QALRAGQIIRRLRDFS
SASA_NOSP7      --------------------------------------NQTKVIDRMITDLLQVGKVQLGKVFLDVLE--
PHYA_ANASP      -ASHDLQEPLNQVANYVQLLEMRYQDQLDADAFITFAVEGVSLMQTLIDDVLAYSK-----VDTQAIAFQ
PHY1_SYNY3      -ASHDLQEPLNQVSNYVQLLEMRYSEALDEDAFIDFAVTGVSLMQTLIDDILTYAKVDTQYAQLTFTD--
MPRB_MYCPA      DAGHELRTPLTSLRTNVELLMASMLPEQEMVELRADVLAQIEELSTLVGDLVDLTRDDAGQVVHEPVDMS
DHKG_DICDI      NMSHEMRTPLNHIIGSIELLKSNHLFNSDQKELLDISAKSSESLLFMVNNILDLSKVEQGKTKLNLTNFN
YFHK_ECOLI      HLSHELKTPLASMREGTELLADQVVGPPEQKEVVSILDSSSRNLQKLIEQLLDYNRKQADSA-VELENVE
RSSA_SERMA      DAAHELRTPIAAVLAQLHLLTQ-VTEQQERREIIGDMQQGLDRAASLSRQLINLAKLEAEDFPLKIEAVD
GTCS_ANEMI      DLSHDFKTPITTIQGYAMALQMGVVDSPEQRRYLEMIYNKSIIVTALVEDMFQLATLDSPDLPSAEEHGR
DIVL_CAUCR      NVSYELRTPLTTIIGYSELLEDGISERGRN--HXXXXXXXXTQLARSIDDVLDMAQIDAGEMALEIEDIR
MPRB_MYCA1      DAGHELRTPLTSLRTNVELLMASMLPEQEMVELRADVLAQIEELSTLVGDLVDLTRDDAGQVVHEPVDMS
DHKL_DICDI      --SHDIRTPMSNIIGMADLLLDTSLS-QHQHHYLEIIKNSXXXXXXXXXXXXXXXKIEAGKLDIDYESFD
SASA_ANASP      ----------------------------------------------LVVNLLRQARTQAKTIDKMIADLL
MPRB_MYCSS      DAGHELRTPLTSLRTNVELLMASLPEEEMAGLRADVIA-QIEELSTLVGDLVDLTRDEAGGVVYETVDMA
MPRB_MYCSK      DAGHELRTPLTSLRTNVELLMASLPEEEMAGLRADVIA-QIEELSTLVGDLVDLTRDEAGGVVYETVDMA
MPRB_MYCSJ      DAGHELRTPLTSLRTNVELLMASLPEEEMAGLRADVIA-QIEELSTLVGDLVDLTRDEAGGVVYETVDMA
FIXL_RHIME      --AHELNQPLSAIANYSHGCTRLLRDMDDA---------VATRIREALEEVASQS-LRAGQIIKHLREFD
DHKH_DICDI      TMSHEMRTPLAGIMGINSWLSTSSPQLTSEQLDGCHTIDMAEALLVLINNILDLSKLEENKIILEETEFY
DHKF_DICDI      TISHEIRTPLNGIITMGEMLLSTSPLNTEQHDIAETIFGSSELLLSITSDILDFSKIEASKLELEMIEFD
SASA_ANAVT      ----------------------------------------------LVVNLLRQARTQAKTIDKMIADLL
MPRB_MYCLE      DAGHELRTPLTSLRTNVELLIASMADQEMADLRADVLA-QIEELSTLVGDLVDLTRDDAGQVVHEPIDMS
FIXL_AZOC5      --AHELNQPLSAIANYIKGSRRLLDDGDPKRI----------PMLQGALDKAAEQALRAGQIIRRLRDFS
KIND_BACSU      STAHEIRNPLTGISGFIQLLQKKYKGEEDQ-LYFSIIEQEIKRINQIVSEFLVLGKPTAEKWELN----S
YXDK_BACSU      ---HQVKTPLSVINL--------IIQEEDEPVF-EQIKKEVRQIEFGLETLLYSSRLDLFERDFKIEAVS
YEDV_ECOLI      DLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADKNNVLVKLDSLS
SASA_THEEB      --AHELRNPLTAGGIALETLESNLQEESSQQLPIEDIQSQTQTMGQLITDLLLAARGPQDKLQIMARQLD
PHY1_SELMA      -----------------------------------------EKQIRKILDDMDLESIEDGYLELDTTEFM
NTRB_SHIFL      GLAHEIKNPLGGLRGAAQLLSKALPD-PSLLEYTKVIIEQADRLRNLV------DRLLGPQLPGTRVTES
NTRB_ECOLI      GLAHEIKNPLGGLRGAAQLLSKALPD-PSLLEYTKVIIEQADRLRNLV------DRLLGPQLPGTRVTES
NTRB_ECO57      GLAHEIKNPLGGLRGAAQLLSKALPD-PSLLEYTKVIIEQADRLRNLV------DRLLGPQLPGTRVTES
DHKE_DICDI      TVSHEVRTPINGILASVE-ILDGSQLDVTQRDFLSCIKQSAXXXXXXXXXXXXFSKIEAGKFELDRVEFN
AFSQ2_STRCO     DMSHELRTPXXXXXXXXXXXXXXXXXXXXXXXXVRLVVSETRRLNDLVENLMEVTRFDAGTARXXXXXXQ
SASA_SYNE7      ---------------------------------------QLREIERMIAEILEATRHSGESLRINPREVV
YVCQ_BACSU      ---HHMKTPVSVISLMIQEGKNGT--SSSFPTFLEELEDENERFRHGLDMMLQTARLEEFAFDVKPQTFD
NTRB_SALTY      GLAHEIKNPLGGLRGAAQLLSKALPDPA-LTEYTKVIIEQADRLRNLV-DRL-LGPQHPG---MHITE-S
NTRB_SALTI      GLAHEIKNPLGGLRGAAQLLSKALPDPA-LTEYTKVIIEQADRLRNLV-DRL-LGPQHPG---MHITE-S
KINB_BACSU      SVAHEVRNPLTVVRGFVQLLNDETLQNKSSADYKKLVLSELDRAQGIITNYLDMAKQQLYEKEV----FD
MPRB_MYCBP      DAGHELRTPLTSLRTNVELLMASMAPGKQEMVDLRAVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMA
MPRB_MYCBO      DAGHELRTPLTSLRTNVELLMASMAPGKQEMVDLRAVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMA
SASA_PROMP      --AHELRTPLTAATLAIQSQKLGQIDIKK---LQDVIKRRLEEIELLSQDLLEVTKWEAQKIDLGNISAE
SASA_PROM2      --AHELRTPLTAATLAIQSQKLGQIDISK---LQEVIKRRLEEIELLSQDLLEVTKWEAQKIDLGNISAE
PILS_PSEAE      GIAHEIRNPLGAISHAAQLLQESELDAPDRRL-TQIIQDQSKRMNLVIENVLQLSRRRQAEPQQLDLKEW
MPRB_MYCTU      DAGHELRTPLTSLRTNVELLMASMAPGKQEMVDLRAVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMA
MPRB_MYCTA      DAGHELRTPLTSLRTNVELLMASMAPGKQEMVDLRAVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMA
MPRB_MYCS2      DAGHELRTPVELLMAAQEPGAPPLPEDEMAGLRADVIA-QIEELSTLVGDLVDLTREDAGGITPEPVDMA
VIRA_AGRT9      GIAHEFNNILGSILGHAELAQNSVSRTSVTRRYIDYIISSGDRAMLIIDQILTLSR----KQERMIKPFS
VIRAW_RHIRD     GIAHEFNNILGSILGHAELAQNSVSRTSVTRRYIDYIISSGDRAMLIIDQILTLSR----KQERMIKPFS
PHOR_PSEAE      NVSHELRTPLTVIAGY-----------------LETLLDNVEDVNPXXXXXXXXXXXXXXNXXXXXXXXX
MAK3_SCHPO      NISHELRTPFSGFYGMLSLLDDTNLDSEQRDIVSAARIS-CEMLLRVINDLLNFSKLEAGKVTLESLEFS
HSSS_STAES      NVSHEIKXXXXXXXXXXXXXXXXXXXXXXXXC-----INEMFEITNQVXXXXXXXXXXXXXXXXXXXTFN
MAK1_SCHPO      NMSHEIRTPLIGITGMVSFLLETQMS-AEQLSYARIIQQSAKSLLTVINDILDLSKVRAGMMKLTSQRFS
PHY2_CERPU      YIRQEIKNPLCGITFTRQLLEDTDLSD-DQKQFLDTSAVCEQQLQKVLNDM-DLESIEDGYLELDTAEFE
NTRB_KLEOX      GLAHEIKNPLGGLRGAAQLLSKALPDPALM-EYTKVIIEQADRLRNLV-DRL-LGPQHPG---MHVTE-S
MPRB_MYCUA      DAGHELRTPLTSLRTNVESMEPGAPRLPEQGLREDVVA-QIEELSTLVGDLVDLTRGDAGVVVHEPVDMA
ZRAS_ECOLI      ----EIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSELLELVK--PTHLALQAVD--
Y3689_SHEFN     GIAHEINNPTGLISLFTAAMKDLTPAAKHYGLNPDIAIEEAKRISRIVNDLKRYAMP-------HIADYT
NISK_LACLA      ALSHDVKTPLTVLKGNIELLEMTEV-NEQQADFIESMKNSLTVFDKYFNTMISYTKLLNDE-----NDYK
PMRB_PECCC      DVAHELRTPLGIRXXXXXXXXXXXIDCSS-------LIKRIDKMVKTVEQLLLLARVSAGHHELKDVIFP
NTRYL_RICPR     -VAHEIKNPLTPILLASERLSSEINEKSEFESYLKMIIRHTNDIKNIVSEFVLFARLPAPK-------FT
NTRYL_RICBR     -VAHEIKNPLTPILLASERLSPEIKERAEFENYLKMIIRHTNDIKNIVSEFVLFARLPAPKF--------
HSSS_STAEQ      NVSHEVKXXXXXXXXXXXXXXXXXXXXXXXXC-----INEMFEITNQVXXXXXXXXXXXXXXXXXXXTFN
HSSS_STAAW      NVSHEIKTPLTHIHHLLSELQQ-TSDNTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAAS      NVSHEIKTPLTHIHHLLSELQQ-TSDNTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
ZRAS_ECO57      ----EIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSELLELVK--PTHLALQAVD--
SASA_PROMS      --AHELRTPLTAATLAVQSQKLGQIDISK---LQEVIKRRLEEIELLSQDLLEVTKWEAQKIDLGNISAE
SASA_PROM0      --AHELRTPLTAATLAVQSQKLGQIDISK---LQEVIKRRLEEIELLSQDLLEVTKWEAQKIDLGNISAE
KDPD_ECOLI      ALSHDLRTPLTVLFGQAEILTDLASEGSPHARQASEIRQHXXXXXXXXXXXXDMARIQSGGFNL-----K
HSSS_STAAT      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAAE      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAAC      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAA8      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAA3      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
NTRYL_RICTY     -VAHEIKNPLTPILLASERLSAEIKDKSEFESYLKMIIRHTNDIKNIVSEFVLFARLPAPK-------FT
HSSS_STAAN      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAAM      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAA9      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAA2      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAA1      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAAR      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
HSSS_STAAB      NVSHEIKTPLTHIHHLLSELQQ-TSDKTLRQQYINDIYTIXXXXXXXXXXXXXXXXXXXXXXXXFDDKIQ
NTRYL_RICFE     -VAHEIKNPLTPILLASERLSPEIKEKEEFENYLKMIIRHTNDIKNIVSEFVLFARLPAPK-------FT
COPS_PSESM      DIAHELRTPISNLRTHTEVI---LAKKRAPEVYXXXXXXXXXXXXXIIDGMLFLAKSDNGLIVPEAVELD
BPHY_PSEAE      ----------------------------------------SSRMERLVSQILDMSRLQSGGLTVNPVDTD
SASA_PROMA      --AHELRTPXXXXXXXXXXXXXGQIDLIKLQEVVKRRLEEIESLSK---DLLEVGTTRWEAL-FNPQEAN
NTRYL_RICCN     -VAHEIKNPLTPILLASERLSPEIKERVEFENYLKMIIRHTNDIKNIVSEFVLFARLPAPK-------FT
ZRAS_KLEOX      ----EIRNPLSSIKGLAKYFAERTPADGEAHQLALVMAREADRLNRVVSELLELVRLKYQSVDLNEVITH
PHY_PINSY       -----------------------------------------ERQMQKVMDDMDLESLEDGYMELDTAEFI
PHY_PICAB       -----------------------------------------------VLDDADLESIEDGYLELDTIEFT
SASA_PROM9      --AHELRTPLTAATLAVQSQKLGQIDIAK---LQEVIKRRLEEIELLSQDLLEVTKWEAQKIDLGNISAE
QSEC_HAEIN      DAAHELRSPLAALRIQIEVAQDDVALREQALLHLTQGIDRASQLIEQLLTLSRLDNLQALET-LQLLDWE
SASA_SYNS9      ----------------------------DMDRFQDVVTRRLEEMEALSKDLLEVGTFNPQRLDLASVSAE
SASA_PROM3      --AHELRTPLAVLALQSQQLGQINIEH-----FQDVVKRRLDEIELLSKDLLEVKSFNPQNLDLGNIAAE
PHY1_PHYPA      ----EIKNPLCGLTFTRQLLEDTDLSD-DQQQFLDTSAVCEQQLQKSLNDM-DLESIEDGYLELDTAEFE
NODV_BRAJA      ------------------------------------IIEDAIRASEVIRSIRALAKIEMVPLDINQVVRD
GRAS_STAHJ      ---HDIKTPVTAMKL--------LIDQEEEGKRKKSLLYEWARINELLDKQLYLTRLESKNRDMYFEETS
PHYB_SOYBN      ----------------------------EQKQFLETSVACEKQMLKIIRDV-DLESIEDGSLELEKGEFL
RSTB_ECOLI      GIAHELRTPL-VRLRYRLEMSDNLSAAESQALNRDI-----SQLEALIEELLTYARLDRPQNELHLSEPD
VIRA_AGRT5      GIAHEFNNILGAILGYAEMAQNMLRRSSVTRRHIDQIISSGDRARLIIDQILTLSR----KLERVTKPFS
SASA_SYNPX      ----------------------------DMTRFQDVITRRLEEMEALSKDLLEVGTFNPQRLDLASVSAE
PHYD_ARATH      --------------------------NEDQKQLLETSVSCEKQISKIVGDM-DVKSIDDGSFLLERTEFF
SASA_SYNS3      --AHELRTPLTAATLAVQSQELGQIDHR----FRDVLKRRLEEIALLSKDLLEVGSTRWEAL-FNPQRLD
SASA_PROMM      --AHELRTPLAVLALQSQQLGQINIEH-----FQDVVKRRLDEIELLSKDLLEVKSTKWEDL-FNPQNLD
PHYB_TOBAC      YLCQEIKSPLNGIR-FTNSLLEATDLTENQKQYLETSAACERQMSKIIRDV-DLENIEDGSLTLEKEEFF
PHYB_SOLTU      YICQEIKSPLNGIR-FTNSLLEATNLTENQKQYLETSAACERQMSKIIRD-IDLENIEDGSLTLEKEDFF
DCTB_RHILE      GVAHEINQPVATIRAYADNARTFLGQTAPAGENLESIAALTERIGSITEELKTFARKGRGSAE----PTG
TCSB_EMENI      ----------------------------------------------------------------------
PHYB_ORYSJ      ----------------------------DQRQFLETSTACEKQMSKIVKDA-SLQSIEDGSLVLEKGEFS
PHYB_SORBI      YICQEIKNPLSGIR-FTNSLLQMTDLNDDQRQFLETCSACEEQMSKIVKDAT-LQSIEDGSLVLEKSEFS
PHYB_ORYSI      ----------------------------DQRQFLETSTACEKQMSKIVKDA-SLQSIEDGSLVLEKGEFS
PHYB1_SOLLC     YICQEVKSPLNGIR-FTNSLLEATNLTEYQKQYLETSAACERQMSKIIRDV-DLENIEDGSLTLEKEDFF
DCTB_RHIME      GVAHEINQPVATIRAYADNARTFL--HRGQTVTAAENMESIAELTERVGAITDELRRFARKGHFAAGPTA
PHYA_CUCPE      -----------------------------------------QKQISKVLDESDIDKIIDGFIDLEMDEFT
DHKI_DICDI      NISHELLSPMNSIIGMVGLCLD--VAPRNLKEMLNDVVESSKILLDLLHQILDFTTLESNSLAVRPFPFK
PHYC_SORBI      -----------------------------------------DQLKKILHDT-DLESIEQCYMEMNTVEFN
QSEC_SALTY      DAAHELRSPLAALKVQTEVAQLSGDDPLSRDKALTQLHAGIDRATRLVDQLLTLSRLDSLNNLQDVAEIS
QSEC_SALTI      DAAHELRSPLAALKVQTEVAQLSGDDPLSRDKALTQLHAGIDRATRLVDQLLTLSRLDSLNNLQDVAEIS
CSEC_STRCO      DIAHELRTPVTGLLTAAELLPPGRPT--------ELVLDRAKAMRTLVEDVLEVARLDGASERAELQDIM
ENVZ_SALTY      GVSHDLRTPLTRIRLATEMMGE------EDGYLAESINKDIEECNAIIEQFIDYLRT-GQEMPMEMAD--
NTRB_PROVU      GLAHEIKNPXXXXXXXXXXXXKSLPDPA-LTEYTQVIIEQADRLRTLV-DRL-LGPQHPGKKTHQ----S
