[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81731.1

[Show Plain Result]


## Summary of Sequence Search
    1::434
    4::436     e-102  43%  451 aa  YQEV_BACSU RecName: Full=Putative methylthiotransferase yqeV;      
    1::410     4e-89  41%  410 aa  Y474_AQUAE RecName: Full=Putative methylthiotransferase aq_474;    
   11::437     2e-75  37%  438 aa  Y16R_MYCIO RecName: Full=Putative methylthiotransferase in 16S RNA
   23::453     1e-71  36%  453 aa  MIAB_CLOTE RecName: Full=(Dimethylallyl)adenosine tRNA
   20::443     2e-71  38%  450 aa  MIAB_CLOBM RecName: Full=(Dimethylallyl)adenosine tRNA
   20::443     5e-71  37%  450 aa  MIAB_CLOBK RecName: Full=(Dimethylallyl)adenosine tRNA
    4::416     9e-71  38%  434 aa  Y830_THEMA RecName: Full=Putative methylthiotransferase TM_0830;   
   37::467     3e-70  39%  471 aa  MIAB_THEP3 RecName: Full=(Dimethylallyl)adenosine tRNA
   37::467     6e-70  39%  471 aa  MIAB_THEPX RecName: Full=(Dimethylallyl)adenosine tRNA
    3::426     2e-69  35%  448 aa  MIAB_PELTS RecName: Full=(Dimethylallyl)adenosine tRNA
   20::443     4e-69  37%  450 aa  MIAB_CLOBH RecName: Full=(Dimethylallyl)adenosine tRNA
   20::443     4e-69  37%  450 aa  MIAB_CLOB1 RecName: Full=(Dimethylallyl)adenosine tRNA
   20::443     5e-68  36%  450 aa  MIAB_CLOBL RecName: Full=(Dimethylallyl)adenosine tRNA
   24::453     2e-67  35%  455 aa  MIAB_CLOB8 RecName: Full=(Dimethylallyl)adenosine tRNA
   37::467     1e-66  36%  471 aa  MIAB_THETN RecName: Full=(Dimethylallyl)adenosine tRNA
   49::479     4e-66  33%  480 aa  MIAB_CLOTH RecName: Full=(Dimethylallyl)adenosine tRNA
   25::455     4e-66  34%  456 aa  MIAB_CLOBB RecName: Full=(Dimethylallyl)adenosine tRNA
   24::454     5e-66  34%  456 aa  MIAB_CLOBA RecName: Full=(Dimethylallyl)adenosine tRNA
   21::452     1e-65  33%  452 aa  MIAB_CLONN RecName: Full=(Dimethylallyl)adenosine tRNA
   34::469     3e-65  34%  471 aa  MIAB_ALKOO RecName: Full=(Dimethylallyl)adenosine tRNA
   11::441     6e-65  35%  441 aa  MIAB_CLOAB RecName: Full=(Dimethylallyl)adenosine tRNA
   16::445     1e-64  33%  451 aa  MIAB_NATTJ RecName: Full=(Dimethylallyl)adenosine tRNA
   25::454     2e-63  33%  456 aa  MIAB_CLOPH RecName: Full=(Dimethylallyl)adenosine tRNA
   15::446     7e-63  33%  447 aa  MIAB_CLOPE RecName: Full=(Dimethylallyl)adenosine tRNA
   15::446     7e-63  33%  447 aa  MIAB_CLOP1 RecName: Full=(Dimethylallyl)adenosine tRNA
   15::446     9e-63  33%  447 aa  MIAB_CLOPS RecName: Full=(Dimethylallyl)adenosine tRNA
   15::421     4e-62  34%  421 aa  Y477_CHLPN RecName: Full=Putative methylthiotransferase
    3::446     1e-61  33%  458 aa  MIAB_AKKM8 RecName: Full=(Dimethylallyl)adenosine tRNA
   31::460     1e-61  32%  461 aa  MIAB_FINM2 RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     3e-61  33%  509 aa  MIAB_BACCN RecName: Full=(Dimethylallyl)adenosine tRNA
   10::439     5e-61  33%  440 aa  MIAB_CARHZ RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     8e-61  34%  509 aa  MIAB_BACWK RecName: Full=(Dimethylallyl)adenosine tRNA
   12::372     1e-60  35%  443 aa  MIAB_DESAP RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  34%  514 aa  MIAB_STAAW RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  34%  514 aa  MIAB_STAAS RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  34%  514 aa  MIAB_STAAN RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  34%  514 aa  MIAB_STAAM RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  34%  514 aa  MIAB_STAA9 RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  34%  514 aa  MIAB_STAA2 RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  34%  514 aa  MIAB_STAA1 RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     2e-60  33%  509 aa  MIAB_BACC4 RecName: Full=(Dimethylallyl)adenosine tRNA
   73::491     2e-60  34%  513 aa  MIAB_STAS1 RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  33%  514 aa  MIAB_STAAT RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  33%  514 aa  MIAB_STAAE RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  33%  514 aa  MIAB_STAAC RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  33%  514 aa  MIAB_STAA8 RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     2e-60  33%  514 aa  MIAB_STAA3 RecName: Full=(Dimethylallyl)adenosine tRNA
   21::469     5e-60  34%  470 aa  MIAB_SYMTH RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     7e-60  33%  514 aa  MIAB_STAAR RecName: Full=(Dimethylallyl)adenosine tRNA
   74::504     7e-60  33%  514 aa  MIAB_STAAB RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     7e-60  33%  509 aa  MIAB_BACCR RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     7e-60  33%  509 aa  MIAB_BACC2 RecName: Full=(Dimethylallyl)adenosine tRNA
   42::471     9e-60  32%  471 aa  MIAB_CALS8 RecName: Full=(Dimethylallyl)adenosine tRNA
   60::490     1e-59  34%  491 aa  MIAB_MYCPE RecName: Full=(Dimethylallyl)adenosine tRNA
   81::516     1e-59  32%  531 aa  MIAB_GEOKA RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-59  33%  509 aa  MIAB_BACHK RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-59  33%  509 aa  MIAB_BACCZ RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-59  33%  509 aa  MIAB_BACC7 RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-59  33%  509 aa  MIAB_BACC1 RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-59  33%  509 aa  MIAB_BACC0 RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-59  33%  509 aa  MIAB_BACAH RecName: Full=(Dimethylallyl)adenosine tRNA
   23::452     2e-59  30%  456 aa  MIAB_DESRM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::441     2e-59  30%  467 aa  MIAB_METI4 RecName: Full=(Dimethylallyl)adenosine tRNA
   77::499     3e-59  32%  519 aa  MIAB_OCEIH RecName: Full=(Dimethylallyl)adenosine tRNA
   67::489     4e-59  32%  509 aa  MIAB_BACA2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::437     4e-59  33%  440 aa  MIAB_AQUAE RecName: Full=(Dimethylallyl)adenosine tRNA
   66::501     5e-59  32%  508 aa  MIAB_BACP2 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::435     8e-59  34%  435 aa  MIAB_FUSNN RecName: Full=(Dimethylallyl)adenosine tRNA
   45::463     1e-58  32%  478 aa  MIAB_CLOD6 RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-58  32%  509 aa  MIAB_BACAN RecName: Full=(Dimethylallyl)adenosine tRNA
    9::442     4e-58  32%  445 aa  MIAB_SYNWW RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     4e-58  34%  446 aa  MIAB_RICBR RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     5e-58  34%  446 aa  MIAB_RICB8 RecName: Full=(Dimethylallyl)adenosine tRNA
   11::438     5e-58  32%  440 aa  MIAB_GEOUR RecName: Full=(Dimethylallyl)adenosine tRNA
    6::429     7e-58  34%  431 aa  MIAB_THEYD RecName: Full=(Dimethylallyl)adenosine tRNA
    1::388     7e-58  35%  429 aa  MIAB_THEAB RecName: Full=(Dimethylallyl)adenosine tRNA
   13::431     7e-58  33%  450 aa  MIAB_CAUSK RecName: Full=(Dimethylallyl)adenosine tRNA
   45::475     7e-58  33%  476 aa  MIAB_ALKMQ RecName: Full=(Dimethylallyl)adenosine tRNA
   12::370     9e-58  35%  444 aa  MIAB_MOOTA RecName: Full=(Dimethylallyl)adenosine tRNA
   17::451     9e-58  31%  451 aa  MIAB_CYAP8 RecName: Full=(Dimethylallyl)adenosine tRNA
    1::434     1e-57  32%  437 aa  MIAB_SULSY RecName: Full=(Dimethylallyl)adenosine tRNA
    1::430     1e-57  32%  443 aa  MIAB_THESQ RecName: Full=(Dimethylallyl)adenosine tRNA
    1::430     1e-57  32%  443 aa  MIAB_THEP1 RecName: Full=(Dimethylallyl)adenosine tRNA
   23::449     1e-57  33%  450 aa  MIAB_PARUW RecName: Full=(Dimethylallyl)adenosine tRNA
    1::419     2e-57  31%  435 aa  MIAB_HYDS0 RecName: Full=(Dimethylallyl)adenosine tRNA
    1::430     3e-57  33%  443 aa  MIAB_THEMA RecName: Full=(Dimethylallyl)adenosine tRNA
