[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81707.1

[Show Plain Result]


## Summary of Sequence Search
    1::229
   53::190     5e-07  33%  365 aa  Y550_METJA RecName: Full=Uncharacterized protein MJ0550;
 1182::1324    3e-04  27% 2514 aa  PKS8_DICDI RecName: Full=Probable polyketide synthase 8/35;       
  113::230     3e-04  30%  288 aa  IOLJ_BACHD RecName: Full=6-phospho-5-dehydro-2-deoxy-D-gluconate
 1153::1324    5e-04  26% 2931 aa  PKS9_DICDI RecName: Full=Probable polyketide synthase 9/36;       
  308::396     6e-04  29%  454 aa  FLGE_HELMU RecName: Full=Flagellar hook protein flgE;Flags:
    1::229

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxVLLKSFPCVWGKCAFCDYIEDNSKNTEEIIKLNKEVLSNVKGIYGVLEVINSGSV
Y550_METJA      ---------------IILRTEGCYYAKCLMCSYLMDSSKITAEAIEKYKEKIKDLKDFS--VKIFTSGSF
PKS8_DICDI      ------------------------------------------------------------IIVMLSDGSV
IOLJ_BACHD      ---------------------------------IEDNIAMTKEVVAYAQPRNVSVEAEVGTVGGMEDGLI
PKS9_DICDI      ---------------------------------IPANLKDYKDSVYVYSHLKSSVDSFFGIIVMLSDGSV
FLGE_HELMU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FELPKETLEEIKRIVVEKNIKKLFFEAHWCYRNRLKEIEEYFGVPIIFKTGIETFDDHFRNDILNKNARF
Y550_METJA      LEVPKEARNYIKKLSEFDNLKEVAIESRFIDEDKLNEIRKYLDVNVEIGVGIESFNEEIREKAINK----
PKS8_DICDI      LYEIQEVI--FKSLIPIKHSLKIEYPNDELYKVHLQSKDSQIPTPSSFKSII------YENDFFH--SAL
IOLJ_BACHD      GGVKYADLDECVRVVEEANIDALLGSVHGPYQEEMKVISERTGVPLVLHGGSGIPDYQIRKAILLGHAKI
PKS9_DICDI      LYEIEEVV--CKSLIPIKDSLKIEYPNDELYKVHLQSKDSPIPTPSSFKSII------YENDFFH--SAL
FLGE_HELMU      ------------------------------------------------KTGVEAFVDNGMLRLQNKNNMD


                         +         .         .         .         .         *         .:210
query           NDVEEVKKYFKSICLMVGIKGQNKDMIKRDMDILLNNFKYGTVNIWTENTTSFKRDEELIKWFEKEYSFL
Y550_METJA      ----------------------------------------------------------------------
PKS8_DICDI      NIPEDLFKYISTLFY--------KDIIKRCPEININKINSHSVN---EIISSFSKISKNQRLFRFVFETI
IOLJ_BACHD      N---------------------------------------------------------------------
PKS9_DICDI      NIPEDLFKYISTLFY--------KDIIKRCPEININKINSHSVN---EIISSFSKISKHERLFRFVFETI
FLGE_HELMU      GDAE-----VKNIRITADGTGAFANFIEGDSDITAFRYRYTTSASPDSGTGQFRTTEDLRALIQYDANLI


                         .         .         .         +         .         .         .:280
query           KDNKTIEVLFENTDxxxxx
Y550_METJA      -------------------
PKS8_DICDI      KENGILNSLEENDD-----
IOLJ_BACHD      -------------------
PKS9_DICDI      KENGILNSLEENDD-----
FLGE_HELMU      KD-----------------