ENVZ_SALTI      GVSHDLRTPLTRIRLATEMMGE------EDGYLAESINKDIEECNAIIEQFIDYLRT-GQEMPMEMAD--
PHYC_ARATH      YLRHEVKDPEKAIS-FLQDLLHSSGLSEDQKRLLRTSVLCREQLAKVISDS-DIEGIEEGYVELDCSEFG
GLNK_BACSU      ----------------------------------------------------------------------
NTRB_VIBAL      GLAHEIKNPLGGLRGAAQLLEKMLPD-PSLTEYTHIIIEQXXXXXXXXXXXXGPQKPKKTQENLHQILEK
PHYC_ORYSJ      -----------------------------------------EQLKKILHDT-DLESIEQCYTEMSTVDFN
PHYC_ORYSI      -----------------------------------------EQLKKILHDT-DLESIEQCYTEMSTVDFN
EVGS_ECOLI      TMSHEIRTPISSIMXXXXXXXXXXXXKEQRVEAISLAYATGQSLLGLIGEILDVDKIESGNYQLQPQWVD
EVGS_ECO57      TMSHEIRTPISSIMXXXXXXXXXXXXKEQRVEAISLAYATGQSLLGLIGEILDVDKIESGNYQLQPQWVD
PHYA_ARATH      -----------------------------------------QKQLSKILDDSDLESIIEGCLDLEMKEFT
VIRAL_RHIRD     GIAHEFNNILGVILGYA--MAQNILHRRTYARYIDRINAESNRARLIIDQILALSR----RRERTARPFN
SLN1_YEAST      ----------------------------------------------------------------------
NTRY_AZOBR      ----------------------------------------------------------------------
CYAD_DICDI      ----------------------------------------------LLNDTKLILAIESGVISREDVSVN
PHYA_SOLTU      -----------------------------------------------ILDDTDLDSIIEGYLDLEMLEFK
GRAS_STAAR      ---HDIKTPVTAMKL--------LIDQEENQERKQALLFEWSRINSMLDTQLYITRLESQRKDMFFDYVS
ENVZ_SHIFL      GVSHDLRTPLTRIRLATEMMQDGYLDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVI---AAESG
ENVZ_ECOLI      GVSHDLRTPLTRIRLATEMMQDGYLDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVI---AAESG
PHYB_ARATH      ---------------FANSLLEATDLNEDQKQLLETSVSCEKQISRIVGDM-DLESIEDGSFVLKREEFF
METK_PICTO      ----------------------------------------------------------------------
TLPA_BACSU      ----------------------------------------------------------------------
NTRY_AZOC5      --AHEIKNPLTPIQLSAERLKRKFGRHQDREIFTDTIIRQVGDIGRMVDEFSSFARMPKPVVD-------
BCES_BACHD      ---HEIKTPLTAMHLIIDRLEDRTI--KGQLTY------EWMRIHLLLDQQLHQKRIPFMENDLYVEKVN
QSEC_ECO57      DAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLDSLDNLQDVAEIP
QSEC_ECOLI      DAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLDSLDNLQDVAEIP
PHYA_SOYBN      -----------------------------------------------------------GYLDLEMAEFT
MCPB_BACSU      ----------------------------------------------------------------------
NTRB_RHOCA      --AHEIKNPLAGIAGAAQLLSMGLSGEDLE--LTDLIVDETRRIVKLLEQVEQFGNVEMKPVNIH-----
TLPB_BACSU      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------NQEAYLSKFSSSYEQLSKLTKECLFYSEIKQLKRDVENLSFV
PHYA1_TOBAC     -----------------------------------------------------------GYLDLEMLEFK
PHYA1_MAIZE     ------------------------------------------QLNKILADLDQDNITDKSSLDLDMAEFV


                         .         .         .         .         *         .         .:420
query           LTELTEEVLVKNSVDINKNNLTVIKNYSPNEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
PHOR_BACSU      PAKMLGEILLKHKAD--EKGISLHLNV-PKDPQYVSGDPYRLKQVFLNLVNNALTYTPEGGSVAINVKPR
VANS_ENTFA      IGRTVAELLPDFQTLAEANNQRFVTDIPAGQ--IVLSDPKLIQKALSNVILNAVQNTPQGGEVRIWSEPG
YYCG_BACSU      IVRFMSLIIDRFEMT-KEQHVEFIRNL-PDRDLYVEIDQDKITQVLDNIISNALKYSPEGGHVTFSIDVN
GACS_PSESY      LRDLLQDTLTILAPAAHAKQLELVSLVYRDTPLALSGDPLRLRQILTNLVSNAIKFTREGTRAMLEDETE
WALK_STAAW      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAU      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAT      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAS      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAR      M--FINKII--NRHEMSTKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAN      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAM      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAE      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAC      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAAB      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAA9      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAA8      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAA3      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAA2      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAA1      M--FINKII--NRHEMSAKDTTFIRDI-PKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQN
WALK_STAHJ      M--FINKII--NRHEMAAKDTTFVREI-PSETIFTEIDPDKMTQVFDNVITNAMKYSRGEKRVEFHVKQA
WALK_STAES      M--FINKII--NRHEMAAKDTTFVREI-PQQTIFAEIDPDKMTQVFDNVITNAMKYSRGEKRVEFHVKQA
WALK_STAEQ      M--FINKII--NRHEMAAKDTTFVREI-PQQTIFAEIDPDKMTQVFDNVITNAMKYSRGEKRVEFHVKQA
WALK_STAS1      M--FINKII--NRHEMSAKDTTFVREV-PTETIFTEIDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQA
YCLK_BACSU      LIEVFEIVKLQQQAEEKQNKLMI----QVEDHVIVHADYDRFIQILVNITKNSIQFTQNGD---IWLRGM
WALK_STASR      XXXXXXXXXXRHEMSQGKN-VTFIRDI-PVKGLFVEIDPDKMTQVFDNVITNAIKYSESHKRVEFHVKQT
RESE_BACSU      VNEFLEKIIRKFSGVAKEKNIALDHDISLT-XXXXXXXXXXXXQVFTNLIDNALRHTSAGGSVSISVHSV
CSSS_BACSU      IVEVTEEVIER----LKWARKELSWEIDVEEDILMPGDPEQWNKLLENILENQIRYAETK----IEISMK
SRRB_STAAW      IAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMD--RMDQVLTNLIDNASRYTKPGDEIAITCDEN
SRRB_STAAU      IAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMD--RMDQVLTNLIDNASRYTKPGDEIAITCDEN
SRRB_STAAS      IAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMD--RMDQVLTNLIDNASRYTKPGDEIAITCDEN
SRRB_STAAR      IAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWTYDMD--RMDQVLTNLIDNASRYTKPGDEIAITCDEN
SRRB_STAAC      IAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMD--RMDQVLTNLIDNASRYTKPGDEIAITCDEN
SRRB_STAA8      IAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMD--RMDQVLTNLIDNASRYTKPGDEIAITCDEN
SRRB_STAAN      IAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMD--RMDQVLTNLIDNASRYTKPGDEIAITCDEN
SRRB_STAAM      IAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMD--RMDQVLTNLIDNASRYTKPGDEIAITCDEN
PHOR_KLEPN      DVPMMLRVVEREAQTLSQEKQTLI--FTVDEQLKVLGNEEQLRSAISNLVYNAVNHTPPGTEIRVSWQRT
BARA_SHIFL      LRSTLDEVVTLLAHSSHDKGLELTLNIKSDVPDNVIGDPLRLQQIITNLVGNAIKFTENGNDILVEKRAL
BARA_ECOLI      LRSTLDEVVTLLAHSSHDKGLELTLNIKSDVPDNVIGDPLRLQQIITNLVGNAIKFTENGNDILVEKRAL
BARA_ECOL6      LRSTLDEVVTLLAHSSHDKGLELTLNIKSDVPDNVIGDPLRLQQIITNLVGNAIKFTENGNDILVEKRAL
BARA_ECO57      LRSTLDEVVTLLAHSSHDKGLELTLNIKSDVPDNVIGDPLRLQQIITNLVGNAIKFTENGNDILVEKRAL
DHKB_DICDI      ILKMLDNSIRIVSKNIYEKGLDLCIFIDPNVPVIVNGDQRRIKQILLNFLSNSIKFTN-HGQIIIRVKLE
YKOH_BACSU      --------LIKAARAVMQTLQSVYQRETDKESLLVKADEERIKQLLTILLDNAIKYSE---------KPI
DHKA_DICDI      IIETCQAVIHMLSVAAN-DDVDILLRVPPNVPRIIFGDAMRMRQVLLNLLSNAIKFTS-RGHVLTDISVT
SEX3_MYCLE      VDIIVSEAIARHKVAADTAAIEV--RTDPPSGLRVLGDQTLLVTALANLVSNAIAYS-PGGSLVSISRRR
LUXQ_VIBHA      FTDTMRTLEIYRPICTNKGVELVIENLDPNVEIFT--DQVRLNQILFNLVSNAVKFT-PIGSIRLHAEGA
ARLS_STAHJ      EVNINEEIRIKSLKQLHPDYQ--FKTHLSKKPLTLQINRHQFEQLLLIFIDNAMKYDKDNKQIEIATQ-L
PHOR_ECOLI      LNEKVDVPMMLRVVEREAQTLSQKKQFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHITVRWQRV
RPRX_BACFR      ANELITGVINTFALKVERYNGKITSNLEATNPV-IFADEMHITNVIFNLMDNAVKYKKPEEDLVLNVRTW
BAES_ECOLI      LIPLLEVAGGAFRERFASRGLKL--QFSLPDSITVFGDRDRLMQLFNNLLENSLRYTDSGGSL--QISAG
DSPA_SYNY3      LYQLIEQSLRSYQLNAKDKQLQLEKILDPDLPFALGNYDLLL-QVMTNLIGNSFKFTKAGGKIIVRAYPL
DHKD_DICDI      MVNLGQTVLIASCFEILAREKSLFSIITPSEPMMAAIDADKMQRVITNLISNAFKFTPSGGAVILEKFDL
PDHS_OCHA4      LNDAIAEAIALMQPQANRERVIIRSSFQSNLPDIV-ADTRSIKQVALNLLSNAVRFTAPGGQVIVSTSYE
DOKA_DICDI      LLPMIEEVLDSQATAANRKGIDLIRDYPVPPVIF--GDRNSLKKVLLNLVGNAVKFTETGLEISTDYESG
SAES_STAAE      LDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINISEN
SAES_STAAC      LDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINISEN
SAES_STAA8      LDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINISEN
SAES_STAA3      LDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINISEN
RPFC_XANCP      LREMIGSVNLILQPQARGRRLEYGTQVADDVPDLLKGDTAHLRQVLLNLVGNAVKFTEHGHVLVTRVSGS
RPFC_XANC8      LREMIGSVNLILQPQARGRRLEYGTQVADDVPDLLKGDTAHLRQVLLNLVGNAVKFTEHGHVLVTRVSGS
DHKK_DICDI      MRELTQQICHVLSGQANEKNIHLSCEVSDKIPSILLGDSGRILQILMNLTGNALKFTQSGXXXXXXXXXX
SAES_STAAW      LDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINIENK
SAES_STAAS      LDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINIENK
SAES_STAAR      LDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINIENK
SAES_STAAN      LDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINIENK
SAES_STAAM      LDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINIENK
SAES_STAAB      LDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRT-PLERILTNLLDNALKFSNVGSRIDINIENK
PHOR_SHIDY      LNEKVDVPMMLRVVEREAQTLSQKKQFEIDNALKVSGNEDQLRSAISNLVYNAVNHTPEGTHITVRWQRV
ARLS_STAEQ      NVDINSEIQSRVKSLQHLHPDYTFETHLATKPIQLKINRHQFEQLLLIFIDNAMKYDTEHKHIKI-VTQL
SAES_STAES      LDQLLVNILQPYEQHIKQENRTLEVNFCTDIDAFYQYRP-PIERILTNLLDNALKFSNSGSRIDIIISEC
SAES_STAEQ      LDQLLVNILQPYEQHIKQENRTLEVNFCTDIDAFYQYRP-PIERILTNLLDNALKFSNSGSRIDIIISEC
ARLS_STAES      NVDVNSEIQSRVKSLQHLHPDYTFETHLATKPIQLKINRHQFEQLLLIFIDNAMKYDTEHKHIKI-VTQL
SENX3_MYCTU     VDTIVSEAISRHKVAADNADIEVRTDAPSN--LRVLGDQTLLVTALANLVSNAIAYS-PRGSLVSISRRR
SENX3_MYCBO     VDTIVSEAISRHKVAADNADIEVRTDAPSN--LRVLGDQTLLVTALANLVSNAIAYS-PRGSLVSISRRR
ARLS_STAS1      NVEINQEIASRKSLSQLHSDYTFEFDAFP-KPLNIKIDRYQFEQMLIIFIDNAMKYDQINKYIQIQTK-L
CHVG_AGRT5      PLDL--DVLMKGLVDISRQISTKKKSVAAKTSFVVNGHDLRIGQIVTNLIENARSFSEESGRITVRLSR-
ARLS_STAAW      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
ARLS_STAAS      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
ARLS_STAAR      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
ARLS_STAAN      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
ARLS_STAAM      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
ARLS_STAAC      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
ARLS_STAAB      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
ARLS_STAA8      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
ARLS_STAA3      VNDISSEAQTVHINDEIRSRIHSLKQLHPDKNLEIKMKPHQFEQLFLIFIDNAXXXXXXXXXXXXXXXXX
LUXQ_VIBVY      FYDTLNTLEIYRPICREKGVSFEIHNQIPL-DCQLHTDQVRLNQIMFNLISNAVKFT-PAGRIEVSFKRS
LUXQ_VIBVU      FYDTLNTLEIYRPICREKGVSFEIHNQIPL-DCQLHTDQVRLNQIMFNLISNAVKFT-PAGRIEVSFKRS
PDHS_BRUSU      LNDAIGEAIALMQPQANRERVIIRSSFQSNLPDIV-ADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYE
PDHS_BRUSI      LNDAIGEAIALMQPQANRERVIIRSSFQSNLPDIV-ADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYE
PDHS_BRUO2      LNDAIGEAIALMQPQANRERVIIRSSFQSNLPDIV-ADSRSIKQVALNLLSNAVRFTAPGRQVIVSTSYE
PDHS_BRUME      LNDAIGEAIALMQPQANRERVIIRSSFQSNLPDIV-ADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYE
PDHS_BRUAB      LNDAIGEAIALMQPQANRERVIIRSSFQSNLPDIV-ADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYE
PDHS_BRUA2      LNDAIGEAIALMQPQANRERVIIRSSFQSNLPDIV-ADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYE
PDHS_BRUA1      LNDAIGEAIALMQPQANRERVIIRSSFQSNLPDIV-ADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYE
PDHS_BRUC2      LNDAIGEAIALMQPQANRERVIIRSSFQSNLPDIV-ADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYE
SENX3_MYCS2     VDSIVSEAVSRHKVAADNSQISITTD-APT-GYRVLGDEGLLVTAIANLVSNAIAYS-PNGTDVSISRRK
MTRB_MYCPA      LRSTVQSAL-SNVGHLAEDAGIELQVELPAEEVIAEVDTRRVERILRNLIANAIDHAEH--------KPV
VANS_ENTFC      LVQMTDEFYPQLSAH---GKQAVI--HAP-EDLTVSGDPDKLARVFNNILKNAAAYSEDNS--IIDITAL
LUXQ_VIBCH      LKELVCAIDRIYRPLCNEKGLELVVNSNITTAAIVRSDQIRINQILFNLLNNAIKFTHQGS-IRVELQLI
ETR1_MALDO      LHSVFREVMIKPVASIKR--LSVTLNIAADLPMYAIGDEKRLMQTILNVVGNAVKFSKEGSISITDFFPV
DLTS_STRA3      LSVLCQEVLLTESLAYEEEKCL---NDTIEDDVWIVGEESQIKQILIILLDNAIRHSLSKSEIQFSLKQA
Y1002_RHIME     VAEAIAEAMLSHQAREKGVRLTSRVTRSVGE---INADQRAFQQILINLIGNAIKFTDRGGLVTVDAA-L
HSSS_STAHJ      FKELITDIIRHEQYGIDNKQLMLMSDI---DTVHFRGNNRLLHQACSNLIQNAIKYSNPNSMIDVNLFN-
DHKC_DICDI      LCHVIEDVCAMVSPQAQAKSLQIASFIFIHCPLSFYGDPIRLRQVLLNLIGNGLKYTN-KGQVCISVEPE
LUXQ_VIBPA      DTMRTLENIYRPICENKGVELVIENQLDGNVEIFT--DQVRLNQILFNLVSNAVKFT-PSGCVRLHAEGA
DLTS_STRA5      LSVLCQEVLLTESLAYEEEKCL---NDTIEDDVWIVGEESQIKQILIILLDNAIRHSLSKSAIQFSLKQA
CUSS_ECO57      MLNLADEVKVFDFFEALAEDRGVELQFVGDE-CQVAGDPLMLRRALSNLLSNALRYTPPGEAIVVRCQTV
YCF26_PORYE     QTVRTYQLSAKDKIDIEENLPCILGNYS------------LVLQILANLIGNSLKFTHSDGIIVLNSTPL
TCSA_EMENI      IREIVGAV-VRNCRSSLQEGVELDTEISPKLPTRMRGDPLRYRQVLQNLVGNAVKFTEKGS---IHVKXX
ETR1_PELHO      LHAVFRQVLIKPIASVKK--LFITLNVSPDLPEYVIGDEKRLVQIMLNVVGNAVKFSKEGIISVTDFFPV
SILS_SALTY      LSQNSLKVFRVFSEALGPKETPILLLKFNGMPCLVEGDPQMFRRAINNLLSNALRYTPEGQAITVSIRE-
CZCS_RALME      LNAELRKLSAYFSVLAEERSVVI----RVSGDATLVADAILFQRAINNVLSNAVRHAWPNSMIDLVVRR-
YCF26_PORPU     LVSAVEQTIIDLHIDIEQNLQCVLGNYN------------LILQILANLVVNSLKFTHPNGIIILEVQHF
ETR1_PRUPE      LHSVFREVLIKPVASVKK--LSVSLNLAADLPVQAVGDEKRLMQIVLNVVGNAVKFSKEGSISITEFFPA
ETR1_CUCMR      LHAVFKEVLIKPVTLVKKLSLTL--HLGPDLPVFAVGDEKRLMQAILNVVGNAVKFSKEGSISISDFHPV
SPHS_SYNE7      VDLVALLTSVRNSLEPLAEPLRLGWAYQGPEQGFVRGDRQRLFRLWLNLVDNAIRHSPSGGCLYVELRQ-
MTRB_MYCTU      TTHLAEEAGIELLVDL------------PAEQVIAEVDARRVERILRNLIANAIDHAEH--------KPV
MTRB_MYCBO      TTHLAEEAGIELLVDL------------PAEQVIAEVDARRVERILRNLIANAIDHAEH--------KPV
KINC_BACSU      LNEILKQVTTLLDTNAILSNIVIEKNFKETDGCMINGDENQLKQVFINIIKNGIEAMPKGGVVTISTAKT
CUSS_ECOLI      MLNLADEVKVFDFFEALAEDRGVELRFV-GDKCQVAGDPLMLRRALSNLLSNALRYTPTGETIVVRCQTV
CUSS_ECOL6      MLNLADEVKVFDFFEALAEDRGVELRFVGDE-CQVAGDPLMLRRALSNLLSNALRYTPTGETIVVRCQTV
SASA_MICAN      LQSLCQEIL-SQFTDTFQEKTLIFQSDIPQDLPPVYADEELIRQVIINLLENGIKYTPAGGEITLSVLHR
SASA_CYAA5      LPRLSKEIVEQYNDLLTEKSLKLIQDV-PQDVPGVYADEELIRQVIVNLIDNAIKYTSEGGEITLSILHR
PCOS_ECOLX      LNELRE--LFEPLADETGKTITV------EGEGVVAGDSDMLRRAFSNLLSNAIKYSPDNTCTAIHLER-
MTRB_MYCLE      LRVMVNNALGNVGHLAEEAGIELLVDM-PVDEVIAEVDARRVERILRNLIANAIDHSEH--------KPV
ARCB_SHIFL      FTSFLADLENLSALQAQQKGLRF--NLEPTLPLQVITDGTRLRQILWNLISNAVKFTQ-QGQVTVRVRYD
ARCB_ECOLI      FTSFLADLENLSALQAQQKGLRF--NLEPTLPLQVITDGTRLRQILWNLISNAVKFTQ-QGQVTVRVRYD
ARCB_ECO57      FTSFLADLENLSALQAQQKGLRF--NLEPTLPLQVITDGTRLRQILWNLISNAVKFTQ-QGQVTVRVRYD
BVGS_BORBR      LRALPEAIRVFDGLARQKGIELVLKTDIVGVD-DVLIDPLRMKQVLSNLVGNAIKFTTEGQVVLVTARPG
SASA_CYAP8      LPVLCQDILDEYREIFKEKSLTLVKDI-PQDIPTVYADEELIRQVIVNLLDNAIKYTPSGGKVTVSILHR
ETR1_SOLLC      LHALFREVLIKPIASVKK--LFVTLSLSSDLPEYVIGDEKRLMQILLNVVGNAVKFSKEGNVSISDPRAP
ETR2_PELHO      LHALLREVLIKPIASVKK--LCISLNVATDLPEYAVGDEKRLVQIILNVVGNAVKFSKEGNISITDFFPI
BVGS_BORPE      LRVLPEAIRVFDGLARQKGIELVLKTDIVGVD-DVLIDPLRMKQVLSNLVGNAIKFTTEGQVVLAVTARP
BVGS_BORPA      LRALPEAIRLFDGLARQKGIELVLKTDIVGVD-DVLIDPLRMKQVLSNLVGNAIKFTTEGQVVLVTARPG
SASA_SYNY3      IADLCQEVLELYQAKFSKKNLTI--TYDIPKDLNVFADEELIRQVIANLLDNAIKYTPAHGSITVGALHR
CHVG_RHIME      LVEISRQI--RGSKKPVLLDFVVDRKDNPRASFIVSGYELRIGQIITNLIENARSFPEQNGRIVVRLTRS
PHOR_HAEIN      MSAMINS-LRKDTDILNTYNHHXXXXXXXXXXXF--GNESQLRSAVSNLIYNAIKHSGKQCHIQIQWETC
ETR1_CUCSA      LHAVFKEVLIKPVTLVKKLSLTL--HLGLDLPVFAVGDEKRLMQAILNVVGNAVKFSKEGSISISDFHPV
KINE_BACSU      VTQIMRDTIDLLNAQANLSNLDLIDDIPP---IYCEPNQLK--QVFINILKNAIEVMPDGGNIFVTIKAL
SASA_SYNJB      LPGLCQAVIEELWPRIQGKRLQFQADI-PVDLPSVHVDPDKIRQVLFNLLDNAIKYTPAGGSIRLDVLHR
ETR2_SOLLC      LHALFREVLIKPVAAVKK--LFVTLSLSSDFPEVAIGDEKRLMQILLNVVGNAVKFSKAKSESLIDPRPV
SPAK_BACSU      VDELTE-TLVKD-ISAYKGNKNINISFKKENLMKEAKIDWQLHRALLNILTNAVDYTPEGGTVSVHAE-C
DIVJ_CAUCR      AREAVQAAMRLLRVQSDTAGVQ-LRGVLPPGELEVDADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGY
CREC_ECOLI      VAALFRRVSEARTVQLAEKKITL--HVTPTE-VNVAAEPALLEQALGNLLDNAIDFTPESGCITLSAE-V
BASS_ECOLI      HVKLLEDVILPSSTMLDQRQQTLLLPESA-ADITVQGDATLLRMLLRNLVENAHRYSPQGSNIMIKLQ--
MAK2_SCHPO      VEENIADCIELVYPSLSSKPVQISYDIYPNVPALLAGDSAKLRQVITNLLGNSVKFTTEGH-ILLRCMAI
HSSS_STAS1      LNQLIKKIIRHEQFSANEKDLIIMSDL---ETISMNGNERLLHQAFQNLITNAIKYSTTGGMVDVTLSQ-
YCBM_BACSU      MNDICKRNILHYYDAVQSKGFQAAIDI-PDTPVYAQANEEALDRILQNLLSNAIQYGAAGKLIGLTLS-Y
SASA_SYNJA      LASLCQPVIEELLPRIQAKQLQFQADI-PVDLPTVHVDPDKIRQVIFNLLDNAIKYTPAGGSIRLNILHR
KDPD_CLOAB      XXXXXXXXXXQRSSKYFKNHK--IKVSVPEDVIMVSMDGSLIEQVIINLLDNASKFSPKGSTIEIKVYEK
ETR1_TOBAC      LHVLFRKVLIKPIASV-KNCLSRLTCLQICPEFAI-GDEKRLMQILLNVVGNAVKFSKEGSVSISAVAPV
CPXA_ECOLI      ANQLWSEVLDNAAFEAEQMGKSLTVNFPPGPPLY--GNPNALESALENIVRNALRYSHTKIEVGF---AV
CPXA_ECOL6      ANQLWSEVLDNAAFEAEQMGKSLTVNFPPGPPLY--GNPNALESALENIVRNALRYSHTKIEVGF---AV
CPXA_ECO57      ANQLWSEVLDNAAFEAEQMGKSLTVNFPPGPPLY--GNPNALESALENIVRNALRYSHTKIEVGF---AV
ETR1_PASED      LHAVFREVLIKPIASVKK--XXXXXXXAPDLPEYAVGDEKRLIQIILNIVGNAMKFSKEGSISITDFFPT
CUTS_STRLI      LAEVAGQAIDQVHAEAESKGVEV---RGTREAAVVQGNGVLLERIALNLVQNAVRYNVAGQGWVEVATAV
CUTS_STRCO      LAEVAGQAIDQVHAEAESKGVEV---RGTREAAVVQGNGVLLERIALNLVQNAVRYNVAGQGWVEVATAV
ZRAS_SALTY      LNDIITHSLNLVSQDAQSREIQL--RFTANETLKIQADPDRLTQVLLNLYLNAIHAIGRQGTISVEAKES
ZRAS_SALTI      LNDIITHSLNLVSQDAQSREIQL--RFTANETLKIQADPDRLTQVLLNLYLNAIHAIGRQGTITVEAKES
PLEC_CAUCR      LEDVAEDALVRNRAEAAGLKLDIDFPQLPE----IEADYRAVKQVLLNLLSNAIKFTPRAGSVTVRAEVR
YVRG_BACSU      LTSLIP--FFKNVIDFKKNPFSEISFVSKEEHIEFALDEAWFRRILENLLGNAVKHNGKGTEIQVILEQT
ARCB_HAEIN      FPALLNDIYNFASFLAKEKNLIFSXXXXXXXXXXXXXDRVRLSQILWNLISNAVKFTDQGNIILKIMR--
RCSC_ECOLI      PREVMNHITANYLPLVVRKQLGLYCFIEPDVPVALNGDPMRLQQVISNLLSNAIKFTD-TGCIVLHVR-A
ERS1_ARATH      LQAIFEEVLIKPIASVKKLSTNLI--LSADLPTYAIGDEKRLMQTILNIMGNAVKFTKEGYISIIEFFPV
ATOS_ECOLI      LNALVEETLVLVQTAGVQARVDFISELD-NELSPINADRELLKQVLLNILINAVQAISARGKIRIQTWQY
SASA_CYAP7      XXXXCLEILKQMGDQFQEKSLKIEKDI-PQDLPPVYADEELIRQVIVNLLDNAIKYTPEEGTITVSILHR
RCSC_SALTI      PREVMNHITANYLPLVVRKQLGLYCFIEPDVPVSLNGDPMRLQQVISNLLSNAIKFTDIGC-IVLHVR-C
DHKJ_DICDI      LRAHLYDALKTLSWRAHQKCIELVCDIASDVPDSLIGDPGRLRQIVNNLVGNAIKFSQGEVDLVVKVESC
TORS_ECO57      PRPLLESTLQLMSGRVKGRPIRLATAIADDVPTALMGDPRRIRQVITNLLSNALRFTD-EGQIVLRSR-T
RCSC_SALTY      PREVMNHITANYLPLVVRKQLGLYCFIEPDVPVSLNGDPMRLQQVISNLLSNAIKFTDIGC-IVLHVR-C
MPRB_MYCVP      ITEVIDRSLER--VRRRRNDIQFDVAVTPWQ---VYGDAAGLGRAVLNLLDNAAKWSPPGGRVGVGLTQI
KINB_PSEAE      LVDLLTQA-QQRFIPKGEARRVSLQLELGDELPRLQLDRLQIERVIDNLLENALRHSSEGGQIHLQARR-
KINA_BACSU      LKKLIGEVSALLETQANLNGIFIRTSYE-KDSIYINGDQNQLKQVFINLIKNAVE-SMPDGGTVDIIITE
ETR1_ARATH      LHTLFREVLIKPIAVVKK--LPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSISVTALVTK
BASS_SALTY      EVKLLEDVILPSYDELNTMLETRQQTLLLPEDVVVRGDATLLRMLLRNLVENAHRYSPEGTHITIHIS-A
PHY_MOUSC       MATVMNSVVSQGMIQSTQKNLQLYCDTPPDKSLSVFGDQVRLQQVLADFLLNAVQFTPPSGWVEIKVEPV
TORS_ECOLI      PRPLLESTLQLMSGRVKGRPIRLATAIADDMPCALMGDPRRIRQVITNLLSNALRFTDEG--YIILRSRT
PHYB_ANASP      LNEIVHRILDMLSGRIEETGVEIILQLLP----VVYCDRIQIGEVFSNLIANSIKYNDKANKWIIDNPPL
CIAH_STRR6      FFNTT----FTNYEMIASENNRVFR-FENRIHRTIVTDQLLLKQLMTILFDNAVKYTEEDGEIDFLISAT
CIAH_STRPN      FFNTT----FTNYEMIASENNRVFR-FENRIHRTIVTDQLLLKQLMTILFDNAVKYTEEDGEIDFLISAT
IRLS_BURPS      AAAQAERVAGYYEPMAEDADVRIVVRGKAE----VRADALLYHRALSNLISNALNHAPRGSTITIECAQA
ETR1_BRAOL      LHTLFREVLIKPIAVVKK--LPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSISVTALVTK
FIXL_BRAJA      LSKLIEEXXXXXXXXXREQNVQLRFSLDPGADL-VLADRVQIQQVLVNLFRNALEAQSQRRELVVTNTPA
SASA_NOSP7      --ELCDRYTAKSQE---------VETDIPSDLPYVYADPERIRQVLVNLLDNAIKYTPEGGKISVSGLHR
PHYA_ANASP      LTEV-EKALDKALGNLRQRIAETGANITHDPLPTVMAGSTQLMQLFQNLIANAIKFSEEAPQIHIGAERL
PHY1_SYNY3      VQEVVDKALANLKQRIEESGAEIEVGSMPA----VMADQIQLMQVFQNLIANGIKFAGDKSPKIKIWGDR
MPRB_MYCPA      --DVIDRSLER--VRRRRNDIHFDVDVTPWQ---MYGDAAGLSRAVLNLLDNAAKWSPPGGHVGVTMRQL
DHKG_DICDI      LVSFLEDSICAISPNAHLKGVYIALFINPLSKIPVIGDINILRQVIVNLLTNAIKFTE------------
YFHK_ECOLI      LAPLVETVVSAHSLPARAKMMHTDVDLKATACL---AEPMLLMSVLDNLYSNAVHYGAESGNICLR-SSL
RSSA_SERMA      IAEIGKCIAQHVPYALEKD---VELSLDGSEDVVVSTDRRALIAIFTNLLDNALKYAPPGSRIEANIRSL
GTCS_ANEMI      FGRTGSEIAIAYFDQFEQNKFSLDLKI-PTQRVMIRMNRNLLYRALSNLLSNTLKHNPKGTKVALSLTDT
DIVL_CAUCR      VSDLLLNAQERALKDAQLGGVTLAVECEEDVGL-IRGDGKRLAQTLDHLVENALRQTPPGGRVTLSARRA
MPRB_MYCA1      --DVIDRSLER--VRRRRNDIHFDVDVTPWQ---MYGDAAGLSRAVLNLLDNAAKWSPPGGHVGVTMRQL
DHKL_DICDI      FNATVSQVVESMAQRVQSKGLELLSYVDPKIPNILIGPSSRLNQILTNLLGNSLKFTDKGEISICCLLND
SASA_ANASP      QVGRTELIIIPQKTEIGLLCLEVVETDIPQDLPCVYADPERIRQVLINLLDNAIKYTPEGGTISIAGLHR
MPRB_MYCSS      EXXXXXXXXXXXXXNDIEFDVNVV-------GWQVYGDAAGLARAVLNLLDNAAKWSPPGGRVGVRLTQT
MPRB_MYCSK      EXXXXXXXXXXXXXNDIEFDVNVV-------GWQVYGDAAGLARAVLNLLDNAAKWSPPGGRVGVRLTQT
MPRB_MYCSJ      EXXXXXXXXXXXXXNDIEFDVNVV-------GWQVYGDAAGLARAVLNLLDNAAKWSPPGGRVGVRLTQT
FIXL_RHIME      IRKLVEESAALALVGSREQGVRTVFEYLPGAEM-VLVDRIQVQQVLINLMRNAIEAMRDRRELTIRTMPA
DHKH_DICDI      PTKIVEDSVDILSSQAEQKKLDIIFQLKYNCLSKVVGDFYRIRQVLTNLISNSVKFTPANGQIIV-----
DHKF_DICDI      FIGCLEGIGKTIGVSITNKPIEIAFLMDTDIPHRLIGDPNRLIQIMLNMGTNAVKYTDRGHIVFISVISR
SASA_ANAVT      QVGRTELIIIPQKTEIGLLCLEVVETDIPQDLPCVYADPERIRQVLINLLDNAIKYTPEGGTISIAGLHR
MPRB_MYCLE      XXXXXXXXXXXXXXNDIHFDVQAI-------GWQIYGDAAGLSRAVLNLMDNAAKWSPSGGRVVVTMRQF
FIXL_AZOC5      LSKLIEEASALALVGAKEHGIQVRYQIDTSCDL-VLADKVQVQQVLLNLMRNALEMDASRRQLLVQTTPA