   27::473     3e-57  33%  473 aa  MIAB_RHIL3 RecName: Full=(Dimethylallyl)adenosine tRNA
   81::515     3e-57  32%  523 aa  MIAB_GEOTN RecName: Full=(Dimethylallyl)adenosine tRNA
    6::448     3e-57  32%  467 aa  MIAB_BRASO RecName: Full=(Dimethylallyl)adenosine tRNA
   85::520     3e-57  33%  527 aa  MIAB_ANOFW RecName: Full=(Dimethylallyl)adenosine tRNA
   10::388     4e-57  34%  445 aa  MIAB_EHRRW RecName: Full=(Dimethylallyl)adenosine tRNA
    9::441     4e-57  31%  447 aa  MIAB_DESHY RecName: Full=(Dimethylallyl)adenosine tRNA
   74::492     6e-57  33%  514 aa  MIAB_STAHJ RecName: Full=(Dimethylallyl)adenosine tRNA
   10::388     6e-57  34%  445 aa  MIAB_EHRRG RecName: Full=(Dimethylallyl)adenosine tRNA
    4::445     7e-57  36%  445 aa  MIAB_RICFE RecName: Full=(Dimethylallyl)adenosine tRNA
   19::450     7e-57  33%  462 aa  MIAB_OCHA4 RecName: Full=(Dimethylallyl)adenosine tRNA
   10::437     1e-56  32%  453 aa  MIAB_SYNJA RecName: Full=(Dimethylallyl)adenosine tRNA
   24::458     1e-56  33%  461 aa  MIAB_SYNAS RecName: Full=(Dimethylallyl)adenosine tRNA
   12::448     1e-56  33%  456 aa  MIAB_MARMM RecName: Full=(Dimethylallyl)adenosine tRNA
    1::417     2e-56  32%  418 aa  MIAB_UNCTG RecName: Full=(Dimethylallyl)adenosine tRNA
    3::389     2e-56  34%  430 aa  MIAB_THEM4 RecName: Full=(Dimethylallyl)adenosine tRNA
   12::444     2e-56  32%  454 aa  MIAB_ANAVT RecName: Full=(Dimethylallyl)adenosine tRNA
    3::435     3e-56  33%  440 aa  MIAB_DICT6 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     4e-56  36%  445 aa  MIAB_RICRS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     4e-56  36%  445 aa  MIAB_RICRO RecName: Full=(Dimethylallyl)adenosine tRNA
    1::435     4e-56  31%  439 aa  MIAB_PETMO RecName: Full=(Dimethylallyl)adenosine tRNA
   78::512     4e-56  33%  520 aa  MIAB_BACSK RecName: Full=(Dimethylallyl)adenosine tRNA
    6::435     5e-56  34%  436 aa  MIAB_ARCB4 RecName: Full=(Dimethylallyl)adenosine tRNA
   11::445     6e-56  31%  451 aa  MIAB_SYNP2 RecName: Full=(Dimethylallyl)adenosine tRNA
   10::437     6e-56  31%  444 aa  MIAB_SYNJB RecName: Full=(Dimethylallyl)adenosine tRNA
   19::449     6e-56  32%  456 aa  MIAB_SYNFM RecName: Full=(Dimethylallyl)adenosine tRNA
    6::439     6e-56  33%  440 aa  MIAB_SILST RecName: Full=(Dimethylallyl)adenosine tRNA
   11::439     6e-56  33%  444 aa  MIAB_ANAPZ RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     8e-56  36%  445 aa  MIAB_RICCN RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     8e-56  33%  457 aa  MIAB_BURPP RecName: Full=(Dimethylallyl)adenosine tRNA
   23::452     1e-55  32%  472 aa  MIAB_RHIME RecName: Full=(Dimethylallyl)adenosine tRNA
   10::391     1e-55  34%  441 aa  MIAB_EHRCJ RecName: Full=(Dimethylallyl)adenosine tRNA
   10::398     1e-55  33%  447 aa  MIAB_DESPS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::442     1e-55  33%  445 aa  MIAB_DECAR RecName: Full=(Dimethylallyl)adenosine tRNA
    5::438     1e-55  32%  445 aa  MIAB_BUCBP RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-55  33%  457 aa  MIAB_BURXL RecName: Full=(Dimethylallyl)adenosine tRNA
    9::444     2e-55  36%  445 aa  MIAB_RICAH RecName: Full=(Dimethylallyl)adenosine tRNA
    6::392     3e-55  34%  441 aa  MIAB_ROSDO RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     3e-55  34%  446 aa  MIAB_RICCK RecName: Full=(Dimethylallyl)adenosine tRNA
    1::425     3e-55  31%  430 aa  MIAB_FERNB RecName: Full=(Dimethylallyl)adenosine tRNA
   16::435     4e-55  33%  499 aa  MIAB_SALTO RecName: Full=(Dimethylallyl)adenosine tRNA
    6::446     4e-55  32%  466 aa  MIAB_BRASB RecName: Full=(Dimethylallyl)adenosine tRNA
   23::452     5e-55  32%  472 aa  MIAB_SINMW RecName: Full=(Dimethylallyl)adenosine tRNA
   25::464     9e-55  32%  464 aa  MIAB_PROMS RecName: Full=(Dimethylallyl)adenosine tRNA
    1::423     9e-55  32%  426 aa  MIAB_COPPD RecName: Full=(Dimethylallyl)adenosine tRNA
   11::390     1e-54  34%  494 aa  MIAB_THEFY RecName: Full=(Dimethylallyl)adenosine tRNA
    6::448     1e-54  31%  465 aa  MIAB_RHOP5 RecName: Full=(Dimethylallyl)adenosine tRNA
   35::462     1e-54  33%  480 aa  MIAB_PROMM RecName: Full=(Dimethylallyl)adenosine tRNA
   16::410     1e-54  34%  467 aa  MIAB_PARL1 RecName: Full=(Dimethylallyl)adenosine tRNA
   10::391     1e-54  32%  442 aa  MIAB_EHRCR RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     1e-54  33%  457 aa  MIAB_BURS3 RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-54  31%  509 aa  MIAB_BACSU RecName: Full=(Dimethylallyl)adenosine tRNA
   67::502     1e-54  31%  509 aa  MIAB_BACLD RecName: Full=(Dimethylallyl)adenosine tRNA
    5::445     2e-54  35%  450 aa  MIAB_RICM5 RecName: Full=(Dimethylallyl)adenosine tRNA
   23::469     2e-54  33%  469 aa  MIAB_RHIEC RecName: Full=(Dimethylallyl)adenosine tRNA
   35::462     2e-54  34%  480 aa  MIAB_PROM3 RecName: Full=(Dimethylallyl)adenosine tRNA
    6::442     2e-54  32%  442 aa  MIAB_METFK RecName: Full=(Dimethylallyl)adenosine tRNA
    8::412     2e-54  33%  466 aa  MIAB_DESOH RecName: Full=(Dimethylallyl)adenosine tRNA
   33::458     2e-54  31%  524 aa  MIAB_COREF RecName: Full=(Dimethylallyl)adenosine tRNA
   23::469     2e-54  33%  469 aa  MIAB_RHIE6 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     2e-54  32%  448 aa  MIAB_ALHEH RecName: Full=(Dimethylallyl)adenosine tRNA
   12::451     3e-54  31%  451 aa  MIAB_TRIEI RecName: Full=(Dimethylallyl)adenosine tRNA
    3::448     3e-54  35%  457 aa  MIAB_RALSO RecName: Full=(Dimethylallyl)adenosine tRNA
   19::400     3e-54  36%  458 aa  MIAB_LEPBP RecName: Full=(Dimethylallyl)adenosine tRNA
   19::400     3e-54  36%  458 aa  MIAB_LEPBA RecName: Full=(Dimethylallyl)adenosine tRNA
   10::390     3e-54  33%  464 aa  MIAB_DESDG RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     3e-54  33%  457 aa  MIAB_BURM1 RecName: Full=(Dimethylallyl)adenosine tRNA
   14::448     4e-54  30%  448 aa  MIAB_CYAA5 RecName: Full=(Dimethylallyl)adenosine tRNA
   25::442     4e-54  32%  528 aa  MIAB_CLAM3 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     4e-54  33%  457 aa  MIAB_BURTA RecName: Full=(Dimethylallyl)adenosine tRNA
    6::439     6e-54  32%  439 aa  MIAB_SILPO RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     6e-54  32%  457 aa  MIAB_BURA4 RecName: Full=(Dimethylallyl)adenosine tRNA
   16::456     6e-54  32%  458 aa  MIAB_BARQU RecName: Full=(Dimethylallyl)adenosine tRNA
    3::442     6e-54  34%  475 aa  MIAB_ACTP7 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::442     6e-54  34%  475 aa  MIAB_ACTP2 RecName: Full=(Dimethylallyl)adenosine tRNA
   13::396     8e-54  34%  453 aa  MIAB_SYNR3 RecName: Full=(Dimethylallyl)adenosine tRNA
    6::432     8e-54  32%  436 aa  MIAB_RHOS1 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     8e-54  32%  457 aa  MIAB_BURCM RecName: Full=(Dimethylallyl)adenosine tRNA
    6::448     8e-54  31%  465 aa  MIAB_BRAJA RecName: Full=(Dimethylallyl)adenosine tRNA
   16::455     8e-54  32%  458 aa  MIAB_BART1 RecName: Full=(Dimethylallyl)adenosine tRNA
   23::469     1e-53  33%  469 aa  MIAB_RHILW RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-53  34%  474 aa  MIAB_HAES2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-53  34%  474 aa  MIAB_HAES1 RecName: Full=(Dimethylallyl)adenosine tRNA
   23::407     1e-53  32%  516 aa  MIAB_CORDI RecName: Full=(Dimethylallyl)adenosine tRNA
    3::442     1e-53  34%  475 aa  MIAB_ACTPJ RecName: Full=(Dimethylallyl)adenosine tRNA
    1::441     2e-53  33%  446 aa  MIAB_METEP RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  456 aa  MIAB_BURP8 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURCJ RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  33%  457 aa  MIAB_BURCH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  33%  457 aa  MIAB_BURCC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  33%  457 aa  MIAB_BURCA RecName: Full=(Dimethylallyl)adenosine tRNA