KIND_BACSU      LQDIIGEIMPIIYSEGNLYNVEVELQYLTEQPLLVKCTKDHIKQVILNVAKNGLESMPEGGKLTISLGAL
YXDK_BACSU      LSELLQSVIQSYKRFFIQYRVYPKMNVCDDHQIYTDAKWLKF--AIGQVVTNAVKYSAGKSDRLELNVFC
YEDV_ECOLI      LNKEVENLL--DYLEYLSDEKEICFKVECNQQIFA--DKILLQRMLSNLIVNAIRYSPEKSRIHITSFLD
SASA_THEEB      LRQLCQETVVRLNFERKKQHFTTD---IPLDLPLVYGDGDRIRQVLVNLLDNACKYTPEGGKIHLSAFHR
PHY1_SELMA      MGTVMDAVISQGMITSKEKNLQLIRE-TPKEAMFLYGDQVRLQQVLADFLLNAIRFT-PSSENWVGIKVA
NTRB_SHIFL      IHKVAERVVTLVSMEL-PDNVRLIRDYDPSLPELAHDPD-QIEQVLLNIVRNALQALGPEGEIILRTRTA
NTRB_ECOLI      IHKVAERVVTLVSMEL-PDNVRLIRDYDPSLPELAHDPD-QIEQVLLNIVRNALQALGPEGEIILRTRTA
NTRB_ECO57      IHKVAERVVTLVSMEL-PDNVRLIRDYDPSLPELAHDPD-QIEQVLLNIVRNALQALGPEGEIILRTRTA
DHKE_DICDI      LITMLEESINIVYRTAQERGIEVLTFIDPDVPIILIGDPYRVKQCVLNFLSNAIKFTH-KGQVMVKVSIV
AFSQ2_STRCO     ITACIDARAWLDAVDLDAER-----------GVHARLDPRRLDVILANLIGNALKHG--GSPVRVSVARA
SASA_SYNE7      FEPLLQQVLEQLHERWRSKQQQLITDV-PGDLPTLYADPDRLRQVLVNLLDNAIKYTPPGGTITIAALHR
YVCQ_BACSU      LAEMVRSLINQEKRQFIKRRLFPTLHVPPNA-VQISSDQKWLSFVVEQILFNALKYSKQGVGDPITIRET
NTRB_SALTY      IHKVAERVVALVSMEL-PDNVRLIRDYDPSLP-ELPHDPEQIEQVLLNIVRNALQALGPEGEITLRTRTA
NTRB_SALTI      IHKVAERVVALVSMEL-PDNVRLIRDYDPSLP-ELPHDPEQIEQVLLNIVRNALQALGPEGEITLRTRTA
KINB_BACSU      LSALIKETSSLMVSYANYKSVTVEAETEP--DLLIYGDATKLKQAVINLMKNSIE-AVPHGKGMIHISAK
MPRB_MYCBP      XXXXXXXXXXXXXXXXIHFDVEVI-------GWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQL
MPRB_MYCBO      XXXXXXXXXXXXXXXXIHFDVEVI-------GWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQL
SASA_PROMP      AILELEKFWRLRKIEIDTD--------IPSDLPSVYADQRRMRQVFLNLIENALKFSENSGRIKITLIHK
SASA_PROM2      VILELEKFWRLRNIEIDTD--------IPSDLPSVFADQRRMRQVLLNLIENAIKFSEDSGSIKITMIHK
PILS_PSEAE      LQRFVDEYPGR------LRNDSQLHLQLGAGDIQTRMDPHQLNQVLSNLVQNGLRYSHGRGQVWLSLRDP
MPRB_MYCTU      XXXXXXXXXXXXXXXXILFDVEVI-------GWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQL
MPRB_MYCTA      XXXXXXXXXXXXXXXXILFDVEVI-------GWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQL
MPRB_MYCS2      VIDRSLERVRRRRNDI-EFDVDVI-------GWQVFGDAQGLGRAVLNLLDNAAKWSPPGGRVGVRLHQV
VIRA_AGRT9      VSELVTEILLRMAL---PPNIELSFRFDQMQSV-IEGSPLELQQVLINICKNASQAMTANGQIDIIISPV
VIRAW_RHIRD     VSELVTEILLRMAL---PPNIELSFRFDQMQSV-IEGSPLELQQVLINICKNASQAMTANGQIDIIISPV
PHOR_PSEAE      XXEATDDALLA-SIRNDAQALSAGRNHRISLDVQLKGSEAELRSAFSNLVFNAVKYTPDEGEIRIRWW-A
MAK3_SCHPO      LESVVCDCMQSVYSACAEKGINLSYNVSPDIPFFTAGDGMKIGQMLKSILDNSVK---------------
HSSS_STAES      LNTLIKDIIRHEQFRTDEKDLVL---FTELEDLYFRGNERLLHQAFNNLIINAMKYAPQNSMINITLTST
MAK1_SCHPO      VRAMMED--ANETLGTLAFSKGIELNYTVDIDVIVFGDNMRMRQVALNVIGNAIKFTEVFTRCSVEKIDY
PHY2_CERPU      MGTVMDAVISQGMTTSREKGLQIIRE-TPRETMRLFGDQIRLQQVLSDFLINAIRFT-PSSEGWVKIKVV
NTRB_KLEOX      IHKVAERVVKLVSMEL-PDNVKLVRDYDPSLP-ELPHDPDQIEQVLLNIVRNALQALGPGGEITLRTRTA
MPRB_MYCUA      EXXXXXXXXXXXXXNDIHFDVDVV-------GWQVYGDAAGLSRAALNLMDNAAKWSPPGGRVGIRLRQL
ZRAS_ECOLI      LNTLINHSLQLVSQDANSREIQL--RFTANDTLEIQADPDRLTQVLLNLYLNAIQAIGQHG--VISVTAS
Y3689_SHEFN     LVSLNDVVQVAQRLTANQTKSHQISTMLCDPSPCITGDAQQLHQVLINLIQNACNACSTQPGIIVIDTHV
NISK_LACLA      ATISLEDFLIDLSVELEELSTTYQVDYQKKTDLTTYGNTLALSRALINIFVNACQYAKEGEKIVSLSIYD
PMRB_PECCC      MQDELAEMLQKRQQRL--------KWVLPQEDVTLHGDATXXXXXXXXXVENAYRYSPETSQITVSLN--
NTRYL_RICPR     KSELV--YLVKHIIEARKLNDNIVYTYDSNVDQFFMCDATQINQVMINVLKNAEESIEGQEFGKIDILDA
NTRYL_RICBR     -TNCDLIYVINNIVEARKLNNNILYSFETNIDQFFTCDTTQINQVMINLLKNAEESLEGSNQAAIKVNNT
HSSS_STAEQ      LNTLIKDIIRHEQFRTDEKDLVM---FTELEDLYFRGNERLLHQAFNNLIINAMNYAPQNSMINITLTST
HSSS_STAAW      VDQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAAS      VDQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
ZRAS_ECO57      LNTLINHSLQLVSQDANCREIQL--RFTANDTLEIQADPDRLTQVLLNLYLNAIQAIGQHG--VISVTAS
SASA_PROMS      VILELEKFWRIRNIEIDTD--------IPSDLPSVFADQRRMRQVFLNLIENAIKFSKDSGSIKITMIHK
SASA_PROM0      VILELEKFWRLRNIEIDTD--------IPSDLPSVFADQRRMRQVFLNLIENAIKFSRDSGSIKITMIHK
KDPD_ECOLI      KEWLTLEEVVGSALQMLEPGLSSPINLSLPEPLLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAH-V
HSSS_STAAT      VNQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAAE      VNQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAAC      VNQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAA8      VNQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAA3      VNQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
NTRYL_RICTY     KSELV--YLVKHIIEARKLNDNIVYTCDSNVDQFFMCDATQINQVMINVLKNAEESIEGQEDVILDIK--
HSSS_STAAN      VDQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAAM      VDQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAA9      VDQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAA2      VDQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAA1      VDQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAAR      VDQLIKDIIRHEQFAADEKSLIILADL---ESIDFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
HSSS_STAAB      VDQLIKDIIRHEQFAADEKSLIILADL---ESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQH-
NTRYL_RICFE     KSELV--YLVKHIVEARKLNDNILYKFESNVDQFFMCDATQINQVMINLLKNAEESIEGRESGKIEVTDA
COPS_PSESM      LRTVISKLF--GYYEFLAEDKGIQLQASGNASIFA--DSVMIDRVVSNLLSNALRYTSSGETIKVSIHD-
BPHY_PSEAE      VSQLVRQIVCET--DVAYPGLVIEIAIDPQVRAVVDPDRYA--QVAANLLSNARHHGLPGRPVLVTLTR-
SASA_PROMA      LANIAAEVILERGIGIN----TDIPADLPN----VFADQSRMKQVLLNLIENALKFSNDGDTVEITMLHR
NTRYL_RICCN     KSELV--YLVKHIVEARKNDHILYKFESNVEQFDFMCDATQINQVMINLLKNAEESIEGRESGKIEVTDV
ZRAS_KLEOX      SLQLVSQDAASRAISLTFTAQPALCR--------IQADPDRLKQVLLNLYLNAVHAIGREGVITVAVREC
PHY_PINSY       LGTVIDAVVSQGMIVLREKGLQLIREI-PGETMRLYGDEVKIQQILADFLLNVLRFTSPEGWVAIKVFPT
PHY_PICAB       LGTVLDAVVSQGMILSREKGLQLIRD-SPEETMCLYGDQLRLQQILSNFLINALRFSTSEGWVGNKVVPT
SASA_PROM9      AILELEKFWRLRDIEIDTD--------IPSDLPSVFADQRRMRQVFLNLIENAIKFSKDYGSIKITMIHK
QSEC_HAEIN      A--IVQSLISERYFVAEKRKITLVFE-KESEPKQKQGQSILVSLMLRNLLDNAIKYCPEDTXXXXXXXXX
SASA_SYNS9      VILELEKLWLGRNVEIRTD--------IPSDLPKVFADQRRMRQVLLNLLENALKYTGNGGHIALSMLHR
SASA_PROM3      AILELEKLWLDRNIEIHTD--------IPSDLPKVFADQRRMRQVLLNLLENALKFTEDGGQVSLSMLHR
PHY1_PHYPA      MGTVMNAVISQGMTTSREKGLQIFRE-TPRETMRLLGDQIRLQQVLSDFLLNTVRFTSPEGWVKIKVVPV
NODV_BRAJA      VSALVTRELVSHQVTLRSELASALPR--------VLGDRIQLQQVIINLVMNGIEVTDRPRELLIQSSTD
GRAS_STAHJ      LKRLVDEVQLTRHISQAK-GIGYDLDLETNLDVYT--DVKWCRMMIRQILSNSLKYSQ--GQDIIIRSYT
PHYB_SOYBN      LGNVINAVVSQVILLLRERNLQLIRDIPEEKTLAVYGDQLRIQQVLSDFLLNIVRYASPDGWVEIHVRPR
RSTB_ECOLI      LTHLADIQAVTPDKTVRIKTLV--------QGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSG-
VIRA_AGRT5      VSELVMEIAPLLRVALQRN--IELKFKFDDKKSVVEGSPLEVQQMLMNLCKNASQAFTADGQIDIIVSRI
SASA_SYNPX      VILELEKLWLGRNVEIRTD--------IPSDLPKVFADQRRMRQVLLNLLENALKYTGNGGHITLTMLHR
PHYD_ARATH      IGNVTNAVVSQVMLVVRERNLQLIRNIPTEKSMAVYGDQIRLQQVLAEFLLSIVRYAPMEGSVELHLCPT
SASA_SYNS3      LTSVAAEAILELEKLWLGRDVTIHTDI-PADLPKVFADQRRMRQVLLNLLENALKYTPNGGLISLTMLHR
SASA_PROMM      LGNIAAEAILEEKLWLDRN--IEIRTDIPSDLPKVFADQRRMRQVLLNLLENALKFTEDGGEVSLTMLHR
PHYB_TOBAC      LGSVIDAVVSQVMLLLRERSVQLIRDIPEEKTLTVHGDQVRIQQVLADFLLNMVRYASPDGWVEIQLQPV
PHYB_SOLTU      LGSVIDAVVSQVMLLLREKGVQLIRDIPEEKTLTVHGDQVRIQQVLADFLLNMVRYASPDGWVEIQLRPV
DCTB_RHILE      LKDVIEVMLLRSRFAGRMDTLDI---DLPPDELQVMGNRIRLEQVLINLLQNALEAVAPKGEGRVEIRST
TCSB_EMENI      ------------------------------KDMVLWGDQHRILQILINLVGNSLKFTPEQGTVAIRIKCV
PHYB_ORYSJ      LGSVMNAVVSQVMIQLRERDLQLIRDI-PDEEASAYGDQYRIQQVLCDFLLSMVRFAAENGWVEIQVRPT
PHYB_SORBI      FGDVMNAVVSQAMLLLRERDLQLIRDI-PDEDASAYGDQFRIQQVLADFLLSMVRSASENGWVEIQVRPT
PHYB_ORYSI      LGSVMNAVVSQVMIQLRERDLQLIRDI-PDEEASAYGDQYRIQQVLCDFLLSMVRFAAENGWVEIQVRPT
PHYB1_SOLLC     LGSVIDAVVSQVMLLLREKGVQLIRDIPEEKTLTVHGDQVRIQQVLADFLLNMVRYASPDGWVEIQLRP-
DCTB_RHIME      MKEVVEGALMLLRSRF-AGRMDAIRLDLPPDGLQALGNRIRLEQVLINLLQNALEAIGDSEDGAIQVRCE
PHYA_CUCPE      LHEVLMVSISQVMLKIKGKGIQIV-NETPEEAMSLYGDSLRLQQVLADFLLISVSYAPSGGQLTISTKSV
DHKI_DICDI      LRDTFNQLFKVFYTRIIEKKISLTFSIDPNDDFY--GDQNRLKQILSNLIDNAIKF--------------
PHYC_SORBI      LEEALNTVLMQG-IPLGKEKRISIERDWPVERMYLYGDNLRLQQVLADYLACALQFTQPEGPIVLQVIPK
QSEC_SALTY      LEELLQSAVMDIYHPAQQANIDVRLQLNAH-DVIRTGQPXXXXXXXXXXXDNAIRYSPQGSVVDVTLHAR
QSEC_SALTI      LEELLQSAVMDIYHPAQQANIDVRLQLNAH-DVIRTGQPXXXXXXXXXXXDNAIRYSPQGSVVDVTLHAR
CSEC_STRCO      LGDFVSRRVAA------KDPAVEVRVIHESE---VTTDPRRLERVLFNLLANAARHGRSPVEVSVEGRVI
ENVZ_SALTY      LNSVLGEVIAAESGYEREINTALQAG-----SIQVKMHPLSIKRXXXXXXXXXXRYG---NGWIKVSSGT
NTRB_PROVU      IHHVVERVAQLISLECPEN-VTLLKDYDPSLPELSHYPD-QIEQVLLNITRNALQAVEKTGTIILRTRTA
ENVZ_SALTI      LNSVLGEVIAAESGYEREINTALQAG-----SIQVKMHPLSIKRXXXXXXXXXXRYG---NCWIKVSSGT
PHYC_ARATH      LQESLEAV-VKQVMELSIERKVQISCDYPQESMRLYGDNLRLQQILSETLLSSIRFTPALRGLCVSFKVI
GLNK_BACSU      ---------------------------------------FIVLSIINNLTANAVEAMDEEGMVSLRLRKP
NTRB_VIBAL      VRQLVELE--------SQRSIVIERDYDPSLPEILMDAD-QIEQAMLNIVSNAILSHQEHGKITIRTRTV
PHYC_ORYSJ      LEEALNTVLMQAMPQSKEKQISIDRDWPAEVSMHLCGDNLRLQQVLADFLACMLQFTQPEGPIVLQVIPR
PHYC_ORYSI      LEEALNTVLMQAMPQSKEKQISIDRDWPAEVSMHLCGDNLRLQQVLADFLACMLQFTQPEGPIVLQVIPR
EVGS_ECOLI      IPTLVQNTCHSFGAIAASKSIALSCSSTFPEHYLVKIDPQAFKQVLSNLLSNALKFTEGAVKITTSLGHI
EVGS_ECO57      IPTLVQNTCHSFGAIAASKSIALSCSSTFPDHYLVKIDPQAFKQVLSNLLSNALKFT-TEGAVKITTSLV
PHYA_ARATH      LNEVTSQVMMKNGKSVRITNETGEEVMS--DTLY--GDSIRLQQVLADFMLMAVNFTPSGGQLTVSARSV
VIRAL_RHIRD     LSALVREIAPSLRVAL-PSEVEVDFNIQ-SAQMIVEGNPLEIEQILMNLCKNAAEACIGKHKVLANGTIP
SLN1_YEAST      -------------------------------------------------------------------RPI
NTRY_AZOBR      ----------------------------PQGPLTVPCDSRQISQALTNLLQNAADAIEPPGHVAIRVE-A
CYAD_DICDI      LFDFLEDVLERTSKDIKFNNIELVYKIDKDVPLNIILDPTALTQICFQLLSNAIKYTE------------
PHYA_SOLTU      LHEVLVASISQVMMKSNGKNIMISNDMVENETLY--GDSPRLQQVLANFLLVSVNSTPSGGKLSISGKSV
GRAS_STAAR      LKRMVDEIQLTRHISQVKG---IGFDIDFKVDNHVYTDIKWCRMIIRQILSNALKYSENYN---VDISEL
ENVZ_SHIFL      YEREIETALYPGSIEVKMHPLSIKRXXXXXXXXXXR------------YGNGWIKVSSGT----------
ENVZ_ECOLI      YEREIETALYPGSIEVKMHPLSIKRXXXXXXXXXXR------------YGNGWIKVSSGT----------
PHYB_ARATH      LGSVINAIVSQAMFLLRDRGLQLIRDIPEEKSIEVFGDQIRIQQLLAEFLLSIIRYAPSQEWVEIHLSQL
METK_PICTO      -------------------NLTVAAAYV---DKYVKDPDYSVKEELVNKITNALKYTNNDVQVFVNTGDI
TLPA_BACSU      ----------------------------------------------------------------------
NTRY_AZOC5      -SQDMSEIIRQTVFLMRVGHPEVVFDSEVPPAMPARFDRRLVSQALTNILKNAAEAIEAQGRIRVSANRV
BCES_BACHD      LESLHQEIKTLQSWCIQKG----IGFDLQLEVTDVLTDAKWLSFILRQLLSNAVKYSEASD--IIIKSDV
QSEC_ECO57      LEDLLQSSVIYHTAQQAKIDVRLTLNV---QGIKRTGQPXXXXXXXXXXXDNAVRYSPQGS--VVDVTLN
QSEC_ECOLI      LEDLLQSSVMDIYHTAQQAKIDVRLTLNAHS-IKRTGQPXXXXXXXXXXXDNAVRYSPQGS--VVDVTLN
PHYA_SOYBN      LHEVLVTSLSQVMEKSNGKSIRIVNDVAGHETLY--GDSLRLQQVLADFLLISINFTPNGGQVVVAGSLT
MCPB_BACSU      ----------------------------------------------------------------------
NTRB_RHOCA      --DVLDRARKSAGVGFGAHML-IVEDYDPSVPPTL-GDADQLTQVFLNLLKNASEAAKGQGTIRLRLRLR
TLPB_BACSU      ----------------------------------------------------------------------
DHKM_DICDI      VSNLLEDLISTPSIRTQFEEKEIDLFYLIDKDLSLVGDSQKIKQILLKLITNSIK---------------
PHYA1_TOBAC     LHEVLVASISQIMMKSNGKNIMIVNDMVENETLY--GDSPRLQQVLANFLLVCVNSTPSGGQLSIS-GTL
PHYA1_MAIZE     LQDVVVSAVSQVLIGCQAKGIRVACNL-PERSMKVYGDGIRLQQIVSDFLFVSVKFSPAGGSVDISSKLT


                         .         .         +         .         .         .         .:490
query           EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEFGVMNTENGVK
PHOR_BACSU      EKD-IQIEVADSGIGIQKEEIPRIFERFYRVDKDRSRNSGGTGLGLAIVKHLIEAHEGKIDVTSLGRGTV
VANS_ENTFA      AE-KYRLSVLNMGVHIDDTALSKLFIPFYRIDQARSRKSGRSGLGLAIVQKTLDAMSLQYALENTSDGVL
YYCG_BACSU      EEEELYISVKDEGIGIPKKDVEKVFDRFYRVDKARTRKXXXXXXXXAIAKEMVQAHGGDIWADSIEKGTT
GACS_PSESY      EHAQLRISVQDTGIGLSSQDVRALFQAFSQADNSLSRQPGGTGLGLVISKRLIEQMGGEIGVDSTPEGSE
WALK_STAAW      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAU      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAT      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAS      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAR      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAN      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAM      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAE      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAC      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAAB      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAA9      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAA8      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAA3      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAA2      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAA1      PYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAHJ      LYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAES      LYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAEQ      LYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
WALK_STAS1      LYNRMTIRVKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEQGTS
YCLK_BACSU      EGYKXXXXXXXXXXXXPKEDIEHIWERFYKADISRNTAYGEYGLGLSIVRQLVEMHQGTVEIKSEEKGTK
WALK_STASR      LYNRMTIQIKDNGIGIPVNKVDKIFDRFYRVDKARARKMGGTGLGLAITKEIVEAHKGRIWASSKEQGTS
RESE_BACSU      -KDGLKIDIKDSGSGIPEEDLPFIFERFYKADKXXXXXXXXXXXXXXIVKNIVEAHNGSITVSRIDKGTT
CSSS_BACSU      QDDRIVITIKNDGPHIEDEMLSSLYEPFNKGKKG------EFGIGLSIVKRILTLHKASISIENDKTGVT
SRRB_STAAW      ESEDILY-IKDTGTGIAPEHLQQVFDRFYKVDAARTRGKQGTGLGLFICKMIIEEHGGSIDV-KSELGKG
SRRB_STAAU      ESEDILY-IKDTGTGIAPEHLQQVFDRFYKVDAARTRGKQGTGLGLFICKMIIEEHGGSIDV-KSELGKG
SRRB_STAAS      ESEDILY-IKDTGTGIAPEHLQQVFDRFYKVDAARTRGKQGTGLGLFICKMIIEEHGGSIDV-KSELGKG
SRRB_STAAR      ESEDILY-IKDTGTGIAPEHLQQVFDRFYKVDAARTRGKQGTGLGLFICKMIIEEHGGSIDV-KSELGKG
SRRB_STAAC      ESEDILY-IKDTGTGIAPEHLQQVFDRFYKVDAARTRGKQGTGLGLFICKMIIEEHGGSIDV-KSELGKG
SRRB_STAA8      ESEDILY-IKDTGTGIAPEHLQQVFDRFYKVDAARTRGKQGTGLGLFICKMIIEEHGGSIDV-KSELGKG
SRRB_STAAN      ESEDILY-IKDTGTGIAPEHLQQVFDRFYKVDAARTRGKQGTGLGLFICKMIIEEHGGSIDV-KSELGKG
SRRB_STAAM      ESEDILY-IKDTGTGIAPEHLQQVFDRFYKVDAARTRGKQGTGLGLFICKMIIEEHGGSIDV-KSELGKG
PHOR_KLEPN      PQGAL-FSVEDNGPGIAPEHIPLLTERFYRGDKARSRQTGGSGLGLAIVKHAVNHHDSRLEIDSTGKGTR
BARA_SHIFL      SNTKVQIEVQDTGIGIPERDQSRLFQAFRQADASISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNGST
BARA_ECOLI      SNTKVQIEVQDTGIGIPERDQSRLFQAFRQADASISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNGST
BARA_ECOL6      SNTKVQIEVQDTGIGIPERDQSRLFQAFRQADASISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNGST
BARA_ECO57      SNTKVQIEVQDTGIGIPERDQSRLFQAFRQADASISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNGST
DHKB_DICDI      SDDSIKFDVEDSGIGIKTEHLNQLFASFSQIDSGNSRKYQGTGLGLSISKRLCKMMKSEFGV-----GST
YKOH_BACSU      ENGRPFLSVRDEGIGIPEEHIPHLFERFYRADEARNRKTGGTGLGLSIAKQIADEHGIELSV--------
DHKA_DICDI      EEEIIHLTIEDTGIGIPQSLFDSIFEPFSQADNSTTRKYGGTGLGLSITKRLIE----------------
SEX3_MYCLE      RGDNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHNGSIGVW-SKPGTG
LUXQ_VIBHA      ENSVLVVELTDTGIGIESDKLDQMFEPFVQEESTTTREYGGSGLGLTIVKNLVDMLEGDVQVRSSKGGTT
ARLS_STAHJ      RNKQISIEITDHGLGIPKEDQEFIFDRFYRVDKSRSRSQGGNGLGLFIAEKIVQQYG---GYITVDSEVN
PHOR_ECOLI      PHGA-EFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTGKGTR
RPRX_BACFR      NEPKLMISIQDNGIGIKKENLKKVFDKFYRVHTGNLHDVKGFGLGLAYVKKIIQDHKGTIRAESELNGTK
BAES_ECOLI      QRDKVRLTFADSAPGVSDDQLQKLFERFYRTEGSRNRASGGSGLGLAICLNIVEAH--------------
DSPA_SYNY3      HRSNVRVEISDTGIGIDPEDQAAIFERFYRVE-NRVHTLEGTGLGLSIVKNIIAKHQSQIHLVSEVGGTT
DHKD_DICDI      SPNKPGFQISDTGPGIPDNLHEIIFERFRQVDGSSTRKHGGTGLGLSIVKEFVTLHGGTVTIHNSTGGAQ
PDHS_OCHA4      MNGDVVMRVRDTGIGMTKSEVEQALKPFRKAETAKDWRSEGTGLGLPLTKAMVEANRAQFAIDST-----
DOKA_DICDI      DQISLRFTVKDSGIGIPENKIEQIFVPFGQIDGSFSRKYGGSGLGLSFCKELVALMRVESGDQEGGKGTT
SAES_STAAE      EQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
SAES_STAAC      EQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
SAES_STAA8      EQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
SAES_STAA3      EQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
RPFC_XANCP      AEDRLRFDVEDTGIGVPMDMRPRLFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGSIGFKNQPSGSV
RPFC_XANC8      AEDRLRFDVEDTGIGVPMDMRPRLFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGSIGFKNQPSGSV
DHKK_DICDI      GEYNISFRVKDTGIGVPVESHQKIFEAFVQADPSDSRKYGGSGLGLYLCAKLVRLMKGEIGVYNNPDGST
SAES_STAAW      DQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
SAES_STAAS      DQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
SAES_STAAR      DQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
SAES_STAAN      DQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
SAES_STAAM      DQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
SAES_STAAB      DQDTIDIAISDEGIGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSDIDVGTT
PHOR_SHIDY      PHGA-EFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTGKGTR
ARLS_STAEQ      KNKMIMIDITDHGMGIPKADLEFIFDRFYRVDKSRARSQGGNGLGLSIAEKIVQLNG---GMIQVESELQ
SAES_STAES      KEDVISISIKDEGIGIVPELQSRIFERTFRVEDSRNTKTGGSGLGLYIANELAQQIDASITVQDLDIGTT
SAES_STAEQ      KEDVISISIKDEGIGIVPELQSRIFERTFRVEDSRNTKTGGSGLGLYIANELAQQIDASITVQDLDIGTT
ARLS_STAES      KNKMIMIDITDHGMGIPKADLEFIFDRFYRVDKSRARSQGGNGLGLSIAEKIVQLNG---GMIQVESELQ
SENX3_MYCTU     RGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHDGTIRVW-SKPGTG
SENX3_MYCBO     RGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHDGTIRVW-SKPGTG
ARLS_STAS1      RNKQISIEITDHGVGIPKEDIEFIFDRFYRVDKSRSRKLGGNGLGLSIAKKIIELNN---GTIHVDSEVD
CHVG_AGRT5      HKDRCIVQVEDNGPGIQAEDIDRIFERFYTDRPASEGFGQNSGLGLSISRQIAEAHG---GSLRAENVVD
ARLS_STAAW      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
ARLS_STAAS      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
ARLS_STAAR      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
ARLS_STAAN      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
ARLS_STAAM      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
ARLS_STAAC      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
ARLS_STAAB      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
ARLS_STAA8      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
ARLS_STAA3      XXQKI-IEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLGLSIAQKIIQLNGGSIKIKSEIN---
LUXQ_VIBVY      EHSILSIQVSDTGIGIDESKLESIFEPFVQADSLSTREYGGSGLGLTIVKNLVEMLEGEISVQSELKGST
LUXQ_VIBVU      EHSILSIQVSDTGIGIDESKLESIFEPFVQADSLSTREYGGSGLGLTIVKNLVEMLEGEISVQSELKGST
PDHS_BRUSU      LNGDVVMRVRDTGIGMSKSEVEQALKPFRKAESAKDWRNEGTGLGLPLTKAMVEANRAQFAI--------
PDHS_BRUSI      LNGDVVMRVRDTGIGMSKSEVEQALKPFRKAESAKDWRNEGTGLGLPLTKAMVEANRAQFAI--------
PDHS_BRUO2      LNGDVVMRVRDTGIGMSKSEVEQALKPFRKAESAKDWRNEGTGLGLPLTKAMVEANRAQFAI--------
PDHS_BRUME      LNGDVVMRVRDTGIGMSKSEVEQALKPFRKAESAKDWRNEGTGLGLPLTKAMVEANRAQFAI--------
PDHS_BRUAB      LNGDVVMRVRDTGIGMSKSEVEQALKPFRKAESAKDWRNEGTGLGLPLTKAMVEANRAQFAI--------
PDHS_BRUA2      LNGDVVMRVRDTGIGMSKSEVEQALKPFRKAESAKDWRNEGTGLGLPLTKAMVEANRAQFAI--------
PDHS_BRUA1      LNGDVVMRVRDTGIGMSKSEVEQALKPFRKAESAKDWRNEGTGLGLPLTKAMVEANRAQFAI--------
PDHS_BRUC2      LNGDVVMRVRDTGIGMSKSEVEQALKPFRKAESAKDWRNEGTGLGLPLTKAMVEANRAQFAI--------
SENX3_MYCS2     RGGNIEIAVTDRGIGIAKDDQERVFERFFRVDKARSRATGGTGLGLAIVKHVAANHNGSIRLW-SQPGTG
MTRB_MYCPA      DEDTVAVTVRDYGVGLRPGEEKLVFSRFWRADPSRVRRSGGTGLGLAISIEDARLHQGRLEAWG-EPGVG
VANS_ENTFC      SGDVVSIEFKNTGS-IPKDKLAAIFEKFYRLDNARSSDTGGAGLGLAIAKEIIVQHGGQIYAESNDNYTT
LUXQ_VIBCH      EGDQLVIQVVDTGIGIREQDLTVIFEPFMQAESTTTREYGGSGLGLTIVHSLVEMLSGQLHV-SSEYGIG
ETR1_MALDO      QSDNHFYQVKDSGSGINPQDIPKLFTKFAQTQALATRNSGGSGLGLAICKNLMEGH--------------
DLTS_STRA3      RR-KAILTISNPSAIYSKEVMDNLFERFYQAKDD-HADSLSFGLGLSIAKAIVERHK-------------
Y1002_RHIME     EGNMLKLTVSDTGIGIAADKLQMLGQPFVQIQNDYTRRYEGTGLGLSLVKGLAELHGGDVSIRSAE----
HSSS_STAHJ      NEGTIYFTVTNEGHTIPESVQPHLFDRFYK----RNAEDNSNGLGLAITQSIIHLHRGQISVSNDRDGTT
DHKC_DICDI      QVNELHFQVKDSGIGIKEENMSKLFAGFSQGTTQEALGS---GLGLAISKDLVELMSSNATQNNGEAGCT
LUXQ_VIBPA      DNSVLVVEISDTGIGIESDKLDEMFEPFVQEEATTTREYGGSGLGLTIVKNLVDMLDGDVQVRSQKQGTT
DLTS_STRA5      RR-KAILTISNPSAIYSKEVMDNLFERFYQAKDD-HADSLSFGLGLSIAKAIVERHK-------------
CUSS_ECO57      DH-LVQVIVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSNARGTR
YCF26_PORYE     QIQKVRVEICDTGIGISKKNQERIFARFLRIENYVHT-LEGTGLGLSIVKNIIQKHNSEIHLYSLKNGSC
TCSA_EMENI      XXXXXXXXXXXXGIGVPDSAINTLFTPFSRFANSAARKYQGTGLGLSICKSLAELMDGSVGYSPNPNGSV
ETR1_PELHO      SSDNQFYQVKDSGSGINPQDMPKLFTKFAQSQPVATKNSGGSGLGLAISKNLMDGH--------------
SILS_SALTY      QESFFDLVIENPGKPIPEEHLSRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVEAHHGRVQVESDVHSTR
CZCS_RALME      EAAHCCIDITNVGDPIPERELSLIFDRFFRGDRARSNSSQSTGLGLAIVLSIMELHGGDASAVSGLDG-K