   96::531     2e-53  32%  538 aa  MIAB_BACHD RecName: Full=(Dimethylallyl)adenosine tRNA
   12::444     2e-53  31%  454 aa  MIAB_ANASP RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-53  33%  474 aa  MIAB_SALPK RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-53  33%  474 aa  MIAB_SALPA RecName: Full=(Dimethylallyl)adenosine tRNA
    9::428     2e-53  31%  491 aa  MIAB_SACEN RecName: Full=(Dimethylallyl)adenosine tRNA
    3::441     2e-53  34%  442 aa  MIAB_NEIM0 RecName: Full=(Dimethylallyl)adenosine tRNA
   74::491     2e-53  31%  514 aa  MIAB_LYSSC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURVG RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURPS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURP6 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURP0 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURMS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURMA RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURM9 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     2e-53  32%  457 aa  MIAB_BURM7 RecName: Full=(Dimethylallyl)adenosine tRNA
   24::455     2e-53  31%  467 aa  MIAB_BRUSU RecName: Full=(Dimethylallyl)adenosine tRNA
   24::455     2e-53  31%  467 aa  MIAB_BRUO2 RecName: Full=(Dimethylallyl)adenosine tRNA
   24::455     2e-53  31%  467 aa  MIAB_BRUC2 RecName: Full=(Dimethylallyl)adenosine tRNA
   24::455     2e-53  31%  467 aa  MIAB_BRUAB RecName: Full=(Dimethylallyl)adenosine tRNA
   24::455     2e-53  31%  467 aa  MIAB_BRUA2 RecName: Full=(Dimethylallyl)adenosine tRNA
   24::455     2e-53  31%  467 aa  MIAB_BRUA1 RecName: Full=(Dimethylallyl)adenosine tRNA
    1::393     3e-53  32%  436 aa  MIAB_THELT RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     3e-53  33%  474 aa  MIAB_SALAR RecName: Full=(Dimethylallyl)adenosine tRNA
   27::453     3e-53  32%  466 aa  MIAB_PROMA RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     3e-53  32%  446 aa  MIAB_JANMA RecName: Full=(Dimethylallyl)adenosine tRNA
   16::430     3e-53  30%  441 aa  MIAB_GLOVI RecName: Full=(Dimethylallyl)adenosine tRNA
   12::446     3e-53  31%  454 aa  MIAB_CYAP7 RecName: Full=(Dimethylallyl)adenosine tRNA
   30::455     3e-53  31%  522 aa  MIAB_CORGL RecName: Full=(Dimethylallyl)adenosine tRNA
    3::442     3e-53  33%  444 aa  MIAB_CHRVO RecName: Full=(Dimethylallyl)adenosine tRNA
   24::455     3e-53  31%  467 aa  MIAB_BRUSI RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALTY RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALTI RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALSV RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALPB RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALNS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALHS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALG2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALEP RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALDC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALCH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_SALA4 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::441     4e-53  33%  442 aa  MIAB_NEIG2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_HAEIN RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-53  33%  474 aa  MIAB_HAEIG RecName: Full=(Dimethylallyl)adenosine tRNA
   23::409     4e-53  32%  512 aa  MIAB_CORJK RecName: Full=(Dimethylallyl)adenosine tRNA
   34::459     4e-53  31%  526 aa  MIAB_CORGB RecName: Full=(Dimethylallyl)adenosine tRNA
   28::468     4e-53  32%  475 aa  MIAB_BORA1 RecName: Full=(Dimethylallyl)adenosine tRNA
    6::432     5e-53  32%  436 aa  MIAB_RHOS4 RecName: Full=(Dimethylallyl)adenosine tRNA
    9::445     5e-53  32%  449 aa  MIAB_ORITB RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     5e-53  33%  474 aa  MIAB_ECO81 RecName: Full=(Dimethylallyl)adenosine tRNA
   25::442     5e-53  32%  530 aa  MIAB_CLAMS RecName: Full=(Dimethylallyl)adenosine tRNA
   74::492     6e-53  31%  514 aa  MIAB_STAES RecName: Full=(Dimethylallyl)adenosine tRNA
   74::492     6e-53  31%  514 aa  MIAB_STAEQ RecName: Full=(Dimethylallyl)adenosine tRNA
    6::439     6e-53  31%  473 aa  MIAB_NITHX RecName: Full=(Dimethylallyl)adenosine tRNA
    3::441     6e-53  33%  442 aa  MIAB_NEIMF RecName: Full=(Dimethylallyl)adenosine tRNA
    3::441     6e-53  33%  442 aa  MIAB_NEIG1 RecName: Full=(Dimethylallyl)adenosine tRNA
   16::456     6e-53  33%  458 aa  MIAB_BARBK RecName: Full=(Dimethylallyl)adenosine tRNA
   31::406     6e-53  35%  515 aa  MIAB_ARTAT RecName: Full=(Dimethylallyl)adenosine tRNA
   25::464     8e-53  31%  464 aa  MIAB_PROM0 RecName: Full=(Dimethylallyl)adenosine tRNA
   12::429     8e-53  32%  454 aa  MIAB_NOSP7 RecName: Full=(Dimethylallyl)adenosine tRNA
   26::460     8e-53  32%  475 aa  MIAB_MESSB RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     8e-53  33%  474 aa  MIAB_HAEIE RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     8e-53  33%  474 aa  MIAB_HAEI8 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     8e-53  32%  457 aa  MIAB_BURP1 RecName: Full=(Dimethylallyl)adenosine tRNA
   24::455     8e-53  31%  467 aa  MIAB_BRUME RecName: Full=(Dimethylallyl)adenosine tRNA
   16::455     8e-53  32%  458 aa  MIAB_BARHE RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_SHISS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_SHIBS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     1e-52  32%  445 aa  MIAB_RICTY RecName: Full=(Dimethylallyl)adenosine tRNA
    3::441     1e-52  33%  442 aa  MIAB_NEIMB RecName: Full=(Dimethylallyl)adenosine tRNA
    3::442     1e-52  33%  475 aa  MIAB_HAEDU RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_CITK8 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_SHIFL RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_SHIF8 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_SHIDS RecName: Full=(Dimethylallyl)adenosine tRNA
    6::447     1e-52  31%  463 aa  MIAB_RHOPA RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_NITMU RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  32%  474 aa  MIAB_KLEP3 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ESCF3 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOUT RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOSM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOSE RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOLU RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOLI RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOLC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOL6 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOL5 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOK1 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECOHS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECODH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECO8A RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECO7I RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECO5E RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECO57 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECO55 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECO45 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-52  33%  474 aa  MIAB_ECO24 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::443     2e-52  31%  448 aa  MIAB_POLNS RecName: Full=(Dimethylallyl)adenosine tRNA
    8::436     2e-52  30%  438 aa  MIAB_PELCD RecName: Full=(Dimethylallyl)adenosine tRNA
   25::451     2e-52  33%  464 aa  MIAB_PROM2 RecName: Full=(Dimethylallyl)adenosine tRNA
   18::458     2e-52  33%  494 aa  MIAB_PROAC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     2e-52  32%  446 aa  MIAB_HERAR RecName: Full=(Dimethylallyl)adenosine tRNA
    4::440     2e-52  31%  442 aa  MIAB_DELAS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::440     2e-52  31%  448 aa  MIAB_ACISJ RecName: Full=(Dimethylallyl)adenosine tRNA
    6::434     3e-52  33%  435 aa  MIAB_SULDN RecName: Full=(Dimethylallyl)adenosine tRNA
    3::443     3e-52  31%  448 aa  MIAB_POLSQ RecName: Full=(Dimethylallyl)adenosine tRNA
   29::462     3e-52  30%  462 aa  MIAB_JANSC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     4e-52  31%  445 aa  MIAB_RICPR RecName: Full=(Dimethylallyl)adenosine tRNA
    3::441     4e-52  33%  442 aa  MIAB_NEIMA RecName: Full=(Dimethylallyl)adenosine tRNA
   19::413     4e-52  33%  507 aa  MIAB_MYCA9 RecName: Full=(Dimethylallyl)adenosine tRNA
   33::408     4e-52  34%  513 aa  MIAB_KOCRD RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-52  32%  474 aa  MIAB_KLEP7 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-52  32%  474 aa  MIAB_ENT38 RecName: Full=(Dimethylallyl)adenosine tRNA
   11::385     4e-52  34%  455 aa  MIAB_ANAMM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     5e-52  32%  474 aa  MIAB_SHIB3 RecName: Full=(Dimethylallyl)adenosine tRNA
   11::453     5e-52  31%  455 aa  MIAB_AGRT5 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     7e-52  32%  474 aa  MIAB_YERPN RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     7e-52  32%  474 aa  MIAB_YERPE RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     7e-52  32%  474 aa  MIAB_YERPA RecName: Full=(Dimethylallyl)adenosine tRNA
    6::447     7e-52  31%  463 aa  MIAB_RHOPT RecName: Full=(Dimethylallyl)adenosine tRNA
   25::462     7e-52  31%  464 aa  MIAB_PROM5 RecName: Full=(Dimethylallyl)adenosine tRNA
   31::397     7e-52  34%  480 aa  MIAB_BIFAA RecName: Full=(Dimethylallyl)adenosine tRNA
    1::382     9e-52  32%  470 aa  MIAB_TROWT RecName: Full=(Dimethylallyl)adenosine tRNA
    3::439     9e-52  32%  446 aa  MIAB_THIDA RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-51  33%  474 aa  MIAB_PASMU RecName: Full=(Dimethylallyl)adenosine tRNA
    9::445     1e-51  32%  449 aa  MIAB_ORITI RecName: Full=(Dimethylallyl)adenosine tRNA
   16::395     1e-51  32%  496 aa  MIAB_NOCSJ RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-51  32%  474 aa  MIAB_ENTS8 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     2e-51  32%  474 aa  MIAB_YERPY RecName: Full=(Dimethylallyl)adenosine tRNA
    1::382     2e-51  32%  470 aa  MIAB_TROW8 RecName: Full=(Dimethylallyl)adenosine tRNA
   10::390     2e-51  33%  449 aa  MIAB_DESVV RecName: Full=(Dimethylallyl)adenosine tRNA
   27::452     2e-51  32%  512 aa  MIAB_MYCGI RecName: Full=(Dimethylallyl)adenosine tRNA
   10::390     2e-51  33%  449 aa  MIAB_DESVH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     3e-51  32%  474 aa  MIAB_YERPP RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     3e-51  32%  474 aa  MIAB_YERPG RecName: Full=(Dimethylallyl)adenosine tRNA
    8::391     3e-51  34%  440 aa  MIAB_WOLPP RecName: Full=(Dimethylallyl)adenosine tRNA
   31::462     3e-51  32%  529 aa  MIAB1_MYCMM RecName: Full=(Dimethylallyl)adenosine tRNA
   10::392     4e-51  32%  421 aa  Y416_RICPR RecName: Full=Putative methylthiotransferase RP416;     
    4::427     4e-51  32%  474 aa  MIAB_YERPS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     4e-51  32%  474 aa  MIAB_YERPB RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     4e-51  32%  474 aa  MIAB_YERP3 RecName: Full=(Dimethylallyl)adenosine tRNA
   13::429     4e-51  31%  444 aa  MIAB_SPHAL RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-51  33%  474 aa  MIAB_ACTSZ RecName: Full=(Dimethylallyl)adenosine tRNA
    7::391     5e-51  30%  445 aa  RIMO_DESHY RecName: Full=Ribosomal protein S12
   20::401     5e-51  33%  505 aa  MIAB_STRCO RecName: Full=(Dimethylallyl)adenosine tRNA
    8::402     5e-51  32%  450 aa  MIAB_RHILO RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     5e-51  32%  477 aa  MIAB_PSEA6 RecName: Full=(Dimethylallyl)adenosine tRNA
    9::432     5e-51  34%  433 aa  MIAB_NITSB RecName: Full=(Dimethylallyl)adenosine tRNA
   12::448     5e-51  29%  449 aa  MIAB_LEPBL RecName: Full=(Dimethylallyl)adenosine tRNA
   12::448     5e-51  29%  449 aa  MIAB_LEPBJ RecName: Full=(Dimethylallyl)adenosine tRNA
   38::480     6e-51  32%  485 aa  MIAB_XANCP RecName: Full=(Dimethylallyl)adenosine tRNA
   38::480     6e-51  32%  485 aa  MIAB_XANCB RecName: Full=(Dimethylallyl)adenosine tRNA
   38::480     6e-51  32%  485 aa  MIAB_XANC8 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     6e-51  32%  474 aa  MIAB_SHELP RecName: Full=(Dimethylallyl)adenosine tRNA
    3::448     6e-51  34%  456 aa  MIAB_RALPJ RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     6e-51  32%  474 aa  MIAB_MANSM RecName: Full=(Dimethylallyl)adenosine tRNA
   28::467     6e-51  32%  469 aa  MIAB_LEPCP RecName: Full=(Dimethylallyl)adenosine tRNA
   14::393     6e-51  36%  444 aa  MIAB_ACIBL RecName: Full=(Dimethylallyl)adenosine tRNA
   10::443     8e-51  31%  477 aa  MIAB_NITWN RecName: Full=(Dimethylallyl)adenosine tRNA
    6::446     8e-51  31%  464 aa  MIAB_AZOC5 RecName: Full=(Dimethylallyl)adenosine tRNA
    2::428     1e-50  31%  444 aa  RIMO_CLOD6 RecName: Full=Ribosomal protein S12
   13::353     1e-50  35%  445 aa  MIAB_ZYMMO RecName: Full=(Dimethylallyl)adenosine tRNA
   47::432     1e-50  31%  540 aa  MIAB_CORU7 RecName: Full=(Dimethylallyl)adenosine tRNA
    6::397     1e-50  31%  470 aa  MIAB_XANP2 RecName: Full=(Dimethylallyl)adenosine tRNA
    6::447     1e-50  31%  473 aa  MIAB_RHOPB RecName: Full=(Dimethylallyl)adenosine tRNA
   14::444     1e-50  32%  445 aa  MIAB_PARDP RecName: Full=(Dimethylallyl)adenosine tRNA
   30::412     1e-50  32%  532 aa  MIAB_MYCUA RecName: Full=(Dimethylallyl)adenosine tRNA
   29::411     1e-50  33%  512 aa  MIAB_MYCS2 RecName: Full=(Dimethylallyl)adenosine tRNA
    5::437     1e-50  29%  438 aa  MIAB_GEOLS RecName: Full=(Dimethylallyl)adenosine tRNA
    6::439     1e-50  30%  441 aa  MIAB_GEOBB RecName: Full=(Dimethylallyl)adenosine tRNA
   12::429     1e-50  32%  454 aa  MIAB_ACAM1 RecName: Full=(Dimethylallyl)adenosine tRNA
   30::412     1e-50  32%  532 aa  MIAB2_MYCMM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     2e-50  31%  474 aa  MIAB_YERE8 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-50  32%  474 aa  MIAB_SHESH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-50  31%  474 aa  MIAB_SHEAM RecName: Full=(Dimethylallyl)adenosine tRNA
    6::432     2e-50  32%  436 aa  MIAB_RHOS5 RecName: Full=(Dimethylallyl)adenosine tRNA
   25::462     2e-50  30%  464 aa  MIAB_PROMP RecName: Full=(Dimethylallyl)adenosine tRNA
    6::445     2e-50  31%  476 aa  MIAB_PHOLL RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     2e-50  31%  443 aa  MIAB_NITEC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::440     2e-50  30%  480 aa  MIAB_COLP3 RecName: Full=(Dimethylallyl)adenosine tRNA
   38::486     2e-50  32%  490 aa  MIAB_PSYWF RecName: Full=(Dimethylallyl)adenosine tRNA
   20::455     2e-50  30%  457 aa  MIAB_PARD8 RecName: Full=(Dimethylallyl)adenosine tRNA
   12::423     3e-50  31%  451 aa  MIAB_SYNY3 RecName: Full=(Dimethylallyl)adenosine tRNA
   12::448     3e-50  29%  449 aa  MIAB_LEPIN RecName: Full=(Dimethylallyl)adenosine tRNA
   12::448     3e-50  29%  449 aa  MIAB_LEPIC RecName: Full=(Dimethylallyl)adenosine tRNA
   25::473     3e-50  30%  481 aa  MIAB_GRAFK RecName: Full=(Dimethylallyl)adenosine tRNA
    8::405     4e-50  33%  479 aa  MIAB_RHOBA RecName: Full=(Dimethylallyl)adenosine tRNA