YCF26_PORPU     NSQKVRVEICDNGIGISRKNQERIFARFLRIENYVHT-LEGTGLGLSIVKNIIQKHNSEIHLYSLKNGSC
ETR1_PRUPE      QSDNHFYQVKDSGSGINPQDIPKLFTKFAQTQSLATRNSGGSGLGLAICKNLMEGH--------------
ETR1_CUCMR      PSDSHFYQVKDTGSGISPQDIPKLFTKFAQ-TTVGPRNSGGSGLGLAICKNLMEGH--------------
SPHS_SYNE7      RGDTWICDLYDDGPGFADADLPYLFERFYRGDPSRVRXXXXXXXXXXIARQVVEAHQGRISARN------
MTRB_MYCTU      DEDTVAVTVRDYGVGLRPGEEKLVFSRFWRSDPSRVRRSGGTGLGLAISVEDARLHQ-------------
MTRB_MYCBO      DEDTVAVTVRDYGVGLRPGEEKLVFSRFWRSDPSRVRRSGGTGLGLAISVEDARLHQ-------------
KINC_BACSU      ASHAV-ISVKDEGNGMPQEKLKQIGKPFY---STKEKG---TGLGLPICLRILKEHDGELKI--------
CUSS_ECOLI      DH-LVQVIVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDARGTR
CUSS_ECOL6      DH-LVQVTVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDVRGTR
SASA_MICAN      TTQKVQVSISDTGPGIPEEKQEHIFEGHVR--LKRDEGKEGYGIGLSVCRKIIRAHYGQIWVDSVDHGSS
SASA_CYAA5      TSQKVQVSVCDTGPGIPEEKQERIFEGHFR--LQRDQGKEGYGLGLSLCRKIIRVHYGQIWVDSVPQGSC
PCOS_ECOLX      DSDCVNVMITNTMSGQVPANLERLFDRFYRADSSRFYNTEGAGLGLSITRSIIHAHGGE-----------
MTRB_MYCLE      DEDTVAVTVRDYGIGLRPGEEKLVFSRFWRSDPSRVRRSGGTGLGLAI----------------------
ARCB_SHIFL      EGDMLHFEVEDSGIGIPQDELDKIFAMYYQKDSHGGKPATGTGIGLAVSRRLAKNMGGDITV-TSEQGKG
ARCB_ECOLI      EGDMLHFEVEDSGIGIPQDELDKIFAMYYQKDSHGGKPATGTGIGLAVSRRLAKNMGGDITV-TSEQGKG
ARCB_ECO57      EGDMLHFEVEDSGIGIPQDELDKIFAMYYQKDSHGGKPATGTGIGLAVSRRLAKNMGGDITV-TSEQGKG
BVGS_BORBR      EAAHVQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGAPGTGLGLSISRRLVE----------------
SASA_CYAP8      TTQKVQVSICDTGPGIPEEKQERIFEGHFR--LKRDQEKEGYGLGLSLCRKIIRTHYGQIWVDSVDQGSC
ETR1_SOLLC      EENHFYLQIKDTGIGITPQDIPNLFSKFTQSQALATTNSGGTGLGLAICKNLMEGH--------------
ETR2_PELHO      GENQFYLQVKDSGLGINPQDIPRLFTKFAQTQPVATKNSGGSGLGLAICKNLMEGH--------------
BVGS_BORPE      DGDHVQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGAPGTGLGLSISRRLVE----------------
BVGS_BORPA      EAAHVQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGAPGTGLGLSISRRLVE----------------
SASA_SYNY3      TTQKVQVSITDNGPGIPNSKQETIFEGHFR--LQRDEQTDGYGLGLSLCRKIIQAHYGQIWVSRPKQGSS
CHVG_RHIME      RLRCIVY-VEDNGPGIQAEDIDRIFERFYTDRPEGEDFGQNSGLGLSISRQIAEAHG---GTLRAEN---
PHOR_HAEIN      EQG-IKFNVIDNGVGISPQHIPHLTERFYRVDESRSHLTGGSGLGLAIVKHTLLQYHSHLNIESTEKGSS
ETR1_CUCSA      PSDSHFYQVKDTGSGISPQDIPKLFTKFAQ-TTVGPRNSCGSGLGLAICKNLMEGHESELGIAEQSNESK
KINE_BACSU      DQDHVLISLKDEGIGMTEDKLKRLGEPFY---TTKERG---TGLGLMVSYKIIEEHQGEIMVESEEKGTV
SASA_SYNJB      TSQKVQVTVSDTGPGIPEADQESIFSDSVR--LSRDQQQEGYGIGLSLCRRIVRAHYGQIWVESSGKGSS
ETR2_SOLLC      QSENHFYQVKDTGSGINPQDFPKLFCKFAQNQEPATKNSAGTGLGLAICKNLMEGH--------------
SPAK_BACSU      DSEIFYFFVKDTGNGFSEMGLKKATELFYMDDKSRHSKGHY-GMGLTFAKNAVNLHNGELTLGNTIAG--
DIVJ_CAUCR      -DGVLEIVVADTGVGISPEDLERLGRPYEQAGGAEQR-ARGTGLGLSLVRAFAQLHGGE-----------
CREC_ECOLI      DQEHVTLKVLDTGSGIPDYALSRIFERFY--SLPRANGQKSSGLGLAFVSEVARLFNGEVTLRNVQEG--
BASS_ECOLI      EDDGAVMAVEDEGPGIDESKCGELSKAFVRMD-SRYGG---IGLGLSIVSRITQLHHGQFFLQNRQSGTR
MAK2_SCHPO      DEEKLRFEIEDTGIGLKEEQLKLLFNPFTQVDGSTTRIYGGSGLGLSICLQICKIMDGDIGVQSVGEGST
HSSS_STAS1      NLETITCTITDDGQGMSAETQARIFERFYKSSNHDN----SNGLGLAIAKAIFELHHGTITVDSEKNGTT
YCBM_BACSU      DERNIAITVWDRGKGISETDQQRVFERLYTLEESRNKAFQGSGLGLTITKRLTE----------------
SASA_SYNJA      TSQKVQVTVSDTGPGIPEAEQENIFSDAVR--LSRDQQQEGYGIGLSLCRRIVRAHYGQIWVESLGKGSS
KDPD_CLOAB      KKD-VVFEIIDEGQGISEDILPNIFDRFFTNGSKISDSRRGVGLGLAICKSIVEAHGGKIEAVNKSGGAI
ETR1_TOBAC      QSENHFYQVKDTGSGINPQDIPKLFCKFAQNQALATKSSGGTGLGLAISKNLMEGH--------------
CPXA_ECOLI      DKDGITITVDDDGPGVSPEDREQIFRPFYRTDEARDRESGGTGLGLAIVETAIQQH--------------
CPXA_ECOL6      DKDGITITVDDDGPGVSPEDREQIFRPFYRTDEARDRESGGTGLGLAIVETAIQQH--------------
CPXA_ECO57      DKDGITITVDDDGPGVSPEDREQIFRPFYRTDEARDRESGGTGLGLAIVETAIQQH--------------
ETR1_PASED      PSENHFYQVKDSGVGINPQDIPKLFIKFAQTQTTGARNSSGSGLGLAICRNLMDGH--------------
CUTS_STRLI      ENGQAVLVVTNTGPVVPAYEVDNLFEPFRRLRTERTGSDKGVGLGLSIARSVARAHGGHISAQPREGG--
CUTS_STRCO      ENGQAVLVVTNTGPVVPAYEVDNLFEPFRRLRTERTGSDKGVGLGLSIARSVARAHGGHISAQPREGG--
ZRAS_SALTY      GTDRVIITVTDSGKGIAPDQLEAIFTPYF---TTKADG---TGLGLAVVQNIIEQHGGAIKVKSIE----
ZRAS_SALTI      GTDRVIITVTDSGKGIAPDQLEAIFTPYF---TTKADG---TGLGLAVVQNIIEQHGGAIKVKSIE----
PLEC_CAUCR      RDDLIKVSVTDTGIGIAKEDLARLAKPFEQVESQFSKXXXXXXXXXXXXKSLITMHDGVLEMHSTPEGTT
YVRG_BACSU      -KNHISLKVKDNGKGMDEETITHLFNRYYRG-TNTKDSTAGTGLGLAIAKELVHLHNGTIHVNSRTN---
ARCB_HAEIN      NQDCYHFIVKDTGMGISPEEQKHIFEMYYQVKESRQQ-SAGSGIGLAISKNLAQ----------------
RCSC_ECOLI      DGDYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTGVQRNFQGTGLGLAICEKLISMMDGDISV-DSEPGMG
ERS1_ARATH      LSDSHFYQVKDTGCGIHTQDIPLLFTKFVQPRTGTQRNHSGGGLGLALCKRFV-----------------
ATOS_ECOLI      SDSQQAISIEDNGCGIDLSLQKKIFDPFFTTKAS------GTGLGLALSQRIINAHQGDIRV--------
SASA_CYAP7      TTQKVQVSICDTGPGIPEEKQDRIFEGHFR--LKRDEGKEGYGLGLSLCRKIIRAHYGQIWVDSTINGSC
RCSC_SALTI      DGDYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTGVQRNFQGTGLGLAICEKLISMMDGDISV-DSEPGMG
DHKJ_DICDI      GEVVLKFSVIDTGIGIPKDKLHLIFEAFSQADGSITR---------------------------------
TORS_ECO57      DGEQWLVEVEDSGCGIDPAKLAEIFQPFIQ--VSGKRG--GTGLGLTISSRLAQAMGGELSATST-----
RCSC_SALTY      DGDYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTGVQRNFQGTGLGLAICEKLISMMDGDISV-DSEPGMG
MPRB_MYCVP      DALHAELVVSDRGPGIPPQERALVFERFFRSTSARS--MPGSGLGLAIVKQVVLKHGGTLRIEDTVPG--
KINB_PSEAE      QGDRVLIAVEDNGEGIPFSQQGRIFEPFVQ--VGRKKG--GAGLGLELCKEIIQLHGGRIAVRSQPQGAR
KINA_BACSU      DEHSVHVTVKDEGEGIPEKVLNRIGEPFL---TTKEKG---TGLGLMVTFNIIENHQGVIHVSHPEKGTA
ETR1_ARATH      SDTRLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRXXXXXXXXXAISKRFVNLMEGNIWI--------
BASS_SALTY      DPDAI-MAVEDEGPGIDESKCGKLSEAFVRMD-SRYGG---IGLGLSIVSRITQLHQGQFFLQNERTGTR
PHY_MOUSC       VKKNVDFRVSHPGEGLPEDLIDQMF------DRADARVKSQEGLGLSICRKLVRLMNGE--VQYRREGER
TORS_ECOLI      DGEQWLVEVEDSGCGIDPAKLAEIFQPFVQ--VSGKRG--GTGLGLTISSRLAQAMGGELSATST-----
PHYB_ANASP      PPT---FYVRDNGIGIREKHFETIFRIFKRLHSPSKYGG-GTGAGLTIAKKIVERHGGKIWVESTGEGST
CIAH_STRR6      DRN-LYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGGFGLGLSLAKQIVDA---------------
CIAH_STRPN      DRN-LYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGGFGLGLSLAKQIVDA---------------
IRLS_BURPS      A-DAATISVSDTGRGIEAPHRERIFERFYRVDPARHNSASGTGLGLAIVRSIMENHGGTCGV-DSEPHVR
ETR1_BRAOL      SDNRLRVKVKDLGAGINPQDIPKLFTKFAQTQSLATRXXXXXXXXXAISKRFVNLMEGNIWI--------
FIXL_BRAJA      ADDMIEVEVSDTGSGFQDDVIPNLFQTFF---TTKDTG---MGVGLSISRSIIEAHGGRWAESNASGGAT
SASA_NOSP7      TTQKVQFSIGDTGPGIPVENRDRIFENHFR--LQRDEGKEGYGIGLCLCQRIIVAHYGQIWVDSANNGAW
PHYA_ANASP      EDEWL-FSVRDNGIGIDPQFSDRIFVIFQRLHTRDEY--HGTGMGLAICKKIIECHRGRIWVSQLGEGAT
PHY1_SYNY3      QEDAWVFAVQDNGIGIDPQFFERIFVIFQRLHTRDEY--KGTGMGLAICKKIIEGHQGQIWLSNPGEGST
MPRB_MYCPA      DPSHVELVVSDHGPGIPPQERRLVFERFYRSTSA--RAMPGSGLGLAIVKKVVLNHGGMLRVEDTVPG--
DHKG_DICDI      ----------------------------------------------------------------------
YFHK_ECOLI      HGARVYIDVINTGTPIPQEERAMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGELYLVD-ESGVC
RSSA_SERMA      APLGCYITLRDNGPGVSEEHRSRLFERFYRVPGTQQTGS---GLGLAIARNLADKIGAQLRVTEDDRGIG
GTCS_ANEMI      HE-AILLEVMDNGIGIAEELKESIFQPFVRGDKART--GEGTGLGLPSPKKRL-----------------
DIVL_CAUCR      -LGEVRLDVSDTGRGVPFHVQAHIFDRF----VGRDRG--GPGLGLALVKALVELH--------------
MPRB_MYCA1      DPSHAELVVSDHGPGIPPQERRLVFERFYRSTSA--RAMPGSGLGLAIVKKVVLNHGGMLRVEDTVPG--
DHKL_DICDI      ETDSEYVDVRDTGIGIKKEALPLLFKAFTQAEGTITRQYGGSGLGLAICKELV-----------------
SASA_ANASP      TTQKVQFSIGDTGPGIPSDNRERIFENHYR--LERDEAKEGYGIGLSLCQRIIRAHYGQIWVSNPHGGAW
MPRB_MYCSS      DPVHAELVVSDQGPGIPEAERRLVFERFYRSTAA--RAMPGSGLGLAIVKQVVLKHGGALRVEDTVPG--
MPRB_MYCSK      DPVHAELVVSDQGPGIPEAERRLVFERFYRSTAA--RAMPGSGLGLAIVKQVVLKHGGALRVEDTVPG--
MPRB_MYCSJ      DPVHAELVVSDQGPGIPEAERRLVFERFYRSTAA--RAMPGSGLGLAIVKQVVLKHGGALRVEDTVPG--
FIXL_RHIME      DPGEVAVVVEDTGGGIPEEVAGQLFKPFVTTKAS------GMGIGLSISKRIVEAHGGEMTVSKNEGGAT
DHKH_DICDI      ----------------------------------------------------------------------
DHKF_DICDI      EQNRCXXXXXXXXXXXXXXEDQRLFEPFHQIDSSSTRKYGGSGLGLAISSKLAKLMGGEVILERSKPGVG
SASA_ANAVT      TTQKVQFSIGDTGPGIPTDNRERIFENHYR--LERDEAKEGYGIGLSLCQRIIRAHYGQIWVSNPHGGAW
MPRB_MYCLE      DPSHVELVVSDYGPGIPPQERRLVFERFYRSTTARS--LPGSGLGLAIVKQVVINHGGLLRVEDTAPGVQ
FIXL_AZOC5      EDDMVTVSVCDTGHGISDEMRAQLFTPFV---TTKAQG---MGVGLSISRTIIEAHGGRWAEPNAGGGTI
KIND_BACSU      DKKAIIKVVDN-GEGISQEMLDHIFLPFV---TSKEKG---TGLGLVVCKRIV-----------------
YXDK_BACSU      DEDRTVLEVKDYGVGIPSQDIKRVFDPYYTGENGR-RFQESTGIGLHLVKEI------------------
YEDV_ECOLI      TNSYLNIDIASPGTKINEPE--KLFRRFWRGDNSRH--SVGQGLGLSLVKAIAELH--------------
SASA_THEEB      MTQKVQVTVSDTGPGIPIEQQEKIFGETVRLD--RDRAIEGYGIGLALCRQIIRMHYGQIWVSQPGKGSC
PHY1_SELMA      TSRKLEFRITHPGVGLPEELVQEMF--------DRGRGMTQEGLGLSMCRKLVKLMNGE-----------
NTRB_SHIFL      FQLTLHIDVEDNGPGIPPHLQD---TLFYPMVSGREGG---TGLGLSIARNLIDQHSGKIEFTSWPGHTE
NTRB_ECOLI      FQLTLHIDVEDNGPGIPPHLQD---TLFYPMVSGREGG---TGLGLSIARNLIDQHSGKIEFTSWPGHTE
NTRB_ECO57      FQLTLHIDVEDNGPGIPPHLQD---TLFYPMVSGREGG---TGLGLSIARNLIDQHSGKIEFTSWPGHTE
DHKE_DICDI      DQ--------------------------------------------------------------------
AFSQ2_STRCO     DHE-IVIRVRDNGPGIPEDVLPHVFDRFYKASASRPR-SEGSGLGLSIALENAHIHGGEITAENAPEG--
SASA_SYNE7      TSQKVQISISDTGSGIPRDQLSVIFKNLVR--LSRDSSQEGYGIGLSVCQRIVQAHFGRIWVASLGQGST
YVCQ_BACSU      QGHETRLSVADEGIGIPPQDLPRIFDAFFTGENGRTM-KEATGMGLYLAKQV------------------
NTRB_SALTY      FQLTLHIDVEDNGPGIPPHLQD---TLFYPMVSGREGG---TGLGLSIARNLIDQHAGKIEFTSWPGHTE
NTRB_SALTI      FQLTLHIDVEDNGPGIPPHLQD---TLFYPMVSGREGG---TGLGLSIARNLIDQHAGKIEFTSWPGHTE
KINB_BACSU      RNHTIMINITDNGVGMTDHQMQKLGEPYYSLKTN------GTGLGLTVTFSIIEHH--------------
MPRB_MYCBP      DASHAELVVSDRGPGIPVQERRLVFERFYRSASA--RALPGSGLGLAIVKQVVLNHGGLLRIEDTDPG--
MPRB_MYCBO      DASHAELVVSDRGPGIPVQERRLVFERFYRSASA--RALPGSGLGLAIVKQVVLNHGGLLRIEDTDPG--
SASA_PROMP      TNQWVEITICDKGAGIPVSEQKRIFLDRVRLPQT-SEGTSGFGIGLSVCRRIVEVHGGRIWVVSVGEGSC
SASA_PROM2      TNQWVEITICDKGAGIPLSEQKRIFLDRVRLPQT-SEGTSGFGIGLSVCRRIVQVHGGRIWVVSLSEGSC
PILS_PSEAE      ESDLPVLEVIDDGPGVPADKLNNLFEPFFTTE------SKGTGLGLYLSRELCESNQARIDYRNREEG--
MPRB_MYCTU      DASHAELVVSDRGPGIPVQERRLVFERFYRSASA--RALPGSGLGLAIVKQVVLNHGGLLRIEDTDPG--
MPRB_MYCTA      DASHAELVVSDRGPGIPVQERRLVFERFYRSASA--RALPGSGLGLAIVKQVVLNHGGLLRIEDTDPG--
MPRB_MYCS2      DHMHAEIVVSDQGPGIPPEERRLVFERFYRSDAA--RAMPGSGLGLAIVQQVVLKHGGALRIDETVPG--