   10::401     4e-50  31%  457 aa  MIAB_LAWIP RecName: Full=(Dimethylallyl)adenosine tRNA
   19::400     5e-50  32%  508 aa  MIAB_STRAW RecName: Full=(Dimethylallyl)adenosine tRNA
   27::408     5e-50  33%  515 aa  MIAB_RENSM RecName: Full=(Dimethylallyl)adenosine tRNA
    6::434     5e-50  34%  434 aa  MIAB_CAMFF RecName: Full=(Dimethylallyl)adenosine tRNA
    4::441     7e-50  32%  442 aa  MIAB_PSESM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     9e-50  33%  474 aa  MIAB_SERP5 RecName: Full=(Dimethylallyl)adenosine tRNA
   18::437     9e-50  31%  502 aa  MIAB_SALAI RecName: Full=(Dimethylallyl)adenosine tRNA
    3::448     9e-50  32%  450 aa  MIAB_RALEH RecName: Full=(Dimethylallyl)adenosine tRNA
   31::413     9e-50  32%  512 aa  MIAB_MYCTU RecName: Full=(Dimethylallyl)adenosine tRNA
   31::413     9e-50  32%  512 aa  MIAB_MYCTA RecName: Full=(Dimethylallyl)adenosine tRNA
   31::413     9e-50  32%  512 aa  MIAB_MYCBP RecName: Full=(Dimethylallyl)adenosine tRNA
   31::413     9e-50  32%  512 aa  MIAB_MYCBO RecName: Full=(Dimethylallyl)adenosine tRNA
   12::433     9e-50  29%  446 aa  MIAB_MICAN RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     9e-50  31%  447 aa  MIAB_LEGPL RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     9e-50  31%  447 aa  MIAB_LEGPH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     9e-50  31%  447 aa  MIAB_LEGPC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     9e-50  31%  447 aa  MIAB_LEGPA RecName: Full=(Dimethylallyl)adenosine tRNA
    6::435     9e-50  31%  437 aa  MIAB_DINSH RecName: Full=(Dimethylallyl)adenosine tRNA
    3::448     9e-50  32%  450 aa  MIAB_CUPTR RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-49  32%  474 aa  MIAB_SODGM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-49  31%  474 aa  MIAB_SHEWM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-49  32%  475 aa  MIAB_SHEHH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     1e-49  31%  452 aa  MIAB_RHOFD RecName: Full=(Dimethylallyl)adenosine tRNA
    4::441     1e-49  31%  442 aa  MIAB_PSEU2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     1e-49  30%  447 aa  MIAB_POLNA RecName: Full=(Dimethylallyl)adenosine tRNA
   11::399     1e-49  34%  503 aa  MIAB_NOCFA RecName: Full=(Dimethylallyl)adenosine tRNA
    8::391     1e-49  33%  442 aa  MIAB_WOLTR RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     2e-49  32%  451 aa  MIAB_MARMS RecName: Full=(Dimethylallyl)adenosine tRNA
    8::441     2e-49  32%  449 aa  MIAB_HYPNA RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-49  33%  474 aa  MIAB_ERWCT RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     2e-49  30%  449 aa  MIAB_ACIAC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::420     3e-49  32%  433 aa  MIAB_WOLSU RecName: Full=(Dimethylallyl)adenosine tRNA
    4::440     3e-49  30%  474 aa  MIAB_VIBVU RecName: Full=(Dimethylallyl)adenosine tRNA
   34::457     3e-49  31%  472 aa  MIAB_STRMK RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     3e-49  31%  474 aa  MIAB_SHESA RecName: Full=(Dimethylallyl)adenosine tRNA
    4::441     3e-49  32%  442 aa  MIAB_PSE14 RecName: Full=(Dimethylallyl)adenosine tRNA
    6::445     3e-49  31%  476 aa  MIAB_PROMH RecName: Full=(Dimethylallyl)adenosine tRNA
   30::453     3e-49  32%  471 aa  MIAB_NEOSM RecName: Full=(Dimethylallyl)adenosine tRNA
   11::438     3e-49  31%  441 aa  MIAB_GEOMG RecName: Full=(Dimethylallyl)adenosine tRNA
    4::440     3e-49  30%  474 aa  MIAB_VIBVY RecName: Full=(Dimethylallyl)adenosine tRNA
   34::457     3e-49  31%  472 aa  MIAB_STRM5 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     3e-49  32%  475 aa  MIAB_SHEPA RecName: Full=(Dimethylallyl)adenosine tRNA
    9::449     3e-49  31%  457 aa  MIAB_METPP RecName: Full=(Dimethylallyl)adenosine tRNA
    1::424     3e-49  33%  437 aa  MIAB_HELP2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-49  32%  474 aa  MIAB_SHESR RecName: Full=(Dimethylallyl)adenosine tRNA
   14::393     4e-49  33%  446 aa  MIAB_ERYLH RecName: Full=(Dimethylallyl)adenosine tRNA
    8::389     6e-49  32%  439 aa  MIAB_WOLPM RecName: Full=(Dimethylallyl)adenosine tRNA
   28::465     6e-49  31%  467 aa  MIAB_PROM4 RecName: Full=(Dimethylallyl)adenosine tRNA
   37::475     6e-49  31%  480 aa  MIAB_GLUDA RecName: Full=(Dimethylallyl)adenosine tRNA
   26::452     7e-49  32%  465 aa  MIAB_THET8 RecName: Full=(Dimethylallyl)adenosine tRNA
   26::452     7e-49  32%  465 aa  MIAB_THET2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     7e-49  31%  474 aa  MIAB_SHEFN RecName: Full=(Dimethylallyl)adenosine tRNA
    6::399     7e-49  31%  473 aa  MIAB_RHOPS RecName: Full=(Dimethylallyl)adenosine tRNA
    1::424     7e-49  33%  437 aa  MIAB_HELPJ RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-48  31%  474 aa  MIAB_SHEON RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     1e-48  30%  447 aa  MIAB_POLSJ RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-48  32%  477 aa  MIAB_ALTMD RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-48  32%  474 aa  MIAB_SHESM RecName: Full=(Dimethylallyl)adenosine tRNA
    6::452     1e-48  29%  468 aa  MIAB_RHOP2 RecName: Full=(Dimethylallyl)adenosine tRNA
    1::424     1e-48  32%  437 aa  MIAB_HELPH RecName: Full=(Dimethylallyl)adenosine tRNA
   20::411     2e-48  32%  506 aa  MIAB_STRGG RecName: Full=(Dimethylallyl)adenosine tRNA
    2::425     2e-48  33%  439 aa  MIAB_HELAH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-48  31%  477 aa  MIAB_AERS4 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-48  31%  474 aa  MIAB_SHEDO RecName: Full=(Dimethylallyl)adenosine tRNA
    3::448     2e-48  31%  450 aa  MIAB_RALME RecName: Full=(Dimethylallyl)adenosine tRNA
    3::448     2e-48  32%  450 aa  MIAB_RALEJ RecName: Full=(Dimethylallyl)adenosine tRNA
    8::438     2e-48  31%  439 aa  MIAB_BUCAI RecName: Full=(Dimethylallyl)adenosine tRNA
   32::411     2e-48  33%  497 aa  MIAB_ACIC1 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::389     3e-48  30%  446 aa  RIMO_ALKMQ RecName: Full=Ribosomal protein S12
    4::443     3e-48  31%  474 aa  MIAB_VIBCH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     3e-48  31%  474 aa  MIAB_VIBC3 RecName: Full=(Dimethylallyl)adenosine tRNA
    1::424     3e-48  32%  437 aa  MIAB_HELPY RecName: Full=(Dimethylallyl)adenosine tRNA
   34::409     3e-48  33%  522 aa  MIAB_ARTS2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::440     4e-48  30%  474 aa  MIAB_VIBPA RecName: Full=(Dimethylallyl)adenosine tRNA
   12::452     4e-48  31%  454 aa  MIAB_SACD2 RecName: Full=(Dimethylallyl)adenosine tRNA
   25::462     4e-48  32%  463 aa  MIAB_PROM9 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     4e-48  29%  446 aa  MIAB_PELUB RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-48  31%  474 aa  MIAB_ERWT9 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::438     4e-48  32%  439 aa  MIAB_COXBU RecName: Full=(Dimethylallyl)adenosine tRNA
    3::438     4e-48  32%  439 aa  MIAB_COXBR RecName: Full=(Dimethylallyl)adenosine tRNA
    3::438     4e-48  32%  439 aa  MIAB_COXB2 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::438     4e-48  32%  439 aa  MIAB_COXB1 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     4e-48  30%  477 aa  MIAB_AERHH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::441     5e-48  31%  442 aa  MIAB_PSEPF RecName: Full=(Dimethylallyl)adenosine tRNA
   30::405     5e-48  31%  535 aa  MIAB_LEIXX RecName: Full=(Dimethylallyl)adenosine tRNA
    1::424     5e-48  32%  437 aa  MIAB_HELPG RecName: Full=(Dimethylallyl)adenosine tRNA
    3::438     5e-48  32%  439 aa  MIAB_COXBN RecName: Full=(Dimethylallyl)adenosine tRNA
   28::465     6e-48  32%  475 aa  MIAB_BORPA RecName: Full=(Dimethylallyl)adenosine tRNA
   33::416     8e-48  31%  473 aa  MIAB_SYNS3 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::445     8e-48  33%  449 aa  MIAB_AZOSB RecName: Full=(Dimethylallyl)adenosine tRNA
    5::389     1e-47  30%  445 aa  RIMO_CLOPE RecName: Full=Ribosomal protein S12
    5::389     1e-47  30%  445 aa  RIMO_CLOP1 RecName: Full=Ribosomal protein S12
    4::441     1e-47  31%  442 aa  MIAB_PSEF5 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-47  32%  447 aa  MIAB_NITOC RecName: Full=(Dimethylallyl)adenosine tRNA
   20::413     1e-47  33%  525 aa  MIAB_MYCSS RecName: Full=(Dimethylallyl)adenosine tRNA
   24::417     1e-47  33%  529 aa  MIAB_MYCSK RecName: Full=(Dimethylallyl)adenosine tRNA
   10::417     1e-47  33%  438 aa  MIAB_HERA2 RecName: Full=(Dimethylallyl)adenosine tRNA
   11::439     1e-47  30%  446 aa  MIAB_GEOSL RecName: Full=(Dimethylallyl)adenosine tRNA
    5::389     1e-47  30%  445 aa  RIMO_CLOPS RecName: Full=Ribosomal protein S12
    4::440     1e-47  29%  474 aa  MIAB_VIBHB RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-47  31%  474 aa  MIAB_SHEB9 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     1e-47  31%  474 aa  MIAB_SHEB8 RecName: Full=(Dimethylallyl)adenosine tRNA
    8::454     1e-47  30%  475 aa  MIAB_OLICO RecName: Full=(Dimethylallyl)adenosine tRNA
   20::414     1e-47  33%  526 aa  MIAB_MYCSJ RecName: Full=(Dimethylallyl)adenosine tRNA
    3::443     1e-47  31%  451 aa  MIAB_BAUCH RecName: Full=(Dimethylallyl)adenosine tRNA
    3::431     2e-47  31%  431 aa  MIAB_SULNB RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-47  31%  474 aa  MIAB_SHEB5 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     2e-47  30%  443 aa  MIAB_NITEU RecName: Full=(Dimethylallyl)adenosine tRNA
   25::387     2e-47  33%  510 aa  MIAB_MYCVP RecName: Full=(Dimethylallyl)adenosine tRNA
    1::427     2e-47  32%  440 aa  RIMO_CLOPH RecName: Full=Ribosomal protein S12
    1::424     2e-47  32%  437 aa  MIAB_HELPS RecName: Full=(Dimethylallyl)adenosine tRNA
   14::394     2e-47  32%  450 aa  MIAB_ACICJ RecName: Full=(Dimethylallyl)adenosine tRNA
    4::429     3e-47  32%  447 aa  MIAB_PSEMY RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     3e-47  30%  442 aa  MIAB_FRATW RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     3e-47  30%  442 aa  MIAB_FRATT RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     3e-47  30%  442 aa  MIAB_FRATN RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     3e-47  30%  442 aa  MIAB_FRATM RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     3e-47  30%  442 aa  MIAB_FRAT1 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::433     4e-47  33%  446 aa  RIMO_CLOK5 RecName: Full=Ribosomal protein S12
   19::461     4e-47  29%  477 aa  MIAB_THICR RecName: Full=(Dimethylallyl)adenosine tRNA
   16::398     4e-47  30%  505 aa  MIAB_RHOSR RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     4e-47  30%  446 aa  MIAB_HAHCH RecName: Full=(Dimethylallyl)adenosine tRNA
    4::431     4e-47  33%  433 aa  MIAB_CAMC5 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::366     5e-47  31%  444 aa  RIMO_CLOTE RecName: Full=Ribosomal protein S12
   13::442     5e-47  31%  445 aa  MIAB_SOLUE RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     5e-47  31%  474 aa  MIAB_SHESW RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     5e-47  31%  474 aa  MIAB_SHEPC RecName: Full=(Dimethylallyl)adenosine tRNA
    3::388     5e-47  34%  480 aa  MIAB_OPITP RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     5e-47  29%  442 aa  MIAB_FRAP2 RecName: Full=(Dimethylallyl)adenosine tRNA
    3::441     5e-47  31%  445 aa  MIAB_AZOSE RecName: Full=(Dimethylallyl)adenosine tRNA
    4::440     7e-47  30%  474 aa  MIAB_VIBFM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::440     7e-47  30%  474 aa  MIAB_VIBF1 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     7e-47  29%  448 aa  MIAB_CHRSD RecName: Full=(Dimethylallyl)adenosine tRNA
    4::444     9e-47  32%  482 aa  MIAB_PSEHT RecName: Full=(Dimethylallyl)adenosine tRNA
    6::440     9e-47  29%  440 aa  MIAB_PELPD RecName: Full=(Dimethylallyl)adenosine tRNA
   16::399     1e-46  31%  460 aa  MIAB_SYNPX RecName: Full=(Dimethylallyl)adenosine tRNA
   45::492     1e-46  31%  497 aa  MIAB_PSYCK RecName: Full=(Dimethylallyl)adenosine tRNA
    4::424     1e-46  30%  437 aa  MIAB_PSEU5 RecName: Full=(Dimethylallyl)adenosine tRNA
   24::409     1e-46  31%  517 aa  MIAB_MYCLE RecName: Full=(Dimethylallyl)adenosine tRNA
   15::394     2e-46  34%  454 aa  RIMO_PROMS RecName: Full=Ribosomal protein S12
   15::394     2e-46  32%  454 aa  RIMO_PROM2 RecName: Full=Ribosomal protein S12
    4::443     2e-46  30%  474 aa  MIAB_PHOPR RecName: Full=(Dimethylallyl)adenosine tRNA
   14::435     2e-46  29%  450 aa  MIAB_PHEZH RecName: Full=(Dimethylallyl)adenosine tRNA
    3::443     2e-46  30%  473 aa  MIAB_PSYIN RecName: Full=(Dimethylallyl)adenosine tRNA
   15::394     3e-46  32%  454 aa  RIMO_PROM0 RecName: Full=Ribosomal protein S12
    9::425     3e-46  30%  438 aa  MIAB_MAGSA RecName: Full=(Dimethylallyl)adenosine tRNA
    4::415     3e-46  30%  446 aa  MIAB_PSEAE RecName: Full=(Dimethylallyl)adenosine tRNA
    4::415     3e-46  30%  446 aa  MIAB_PSEAB RecName: Full=(Dimethylallyl)adenosine tRNA
   25::413     3e-46  33%  510 aa  MIAB_KINRD RecName: Full=(Dimethylallyl)adenosine tRNA
    5::389     4e-46  32%  446 aa  RIMO_CLOBA RecName: Full=Ribosomal protein S12
    4::445     4e-46  30%  446 aa  MIAB_PSEA7 RecName: Full=(Dimethylallyl)adenosine tRNA
   47::478     4e-46  30%  505 aa  MIAB_DEIRA RecName: Full=(Dimethylallyl)adenosine tRNA
   14::398     4e-46  31%  449 aa  MIAB_AZOPC RecName: Full=(Dimethylallyl)adenosine tRNA
   11::445     8e-46  29%  452 aa  MIAB_SYNP6 RecName: Full=(Dimethylallyl)adenosine tRNA
   11::445     8e-46  29%  452 aa  MIAB_SYNE7 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     8e-46  29%  474 aa  MIAB_ALISL RecName: Full=(Dimethylallyl)adenosine tRNA
   17::396     1e-45  32%  466 aa  RIMO_SYNS9 RecName: Full=Ribosomal protein S12
   28::411     1e-45  31%  472 aa  MIAB_SYNS9 RecName: Full=(Dimethylallyl)adenosine tRNA
   22::459     1e-45  30%  474 aa  MIAB_HALHL RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     1e-45  30%  442 aa  MIAB_FRATO RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     1e-45  30%  442 aa  MIAB_FRATH RecName: Full=(Dimethylallyl)adenosine tRNA
    6::441     1e-45  30%  442 aa  MIAB_FRATF RecName: Full=(Dimethylallyl)adenosine tRNA
    4::431     1e-45  32%  433 aa  MIAB_CAMC1 RecName: Full=(Dimethylallyl)adenosine tRNA
   32::466     1e-45  28%  483 aa  MIAB_ACIBS RecName: Full=(Dimethylallyl)adenosine tRNA
    4::397     1e-45  30%  436 aa  RIMO_THETN RecName: Full=Ribosomal protein S12
   24::441     2e-45  31%  462 aa  RIMO_PROM4 RecName: Full=Ribosomal protein S12
   10::407     2e-45  32%  457 aa  RIMO_BDEBA RecName: Full=Ribosomal protein S12
   44::491     2e-45  31%  496 aa  MIAB_PSYA2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::443     2e-45  29%  479 aa  MIAB_IDILO RecName: Full=(Dimethylallyl)adenosine tRNA
    8::439     2e-45  28%  439 aa  MIAB_BUCAP RecName: Full=(Dimethylallyl)adenosine tRNA
   23::453     2e-45  28%  453 aa  MIAB_BDEBA RecName: Full=(Dimethylallyl)adenosine tRNA
   32::466     2e-45  28%  483 aa  MIAB_ACIBY RecName: Full=(Dimethylallyl)adenosine tRNA
   32::466     2e-45  28%  483 aa  MIAB_ACIBC RecName: Full=(Dimethylallyl)adenosine tRNA
   32::466     2e-45  28%  483 aa  MIAB_ACIB5 RecName: Full=(Dimethylallyl)adenosine tRNA