VIRA_AGRT9      KKDYVLLSISDNGGGIPEAVLPHIFEPFF---TTRARNG-GTGLGLASVHGHISAFAGYIDVSSTGHGTR
VIRAW_RHIRD     KKDYVLLSISDNGGGIPEAVLPHIFEPFF-STRARNGG---TGLGLASVHGHISAFAGYIDVSSTGHGTR
PHOR_PSEAE      DEQGAHLSVQDTGIGVDPKHLPRLTERFYRVDSSRASNTGGTGLGLAIVKHVLIRHRARLEI--------
MAK3_SCHPO      ----------------------------------------------------------------------
HSSS_STAES      NH-LIIFNIENDGS-IAEEDAKHIFDRFYK----LSDESSSNGLGLAITQSIIHLH--------------
MAK1_SCHPO      STNTVVLKWEDTGQGFNRDDQLQMFKPFSQVESSTLPRHGGSGLGLVISKELVELHNGSMSCQSRRGGTR
PHY2_CERPU      PTRKLEFRVSHPGGGLPDELVLEMY--------DRAKGMTQEGLGLNMCRKLVRLMNGD--VQYVRENAQ
NTRB_KLEOX      FQLTLHIDVEDNGPGIPSHLQD---TLFYPMVSGREGG---TGLGLSIARSLIDQHSGKIEFTSWPGHTE
MPRB_MYCUA      DPSHAELVVSDNGPGISPQERRLVFERFYRSTSA--RAMPGSGLGLAIVKQVVLNHGGSLRIEDTVPG--
ZRAS_ECOLI      ESGAVKISVTDSGKGIAADQLDAIFTPYF---TTKAEG---TGLGLAVVHNIVEQHGGTIQVASQE-GKG
Y3689_SHEFN     ANNMAILSIKDNGCGMDSATLKRITEPFF--TTRRNEG--GSGLGLSVCSKIIKEHQGEMQIQST-----
NISK_LACLA      DEKYLYFEIWNNGHPFSEQAKKNAGKLFFTEDTGRS--GKHYGIGLSFAQGVALKHQGNLILSNPQKG--
PMRB_PECCC      TQQHVELQIEDEGQGIDESKVGELSKAFVRMD-SRYGG---IGLGLSIVTRIAQLHNGKFFLSNRPQG--
NTRYL_RICPR     KDDFISVIVMDNGKGFPPELIGKATESYV------TTSSKGMGVGLAIVKRIVEEHCGVLDIANRED---
NTRYL_RICBR     SEQFINITVLDNGRGFPPELIGKATESYV---TTRSKGM---GVGLAIVKRIVEEHCGVLDIANRETGID
HSSS_STAEQ      NH-LIIFNIENDGS-IAEEDAKHIFDRFYK----LSDESSSNGLGLAITQSIIHLH--------------
HSSS_STAAW      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAAS      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
ZRAS_ECO57      ESGAVKISVTDSGKGIAADQLEAIFTPYF---TTKAEG---TGLGLAVVHNIVEQHGGTIQVASLEKGAR
SASA_PROMS      TNQWVEITICDKGAGIPLSEQKRIFLDRVRLPQT-SEGTSGFGIGLSVCRRIVQVHGGRIWVVSEVGGSC
SASA_PROM0      TNQWVEITICDKGAGIPLSEQKRIFLDRVRLPQT-SEGTSGFGIGLSVCRRIVQVHGGRIWVVSEVGGSC
KDPD_ECOLI      EGENLQLDVWDNGPGLPPGQEQTIFDKFARG--NKESAVPGVGLGLAICRAIVDVHGGTITAFNPEGGAC
HSSS_STAAT      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAAE      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAAC      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAA8      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAA3      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
NTRYL_RICTY     -DDFINVIVMDNGKGFPPELIGKATESYV------TTSSKGMGVGLAIVKRIVEEHCGVLDIANRED---
HSSS_STAAN      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAAM      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAA9      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAA2      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAA1      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAAR      SHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
HSSS_STAAB      SHNNIIFTISNDGSPISPQVEARLFERFYKVSKHDN----SNGLGLAITKSIIELH--------------
NTRYL_RICFE     KDDFISVIVIDSGKGFPPELIGKATESYV------TTSSKGMGVGLAIVKRIVEEHCGILDIANRE----
COPS_PSESM      HGGRVELRLENPGPEIVPQHLDRIFDRFYRVDPARREG-RECGAGAS-----------------------
BPHY_PSEAE      QGDEVCLSVLNETSGLSEAQLANLFEPFKRESADNQRNRNGLGIGLYISQAIAQAHQGRIDVDCRDDVIT
SASA_PROMA      TNQWVQISVSDKGPGIPEEEQQRIFLDRVRLPQTSNETS-GFGIGLSVCRRIVEVHGGKIWVVSQPEGSC
NTRYL_RICCN     KDDFISVIVTDNGKGFPPELIGKATESYV------TTSSKGMGVGLAIVKRIVEEHCGILDIANRE----
ZRAS_KLEOX      GDGRVKVSVADSGKGMTAEQLQAIFTPYF------STKADGTGLGLAVVQNIVEQH--------------
PHY_PINSY       LKQHLEFRITHPGLGLPAELVQDLF--------DRSQWATQEGVGLSMCRKLLKLMNGDVRYIR-ESGIC
PHY_PICAB       KRHHMEFRITHSGQGIPEELIKEMFV--------HNQDMFQEGLGLYMCQQLVK----------------
SASA_PROM9      TNQWVEITICDKGAGIPLNEQKRIFLDRVRLPQT-SEGTSGFGIGLSVCRRIVQVHGGRIWVVSEIGGSC
QSEC_HAEIN      XXXX-----EDNGGGVEPEDLKKLGQRFYRPAGQNEKGS---GLGLSIVMRIAELH--------------
SASA_SYNS9      TNQWVEVSVCDSGPGIPNEEQQRIFLDRVRLPQTSDR-TTGFGVGLSVCRRIVEVHGGRIWVVSPEEGAC
SASA_PROM3      TSQWVQVSICDNGPGIPEDEQERIFLDRVRLPQTSVTTS-GFGVGLSVCRRIVEVHGGKIWVVSPDKGAC
PHY1_PHYPA      HVVHLEFRVSHPGAGLPEELVLEMY--------DRGKGMTQEGLGLNMCRKLVR----------------
NODV_BRAJA      DLGYVQLSVTDCGVGIAENDADRVLDPFF---TTKSSG---LGMGLSICRSIVEVHGGRISVVQKNGGAT
GRAS_STAHJ      NDGHVTLEIKDFGRGISHKDLPRIFERGFTSTVNRNE-TTSSGIGLYLVNSVKDQLGINVRVESTGQGTT
PHYB_SOYBN      IKQHAEFRMVCPGEGLPPELIQDMF--------NNSRWGTQEGLGLSMSRKILKLMNGEVQYIREAERCY
RSTB_ECOLI      --NRATLIVEDDGPGIAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSEGGAR
VIRA_AGRT5      AGDYVLLSVSDDGEGIAETVLPHIFEPFF---TTRS-CSGGTGLGLAAVHGHVSA---------------
SASA_SYNPX      TSQRVEVSVCDSGPGIPTEEQQRIFLDRVRLPQTSDR-TTGFGVGLSVCRRIVEVHGGRIWVVSEPEGAC
PHYD_ARATH      LNQRLEFRMACAGEGVPPEKVQDMF--------HSSRWTSPEGLGLSVCRKILK----------------
SASA_SYNS3      TSQWVQVSISDSGPGIPEEEQQRIFLDRVRLPQT-SAGASGFGVGLSVCRRIVEVHGGRIWVISPEKGAC
SASA_PROMM      TSHWVQVSICDNGPGIPEDEQERIFLDRVRLPQT-SVSTSGFGVGLSVCRRIVEVHGGKIWVVSPDKGAC
PHYB_TOBAC      TVVHIEFRIVCPGEGLPPELVQDMF--------HSSRWVTKEGLGLSMCRKILK----------------
PHYB_SOLTU      TVVHIELRIICPGEGLPPELVQDMF--------HSSRWVTQEGLGLSMCRKMLKLMNGE-----------
DCTB_RHILE      DAGMVTVTVADNGPGIPTEIRKGLFTPF---NTSKESG---LGLGLVISKDIVGDYGGRMDVASDSGGTR
TCSB_EMENI      GEEKLQFEVEDTGPGIPQHLQNRVFEPFVQGDLRLNRKYGGTGLGLSICSQLARLMRGQI-QLNSEQG--
PHYB_ORYSJ      DTMLFLFRFACPGEGLPPEIVQDMF--------SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSF
PHYB_SORBI      DTELFIFRFTYPGEGLPADIVQDMF--------SNSQWSTQEGVGLSTCRKILK----------------
PHYB_ORYSI      DTMLFPFRFACPGEGLPPEIVQDMF--------SNSRWTTQEGIGLSICRKILKLMGGEVQYIRESERSF
PHYB1_SOLLC     ----------------------------------------------------------------------
DCTB_RHIME      EAGGIALTVADNGPGIAADVREELFTPF---NTSKEDG---LGLGLAISKEIVSDYGGTIEVESGPSGTT
PHYA_CUCPE      HLVHLEFRITYAGGGIPESLLNEMF--------GSEEDASEEGFSLLISRKLVKLMNGDVRYMREAGKSS
DHKI_DICDI      ------FSIKDRGIGVPEDKHDFIFDRFFQVDGSYSRVQGGVGLGLSICKKLIE----------------
PHYC_SORBI      KENHLEFRIVHPAPGVPEALIQEMFR--HNPEVSRE------GLGLYICQKLVK----------------
QSEC_SALTY      S-----FTVRDNGPGVAPEILTHIGERFYRPPGQSVTGS---GLGLSIVRRIATLHGMTVSFGNAAEG--
QSEC_SALTI      S-----FTVRDNGPGVAPEILTHIGERFYRPPGQSVTGS---GLGLSIVRRIATLHGMTVSFGNAAEG--
CSEC_STRCO      R-------VRDHGPGFPEDLLAEGPSRFRTGST--DRAGRGHGLGLTI----------------------
ENVZ_SALTY      ESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARS--TSGTGLGLAIVQRIIDNHNGMLEIGTSERG--
NTRB_PROVU      FQITLHIDVIDTGSGIPPHLQD---TLFYPMVSGREDGN---GLGLSIARNLVDQHAGKIEFTSWPGNTE
ENVZ_SALTI      ESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARS--TSGTGLGLAIVQRIIDNHNGMLEIGTSERG--
PHYC_ARATH      KRVELEFRIIHPAPGLPEDLVREMFQPLRKG-TSRE------GLGLHITQKLVKLME-------------
GLNK_BACSU      NESMVEFQVEDNGPGISEKIGDIV---FDPGFTSKEFGTPSTGIGLSYVKEIVTELEGDITFDNQQRGVV
NTRB_VIBAL      HQANIHVEITDNGPGIPPELQD---TLFYPMVSGREGG---TGLGLSISQNLIDQHNGKIDV--------
PHYC_ORYSJ      MENHLEFRLVHPAPGVPEALIQEMF--------RHSPGASREGLGLYISQKLVK----------------
PHYC_ORYSI      MENHLEFRLVHPAPGVPEALIQEMF--------RHSPGASREGLGLYISQKLVK----------------
EVGS_ECOLI      DDNHIKMTIMDXXXXXXXXXXXXXFKRY--SQTSAGRQQTGSGLGLMICKELIKNMQGDLSL--------
EVGS_ECO57      HIDDNHAVIKMTIMDXXXXXXXXXXXXXFKSQTSAGRQQTGSGLGLMICKELIKNMQGDLSL--------
PHYA_ARATH      HLANLEIRLTHTGAGIPEFLLNQMF---------------------------------------------
VIRAL_RHIRD     AGDYILLSFEDNGGGIGQAALPHIFEPFFR--TRAQCG--GTGLGLSTVHGHVSAMAGFVDVISTGRGTR
SLN1_YEAST      ENPKISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMH---GTMKLESGSK
NTRY_AZOBR      DAERIAMIIEDNGKGLPTEERDRLTEPYV---TTRAKG---TGLGLAIVKKIMEDHGGVLTLEDREGG--
CYAD_DICDI      ----------------------------------------------------------------------
PHYA_SOLTU      QLALLEFRIRHTGGGVPEELLSQMF---------------------------------------------
GRAS_STAAR      IDQHVALIIKDHGRGISKKDMPRIFERGFTSTANRNE-TTSSGMGLYLVDSV------------------
ENVZ_SHIFL      EPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISG--TGLGLAIVQRIVDNHNGMLELGTSERG--
ENVZ_ECOLI      EPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISG--TGLGLAIVQRIVDNHNGMLELGTSERG--
PHYB_ARATH      SKQRTEFRMACPGEGLP--------PELVRDMFHSSRWTSPEGLGLSVCRKILKLMNGE-----------
METK_PICTO      KDDKVYY-LTVTGLSMENGD-----------DGSVGRGNRVNGL--------------------------
TLPA_BACSU      ----------------------------------------------------------------------
NTRY_AZOC5      GEDLVIDIIDN-GTGLPQESRNRLLEPYV---TTREKG---TGLGLAIVGKIMEEH--------------
BCES_BACHD      VSGKTVVEVTDFGRGIEPKDLPRIFEKGFT-STKTDQTNGATGMGLYLAKRVAEPLLIDLAVSSTGEGTT
QSEC_ECO57      ADN---FIVRDNGPGVTPEALARIGERFYRPPGQTATGS---GLGLSIVQRIAKLHGMNVEFGNAEQG--
QSEC_ECOLI      ADN---FIVRDNGPGVTPEALARIGERFYRPPGQTATGS---GLGLSIVQRIAKLHGMNVEFGNAEQG--
PHYA_SOYBN      KEQKLELSITHGGSGVPEVLLNQMF---------------------------------------------
MCPB_BACSU      ----------------------------------------------------------------------
NTRB_RHOCA      RPDPLQVEVIDDGPGIPADIASSIFEPFVSG---RENG---TGLGLALVSKIISEHNGWISVESAPGRTL
TLPB_BACSU      ----------------------------------------------------------------------
DHKM_DICDI      ----------------------------------------------------------------------
PHYA1_TOBAC     TKDRIGESVQHTGGGVPEELLSQMF---------------------------------------------
PHYA1_MAIZE     KNSDFELRIKHRGAGVP----AEILSQMYEED---NKEQSEEGFSLAVSRNLLR----------------


                         *         .         .         .         .         +         .:560
query           FYFTLKKSKEIDEVEEx
PHOR_BACSU      FTVTLKRAAE-------
VANS_ENTFA      FWLDL------------
YYCG_BACSU      ITFTLPYKEEQED----
GACS_PSESY      FWISLKLPKAREDKEE-
WALK_STAAW      IFITL------------
WALK_STAAU      IFITL------------
WALK_STAAT      IFITL------------
WALK_STAAS      IFITL------------
WALK_STAAR      IFITL------------
WALK_STAAN      IFITL------------
WALK_STAAM      IFITL------------
WALK_STAAE      IFITL------------
WALK_STAAC      IFITL------------
WALK_STAAB      IFITL------------
WALK_STAA9      IFITL------------
WALK_STAA8      IFITL------------
WALK_STAA3      IFITL------------
WALK_STAA2      IFITL------------
WALK_STAA1      IFITL------------
WALK_STAHJ      IFITL------------
WALK_STAES      IFITL------------
WALK_STAEQ      IFITL------------
WALK_STAS1      IFITL------------
YCLK_BACSU      FIIRL------------
WALK_STASR      IYITL------------
RESE_BACSU      FSF--------------
CSSS_BACSU      YRIAVPK----------
SRRB_STAAW      TTFIIKLPK--------
SRRB_STAAU      TTFIIKLPK--------
SRRB_STAAS      TTFIIKLPK--------
SRRB_STAAR      TTFIIKLPK--------
SRRB_STAAC      TTFIIKLPK--------