   32::466     2e-45  28%  483 aa  MIAB_ACIB3 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::397     2e-45  31%  436 aa  RIMO_THEPX RecName: Full=Ribosomal protein S12
   30::417     2e-45  33%  475 aa  MIAB_GLUOX RecName: Full=(Dimethylallyl)adenosine tRNA
   35::414     2e-45  32%  484 aa  MIAB_BIFLI RecName: Full=(Dimethylallyl)adenosine tRNA
   32::466     2e-45  30%  483 aa  MIAB_ACIAD RecName: Full=(Dimethylallyl)adenosine tRNA
    3::399     3e-45  32%  444 aa  RIMO_PELTS RecName: Full=Ribosomal protein S12
   37::479     3e-45  30%  484 aa  MIAB_XANOR RecName: Full=(Dimethylallyl)adenosine tRNA
    1::399     3e-45  30%  451 aa  MIAB_TREDE RecName: Full=(Dimethylallyl)adenosine tRNA
   19::438     3e-45  29%  451 aa  MIAB_CHLT3 RecName: Full=(Dimethylallyl)adenosine tRNA
   15::394     4e-45  35%  454 aa  RIMO_PROMP RecName: Full=Ribosomal protein S12
   37::479     4e-45  29%  484 aa  MIAB_XANC5 RecName: Full=(Dimethylallyl)adenosine tRNA
   37::479     4e-45  29%  484 aa  MIAB_XANAC RecName: Full=(Dimethylallyl)adenosine tRNA
   24::451     4e-45  30%  464 aa  MIAB_SYNSC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::439     4e-45  30%  458 aa  MIAB_METCA RecName: Full=(Dimethylallyl)adenosine tRNA
   13::442     4e-45  29%  449 aa  MIAB_CHLCH RecName: Full=(Dimethylallyl)adenosine tRNA
   19::455     4e-45  28%  455 aa  MIAB_BACTN RecName: Full=(Dimethylallyl)adenosine tRNA
    4::397     5e-45  30%  436 aa  RIMO_THEP3 RecName: Full=Ribosomal protein S12
   15::394     5e-45  35%  454 aa  RIMO_PROM9 RecName: Full=Ribosomal protein S12
    5::433     5e-45  33%  433 aa  MIAB_CAMJ8 RecName: Full=(Dimethylallyl)adenosine tRNA
   31::410     5e-45  32%  480 aa  MIAB_BIFLO RecName: Full=(Dimethylallyl)adenosine tRNA
   35::414     5e-45  32%  484 aa  MIAB_BIFLD RecName: Full=(Dimethylallyl)adenosine tRNA
   12::427     6e-45  35%  427 aa  Y867_METJA RecName: Full=Putative methylthiotransferase MJ0867;    
   32::407     6e-45  33%  476 aa  MIAB_ROSS1 RecName: Full=(Dimethylallyl)adenosine tRNA
   35::481     6e-45  30%  510 aa  MIAB_BEII9 RecName: Full=(Dimethylallyl)adenosine tRNA
    8::440     6e-45  31%  451 aa  MIAB_ACIF5 RecName: Full=(Dimethylallyl)adenosine tRNA
    8::440     6e-45  31%  451 aa  MIAB_ACIF2 RecName: Full=(Dimethylallyl)adenosine tRNA
    7::368     8e-45  33%  447 aa  RIMO_GEOSL RecName: Full=Ribosomal protein S12
    5::386     8e-45  31%  444 aa  RIMO_CLONN RecName: Full=Ribosomal protein S12
   10::451     8e-45  29%  456 aa  MIAB_CELJU RecName: Full=(Dimethylallyl)adenosine tRNA
    3::413     1e-44  29%  418 aa  Y285_HELPY RecName: Full=Putative methylthiotransferase HP_0285;   
   37::479     1e-44  30%  484 aa  MIAB_XANOP RecName: Full=(Dimethylallyl)adenosine tRNA
   37::479     1e-44  29%  484 aa  MIAB_XANOM RecName: Full=(Dimethylallyl)adenosine tRNA
    9::370     1e-44  31%  450 aa  MIAB_THEEB RecName: Full=(Dimethylallyl)adenosine tRNA
   17::402     1e-44  30%  453 aa  MIAB_SPHWW RecName: Full=(Dimethylallyl)adenosine tRNA
   41::430     1e-44  31%  493 aa  MIAB_GRABC RecName: Full=(Dimethylallyl)adenosine tRNA
   10::389     1e-44  31%  497 aa  MIAB_FRAAA RecName: Full=(Dimethylallyl)adenosine tRNA
    5::433     1e-44  33%  433 aa  MIAB_CAMJJ RecName: Full=(Dimethylallyl)adenosine tRNA
    5::433     1e-44  33%  433 aa  MIAB_CAMJE RecName: Full=(Dimethylallyl)adenosine tRNA
    3::413     1e-44  30%  418 aa  Y285_HELPJ RecName: Full=Putative methylthiotransferase jhp_0270;  
    7::386     1e-44  30%  441 aa  RIMO_TRIEI RecName: Full=Ribosomal protein S12
    4::399     1e-44  30%  444 aa  RIMO_DESRM RecName: Full=Ribosomal protein S12
    1::391     1e-44  30%  438 aa  RIMO_ALKOO RecName: Full=Ribosomal protein S12
    4::437     1e-44  29%  450 aa  MIAB_VEREI RecName: Full=(Dimethylallyl)adenosine tRNA
    5::433     1e-44  32%  433 aa  MIAB_CAMJD RecName: Full=(Dimethylallyl)adenosine tRNA
    1::437     2e-44  32%  447 aa  MIAB_METS4 RecName: Full=(Dimethylallyl)adenosine tRNA
    1::441     2e-44  30%  446 aa  MIAB_METPB RecName: Full=(Dimethylallyl)adenosine tRNA
   19::455     2e-44  29%  456 aa  MIAB_BACV8 RecName: Full=(Dimethylallyl)adenosine tRNA
   19::455     2e-44  28%  457 aa  MIAB_BACFR RecName: Full=(Dimethylallyl)adenosine tRNA
   19::455     2e-44  28%  457 aa  MIAB_BACFN RecName: Full=(Dimethylallyl)adenosine tRNA
   24::359     2e-44  34%  460 aa  MIAB_ANADF RecName: Full=(Dimethylallyl)adenosine tRNA
    4::448     2e-44  29%  453 aa  RIMO_CLOTH RecName: Full=Ribosomal protein S12
    5::389     2e-44  32%  446 aa  RIMO_CLOBB RecName: Full=Ribosomal protein S12
   25::394     2e-44  31%  463 aa  MIAB_PROM1 RecName: Full=(Dimethylallyl)adenosine tRNA
    1::426     2e-44  30%  446 aa  MIAB_METC4 RecName: Full=(Dimethylallyl)adenosine tRNA
   25::475     2e-44  28%  481 aa  MIAB_FLAJ1 RecName: Full=(Dimethylallyl)adenosine tRNA
   16::444     2e-44  31%  444 aa  MIAB_CHLTE RecName: Full=(Dimethylallyl)adenosine tRNA
   18::395     3e-44  31%  443 aa  MIAB_NOVAD RecName: Full=(Dimethylallyl)adenosine tRNA
   73::418     3e-44  32%  715 aa  MIAB_MYCA1 RecName: Full=(Dimethylallyl)adenosine tRNA
    8::436     3e-44  30%  437 aa  MIAB_MAGSM RecName: Full=(Dimethylallyl)adenosine tRNA
   10::416     3e-44  31%  540 aa  MIAB_FRASC RecName: Full=(Dimethylallyl)adenosine tRNA
   25::475     3e-44  29%  481 aa  MIAB_FLAPJ RecName: Full=(Dimethylallyl)adenosine tRNA
    5::433     3e-44  32%  433 aa  MIAB_CAMJR RecName: Full=(Dimethylallyl)adenosine tRNA
   28::465     3e-44  30%  475 aa  MIAB_BORBR RecName: Full=(Dimethylallyl)adenosine tRNA
   14::397     4e-44  31%  454 aa  MIAB_SYNPW RecName: Full=(Dimethylallyl)adenosine tRNA
   33::434     7e-44  27%  477 aa  RIMO_RHOBA RecName: Full=Ribosomal protein S12
   73::418     7e-44  32%  517 aa  MIAB_MYCPA RecName: Full=(Dimethylallyl)adenosine tRNA
    8::400     7e-44  32%  418 aa  MIAB_DEHE1 RecName: Full=(Dimethylallyl)adenosine tRNA
    5::437     7e-44  30%  447 aa  MIAB_BORPE RecName: Full=(Dimethylallyl)adenosine tRNA
    2::393     9e-44  32%  425 aa  Y1729_PYRAB RecName: Full=Putative methylthiotransferase
   25::394     9e-44  31%  463 aa  MIAB_PROMT RecName: Full=(Dimethylallyl)adenosine tRNA
   10::389     9e-44  31%  494 aa  MIAB_FRASN RecName: Full=(Dimethylallyl)adenosine tRNA
    1::382     1e-43  30%  430 aa  RIMO_THELT RecName: Full=Ribosomal protein S12
   20::398     2e-43  31%  468 aa  RIMO_SYNPW RecName: Full=Ribosomal protein S12
    8::423     2e-43  29%  462 aa  MIAB_MYXXD RecName: Full=(Dimethylallyl)adenosine tRNA
    7::437     2e-43  30%  440 aa  RIMO_ANAVT RecName: Full=Ribosomal protein S12
   16::394     3e-43  31%  464 aa  RIMO_SYNPX RecName: Full=Ribosomal protein S12
    4::450     3e-43  30%  466 aa  MIAB_RHOCS RecName: Full=(Dimethylallyl)adenosine tRNA
    9::438     3e-43  28%  443 aa  MIAB_CHLP8 RecName: Full=(Dimethylallyl)adenosine tRNA
   39::478     4e-43  28%  481 aa  MIAB_CYTH3 RecName: Full=(Dimethylallyl)adenosine tRNA
   33::363     4e-43  34%  464 aa  MIAB_ANASK RecName: Full=(Dimethylallyl)adenosine tRNA
    8::368     5e-43  31%  448 aa  RIMO_GEOUR RecName: Full=Ribosomal protein S12
   15::394     6e-43  35%  454 aa  RIMO_PROM5 RecName: Full=Ribosomal protein S12
   24::402     6e-43  31%  472 aa  RIMO_PROM3 RecName: Full=Ribosomal protein S12
    2::381     6e-43  34%  440 aa  RIMO_CALS8 RecName: Full=Ribosomal protein S12
   13::392     6e-43  31%  448 aa  MIAB_PROVI RecName: Full=(Dimethylallyl)adenosine tRNA
    4::447     6e-43  29%  448 aa  MIAB_MARAV RecName: Full=(Dimethylallyl)adenosine tRNA
    7::437     8e-43  29%  440 aa  RIMO_ANASP RecName: Full=Ribosomal protein S12
    8::448     8e-43  31%  456 aa  MIAB_DICNV RecName: Full=(Dimethylallyl)adenosine tRNA
    8::400     8e-43  30%  418 aa  MIAB_DEHSB RecName: Full=(Dimethylallyl)adenosine tRNA