SRRB_STAA8      TTFIIKLPK--------
SRRB_STAAN      TTFIIKLPK--------
SRRB_STAAM      TTFIIKLPK--------
PHOR_KLEPN      FSFLL------------
BARA_SHIFL      FWF--------------
BARA_ECOLI      FWF--------------
BARA_ECOL6      FWF--------------
BARA_ECO57      FWF--------------
DHKB_DICDI      FSFTI------------
YKOH_BACSU      -----------------
DHKA_DICDI      -----------------
SEX3_MYCLE      STFTL------------
LUXQ_VIBHA      FVITL------------
ARLS_STAHJ      QYTTFK-----------
PHOR_ECOLI      FSFVI------------
RPRX_BACFR      FIIAL------------
BAES_ECOLI      -----------------
DSPA_SYNY3      FWFDL------------
DHKD_DICDI      FTLRLPLTPNMDE----
PDHS_OCHA4      -----------------
DOKA_DICDI      FWFAIKVS---------
SAES_STAAE      MTVTLHK----------
SAES_STAAC      MTVTLHK----------
SAES_STAA8      MTVTLHK----------
SAES_STAA3      MTVTLHK----------
RPFC_XANCP      FWFEL------------
RPFC_XANC8      FWFEL------------
DHKK_DICDI      FWFILPLEEGTDQ----
SAES_STAAW      MTVTLHK----------
SAES_STAAS      MTVTLHK----------
SAES_STAAR      MTVTLHK----------
SAES_STAAN      MTVTLHK----------
SAES_STAAM      MTVTLHK----------
SAES_STAAB      MTVTLHK----------
PHOR_SHIDY      FSFVI------------
ARLS_STAEQ      NYTTFKIS---------
SAES_STAES      MTLTLKK----------
SAES_STAEQ      MTLTLKK----------
ARLS_STAES      KYTTFKIS---------
SENX3_MYCTU     STFTL------------
SENX3_MYCBO     STFTL------------
ARLS_STAS1      KYTTFK-----------
CHVG_AGRT5      KY---------------
ARLS_STAAW      -----------------
ARLS_STAAS      -----------------
ARLS_STAAR      -----------------
ARLS_STAAN      -----------------
ARLS_STAAM      -----------------
ARLS_STAAC      -----------------
ARLS_STAAB      -----------------
ARLS_STAA8      -----------------
ARLS_STAA3      -----------------
LUXQ_VIBVY      FYLSIPVEK--------
LUXQ_VIBVU      FYLSIPVEK--------
PDHS_BRUSU      -----------------
PDHS_BRUSI      -----------------
PDHS_BRUO2      -----------------
PDHS_BRUME      -----------------
PDHS_BRUAB      -----------------
PDHS_BRUA2      -----------------
PDHS_BRUA1      -----------------
PDHS_BRUC2      -----------------
SENX3_MYCS2     STFTL------------
MTRB_MYCPA      SCFRL------------
VANS_ENTFC      F----------------
LUXQ_VIBCH      TRFEIQLPIELVE----
ETR1_MALDO      -----------------
DLTS_STRA3      -----------------
Y1002_RHIME     -----------------
HSSS_STAHJ      FTVTLPET---------
DHKC_DICDI      FHFVI------------
LUXQ_VIBPA      FVVTL------------
DLTS_STRA5      -----------------
CUSS_ECO57      FVIVL------------
YCF26_PORYE     FFFDLIIAKD-------
TCSA_EMENI      FWFTAK-----------
ETR1_PELHO      -----------------
SILS_SALTY      FILSVPRLEKM------
CZCS_RALME      TRFTLR-----------
YCF26_PORPU     FFFDLMIAKD-------
ETR1_PRUPE      -----------------
ETR1_CUCMR      -----------------
SPHS_SYNE7      -----------------
MTRB_MYCTU      -----------------
MTRB_MYCBO      -----------------
KINC_BACSU      -----------------
CUSS_ECOLI      FVITL------------
CUSS_ECOL6      FVIIL------------
SASA_MICAN      FHFTL------------
SASA_CYAA5      FHFTL------------
PCOS_ECOLX      -----------------
MTRB_MYCLE      -----------------
ARCB_SHIFL      STFTL------------
ARCB_ECOLI      STFTL------------
ARCB_ECO57      STFTL------------
BVGS_BORBR      -----------------
SASA_CYAP8      FHFTL------------
ETR1_SOLLC      -----------------
ETR2_PELHO      -----------------
BVGS_BORPE      -----------------
BVGS_BORPA      -----------------
SASA_SYNY3      FHFTL------------
CHVG_RHIME      -----------------
PHOR_HAEIN      FSFIIPK----------
ETR1_CUCSA      LPFTSK-----------
KINE_BACSU      FHITLPVRQNAEE----
SASA_SYNJB      FHFTL------------
ETR2_SOLLC      -----------------
SPAK_BACSU      -----------------
DIVJ_CAUCR      -----------------
CREC_ECOLI      -----------------
BASS_ECOLI      AWVRLKKDQYV------
MAK2_SCHPO      FWF--------------
HSSS_STAS1      FTITFKK----------
YCBM_BACSU      -----------------
SASA_SYNJA      FHFTL------------
KDPD_CLOAB      FKFNIPK----------
ETR1_TOBAC      -----------------
CPXA_ECOLI      -----------------
CPXA_ECOL6      -----------------
CPXA_ECO57      -----------------
ETR1_PASED      -----------------
CUTS_STRLI      -----------------
CUTS_STRCO      -----------------
ZRAS_SALTY      -----------------
ZRAS_SALTI      -----------------
PLEC_CAUCR      VSFTL------------
YVRG_BACSU      -----------------
ARCB_HAEIN      -----------------
RCSC_ECOLI      SQFTVR-----------
ERS1_ARATH      -----------------
ATOS_ECOLI      -----------------
SASA_CYAP7      FHFTL------------
RCSC_SALTI      SQFTLR-----------
DHKJ_DICDI      -----------------
TORS_ECO57      -----------------
RCSC_SALTY      SQFTLR-----------
MPRB_MYCVP      -----------------
KINB_PSEAE      FYMLL------------
KINA_BACSU      FKISFPK----------
ETR1_ARATH      -----------------
BASS_SALTY      AWVLLKKA---------
PHY_MOUSC       NFFLLQ-----------
TORS_ECOLI      -----------------
PHYB_ANASP      FYFTLQ-----------
CIAH_STRR6      -----------------
CIAH_STRPN      -----------------
IRLS_BURPS      TTFWLK-----------
ETR1_BRAOL      -----------------
FIXL_BRAJA      FRFTLPAADE-------
SASA_NOSP7      FHFTL------------
PHYA_ANASP      FYFTI------------
PHY1_SYNY3      FYFSI------------
MPRB_MYCPA      -----------------
DHKG_DICDI      -----------------
YFHK_ECOLI      FRIELPSSK--------
RSSA_SERMA      FIIDLPES---------
GTCS_ANEMI      -----------------
DIVL_CAUCR      -----------------
MPRB_MYCA1      -----------------
DHKL_DICDI      -----------------
SASA_ANASP      FHFTL------------
MPRB_MYCSS      -----------------
MPRB_MYCSK      -----------------
MPRB_MYCSJ      -----------------
FIXL_RHIME      FRFTL------------
DHKH_DICDI      -----------------
DHKF_DICDI      SLFSV------------
SASA_ANAVT      FHFTL------------
MPRB_MYCLE      -----------------
FIXL_AZOC5      FRFTLRTVDE-------
KIND_BACSU      -----------------
YXDK_BACSU      -----------------
YEDV_ECOLI      -----------------
SASA_THEEB      FHFTL------------
PHY1_SELMA      -----------------
NTRB_SHIFL      FYLPIRK----------
NTRB_ECOLI      FYLPIRK----------
NTRB_ECO57      FYLPIRK----------
DHKE_DICDI      -----------------
AFSQ2_STRCO     -----------------
SASA_SYNE7      FHFTM------------
YVCQ_BACSU      -----------------
NTRB_SALTY      FYLPIRK----------
NTRB_SALTI      FYLPIRK----------
KINB_BACSU      -----------------
MPRB_MYCBP      -----------------
MPRB_MYCBO      -----------------
SASA_PROMP      FHFTV------------
SASA_PROM2      FHFTV------------
PILS_PSEAE      -----------------
MPRB_MYCTU      -----------------
MPRB_MYCTA      -----------------
MPRB_MYCS2      -----------------
VIRA_AGRT9      FDIYLPPSSK-------
VIRAW_RHIRD     FDIYLPPSSK-------
PHOR_PSEAE      -----------------
MAK3_SCHPO      -----------------
HSSS_STAES      -----------------
MAK1_SCHPO      FMWT-------------
PHY2_CERPU      CYFVV------------
NTRB_KLEOX      FYLPIRK----------
MPRB_MYCUA      -----------------
ZRAS_ECOLI      STFTL------------
Y3689_SHEFN     -----------------
NISK_LACLA      -----------------
PMRB_PECCC      -----------------
NTRYL_RICPR     -----------------
NTRYL_RICBR     IRFNLEELK--------
HSSS_STAEQ      -----------------
HSSS_STAAW      -----------------
HSSS_STAAS      -----------------
ZRAS_ECO57      F----------------
SASA_PROMS      FHFTV------------
SASA_PROM0      FHFTV------------
KDPD_ECOLI      FRVTLQTAPELEEFHE-
HSSS_STAAT      -----------------
HSSS_STAAE      -----------------
HSSS_STAAC      -----------------
HSSS_STAA8      -----------------
HSSS_STAA3      -----------------
NTRYL_RICTY     -----------------
HSSS_STAAN      -----------------
HSSS_STAAM      -----------------
HSSS_STAA9      -----------------
HSSS_STAA2      -----------------
HSSS_STAA1      -----------------
HSSS_STAAR      -----------------
HSSS_STAAB      -----------------
NTRYL_RICFE     -----------------
COPS_PSESM      -----------------
BPHY_PSEAE      FCLRL------------
SASA_PROMA      FYFTVKRNKSLE-----
NTRYL_RICCN     -----------------
ZRAS_KLEOX      -----------------
PHY_PINSY       YF---------------
PHY_PICAB       -----------------
SASA_PROM9      FHFTV------------
QSEC_HAEIN      -----------------
SASA_SYNS9      FTFTV------------
SASA_PROM3      FYLTV------------
PHY1_PHYPA      -----------------
NODV_BRAJA      FQFALPLHKE-------
GRAS_STAHJ      FVLTFPKQNEL------
PHYB_SOYBN      FYVLLE-----------
RSTB_ECOLI      FSFS-------------
VIRA_AGRT5      -----------------
SASA_SYNPX      FTFTV------------
PHYD_ARATH      -----------------
SASA_SYNS3      FTFNV------------
SASA_PROMM      FYLTV------------
PHYB_TOBAC      -----------------
PHYB_SOLTU      -----------------
DCTB_RHILE      FIVQLRKA---------
TCSB_EMENI      -----------------
PHYB_ORYSJ      FHIVLE-----------
PHYB_SORBI      -----------------
PHYB_ORYSI      FHIVLE-----------
PHYB1_SOLLC     -----------------
DCTB_RHIME      FAVNLKKA---------
PHYA_CUCPE      FIITVE-----------
DHKI_DICDI      -----------------
PHYC_SORBI      -----------------
QSEC_SALTY      -----------------
QSEC_SALTI      -----------------
CSEC_STRCO      -----------------
ENVZ_SALTY      -----------------
NTRB_PROVU      F----------------
ENVZ_SALTI      -----------------
PHYC_ARATH      -----------------
GLNK_BACSU      FAIRL------------
NTRB_VIBAL      -----------------
PHYC_ORYSJ      -----------------
PHYC_ORYSI      -----------------
EVGS_ECOLI      -----------------
EVGS_ECO57      -----------------
PHYA_ARATH      -----------------
VIRAL_RHIRD     FDIYLPTS---------
SLN1_YEAST      FTFTLNQTKEI------
NTRY_AZOBR      -----------------
CYAD_DICDI      -----------------
PHYA_SOLTU      -----------------
GRAS_STAAR      -----------------
ENVZ_SHIFL      -----------------
ENVZ_ECOLI      -----------------
PHYB_ARATH      -----------------
METK_PICTO      -----------------
TLPA_BACSU      -----------------
NTRY_AZOC5      -----------------
BCES_BACHD      FTLTFPKENE-------
QSEC_ECO57      -----------------
QSEC_ECOLI      -----------------
PHYA_SOYBN      -----------------
MCPB_BACSU      -----------------
NTRB_RHOCA      FRISL------------
TLPB_BACSU      -----------------
DHKM_DICDI      -----------------
PHYA1_TOBAC     -----------------
PHYA1_MAIZE     -----------------