   10::388     1e-42  30%  458 aa  RIMO_SYNSC RecName: Full=Ribosomal protein S12
    2::417     1e-42  31%  432 aa  RIMO_MOOTA RecName: Full=Ribosomal protein S12
    8::400     1e-42  30%  418 aa  MIAB_DEHSC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     2e-42  30%  445 aa  RIMO_CLOAB RecName: Full=Ribosomal protein S12
   19::457     2e-42  27%  463 aa  MIAB_PORGI RecName: Full=(Dimethylallyl)adenosine tRNA
    1::439     2e-42  29%  445 aa  MIAB_METRJ RecName: Full=(Dimethylallyl)adenosine tRNA
   33::471     2e-42  29%  480 aa  MIAB_BORPD RecName: Full=(Dimethylallyl)adenosine tRNA
    7::437     3e-42  29%  437 aa  RIMO_MICAN RecName: Full=Ribosomal protein S12
    4::366     3e-42  30%  445 aa  RIMO_GEOMG RecName: Full=Ribosomal protein S12
    3::387     3e-42  29%  440 aa  RIMO_DICT6 RecName: Full=Ribosomal protein S12
    7::436     3e-42  29%  438 aa  RIMO_CYAP7 RecName: Full=Ribosomal protein S12
    7::386     5e-42  31%  443 aa  RIMO_SYNY3 RecName: Full=Ribosomal protein S12
   22::400     5e-42  31%  470 aa  RIMO_SYNS3 RecName: Full=Ribosomal protein S12
    1::427     7e-42  29%  444 aa  RIMO_NATTJ RecName: Full=Ribosomal protein S12
    1::406     7e-42  31%  459 aa  MIAB_DEIGD RecName: Full=(Dimethylallyl)adenosine tRNA
    1::451     9e-42  26%  456 aa  MIAB_TREPS RecName: Full=(Dimethylallyl)adenosine tRNA
    1::451     9e-42  26%  456 aa  MIAB_TREPA RecName: Full=(Dimethylallyl)adenosine tRNA
   24::402     1e-41  31%  472 aa  RIMO_PROMM RecName: Full=Ribosomal protein S12
   24::447     1e-41  29%  465 aa  RIMO_CLOB8 RecName: Full=Ribosomal protein S12
   19::457     1e-41  27%  465 aa  MIAB_PORG3 RecName: Full=(Dimethylallyl)adenosine tRNA
    8::427     1e-41  30%  429 aa  MIAB_CAMHC RecName: Full=(Dimethylallyl)adenosine tRNA
   13::404     1e-41  28%  440 aa  MIAB_PELPB RecName: Full=(Dimethylallyl)adenosine tRNA
   28::363     2e-41  33%  464 aa  MIAB_ANADE RecName: Full=(Dimethylallyl)adenosine tRNA
    7::386     3e-41  29%  439 aa  RIMO_SYNP2 RecName: Full=Ribosomal protein S12
   43::446     3e-41  28%  503 aa  MIAB_SALRD RecName: Full=(Dimethylallyl)adenosine tRNA
    9::417     4e-41  31%  484 aa  RIMO_SACEN RecName: Full=Ribosomal protein S12
    7::386     4e-41  29%  439 aa  RIMO_NOSP7 RecName: Full=Ribosomal protein S12
   19::414     6e-41  33%  485 aa  RIMO_SYMTH RecName: Full=Ribosomal protein S12
    7::386     7e-41  29%  437 aa  RIMO_CYAA5 RecName: Full=Ribosomal protein S12
    5::394     7e-41  29%  467 aa  MIAB_RHORT RecName: Full=(Dimethylallyl)adenosine tRNA
    7::437     1e-40  28%  452 aa  RIMO_SYNE7 RecName: Full=Ribosomal protein S12
   28::437     1e-40  29%  466 aa  MIAB_CHLAA RecName: Full=(Dimethylallyl)adenosine tRNA
    7::437     1e-40  28%  452 aa  RIMO_SYNP6 RecName: Full=Ribosomal protein S12
    8::400     1e-40  30%  448 aa  RIMO_GEOBB RecName: Full=Ribosomal protein S12
    4::439     1e-40  27%  442 aa  MIAB_VESOH RecName: Full=(Dimethylallyl)adenosine tRNA
   43::483     1e-40  29%  486 aa  MIAB_AMOA5 RecName: Full=(Dimethylallyl)adenosine tRNA
    7::386     2e-40  30%  449 aa  RIMO_CYAP8 RecName: Full=Ribosomal protein S12
    1::436     2e-40  29%  438 aa  RIMO_CARHZ RecName: Full=Ribosomal protein S12
    3::377     2e-40  30%  434 aa  RIMO_PROMA RecName: Full=Ribosomal protein S12
   19::402     2e-40  29%  448 aa  RIMO_LEPBP RecName: Full=Ribosomal protein S12
   19::402     2e-40  29%  448 aa  RIMO_LEPBA RecName: Full=Ribosomal protein S12
   32::411     4e-40  30%  473 aa  RIMO_SYNJB RecName: Full=Ribosomal protein S12
   18::412     4e-40  29%  460 aa  RIMO_HELMI RecName: Full=Ribosomal protein S12
    4::427     4e-40  31%  445 aa  RIMO_CLOBM RecName: Full=Ribosomal protein S12
   39::420     5e-40  29%  487 aa  RIMO_MAGSM RecName: Full=Ribosomal protein S12
    4::427     5e-40  30%  445 aa  RIMO_CLOBL RecName: Full=Ribosomal protein S12
    4::385     6e-40  28%  439 aa  RIMO_LEPBL RecName: Full=Ribosomal protein S12
   49::494     6e-40  30%  497 aa  MIAB_XYLFT RecName: Full=(Dimethylallyl)adenosine tRNA
   49::494     6e-40  30%  497 aa  MIAB_XYLF2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::427     8e-40  30%  445 aa  RIMO_CLOBH RecName: Full=Ribosomal protein S12
    4::427     8e-40  30%  445 aa  RIMO_CLOB1 RecName: Full=Ribosomal protein S12
   12::366     8e-40  30%  442 aa  MIAB_CHLPD RecName: Full=(Dimethylallyl)adenosine tRNA
   15::352     8e-40  31%  447 aa  MIAB_CHLPB RecName: Full=(Dimethylallyl)adenosine tRNA
    2::393     1e-39  31%  425 aa  Y1875_PYRHO RecName: Full=Putative methylthiotransferase PH1875;   
    7::393     1e-39  31%  439 aa  RIMO_HAHCH RecName: Full=Ribosomal protein S12
    4::427     1e-39  30%  445 aa  RIMO_CLOBK RecName: Full=Ribosomal protein S12
    1::408     1e-39  30%  432 aa  RIMO_AQUAE RecName: Full=Ribosomal protein S12
   49::494     1e-39  29%  497 aa  MIAB_XYLFM RecName: Full=(Dimethylallyl)adenosine tRNA
    4::398     1e-39  28%  441 aa  MIAB_PROA2 RecName: Full=(Dimethylallyl)adenosine tRNA
    8::400     1e-39  28%  449 aa  RIMO_GEOLS RecName: Full=Ribosomal protein S12
   11::403     2e-39  27%  455 aa  RIMO_PELCD RecName: Full=Ribosomal protein S12
    4::427     2e-39  29%  437 aa  RIMO_LEPIN RecName: Full=Ribosomal protein S12
    1::398     2e-39  30%  455 aa  RIMO_CHLAA RecName: Full=Ribosomal protein S12
    7::395     2e-39  28%  443 aa  RIMO_ACAM1 RecName: Full=Ribosomal protein S12
    9::383     3e-39  32%  441 aa  RIMO_KLEP7 RecName: Full=Ribosomal protein S12
    9::383     3e-39  32%  441 aa  RIMO_KLEP3 RecName: Full=Ribosomal protein S12
    4::385     4e-39  28%  439 aa  RIMO_LEPBJ RecName: Full=Ribosomal protein S12
   11::424     4e-39  27%  446 aa  MIAB_PELLD RecName: Full=(Dimethylallyl)adenosine tRNA
   40::419     5e-39  28%  487 aa  RIMO_SYNR3 RecName: Full=Ribosomal protein S12
    5::384     5e-39  28%  437 aa  RIMO_GLOVI RecName: Full=Ribosomal protein S12
   12::366     5e-39  29%  442 aa  MIAB_CHLL2 RecName: Full=(Dimethylallyl)adenosine tRNA
    4::385     7e-39  27%  437 aa  RIMO_LEPIC RecName: Full=Ribosomal protein S12
    4::430     9e-39  30%  431 aa  RIMO_FERNB RecName: Full=Ribosomal protein S12
   10::436     9e-39  29%  437 aa  RIMO_CYTH3 RecName: Full=Ribosomal protein S12
    9::395     1e-38  32%  442 aa  RIMO_AERS4 RecName: Full=Ribosomal protein S12
   49::494     1e-38  29%  497 aa  MIAB_XYLFA RecName: Full=(Dimethylallyl)adenosine tRNA
   61::475     1e-38  28%  553 aa  CDKAL_XENTR RecName: Full=CDK5 regulatory subunit-associated
   19::398     2e-38  29%  460 aa  RIMO_SYNJA RecName: Full=Ribosomal protein S12
    4::398     3e-38  30%  424 aa  Y826_METTH RecName: Full=Putative methylthiotransferase MTH_826;   
    9::395     3e-38  32%  443 aa  RIMO_PROMH RecName: Full=Ribosomal protein S12
    9::393     3e-38  31%  441 aa  RIMO_CITK8 RecName: Full=Ribosomal protein S12
   60::474     3e-38  28%  547 aa  CDKAL_DANRE RecName: Full=CDK5 regulatory subunit-associated
    1::376     4e-38  26%  439 aa  RIMO_SYNWW RecName: Full=Ribosomal protein S12
    9::395     4e-38  33%  442 aa  RIMO_AERHH RecName: Full=Ribosomal protein S12
    3::443     4e-38  26%  444 aa  MIAB_RUTMC RecName: Full=(Dimethylallyl)adenosine tRNA
    4::428     4e-38  29%  445 aa  MIAB_ALCBS RecName: Full=(Dimethylallyl)adenosine tRNA
   61::475     4e-38  28%  556 aa  CDKAL_XENLA RecName: Full=CDK5 regulatory subunit-associated
   37::389     6e-38  29%  475 aa  RIMO_PARUW RecName: Full=Ribosomal protein S12
    1::343     8e-38  31%  430 aa  RIMO_THESQ RecName: Full=Ribosomal protein S12
    1::343     8e-38  31%  430 aa  RIMO_THEMA RecName: Full=Ribosomal protein S12
    1::343     1e-37  31%  430 aa  RIMO_THEP1 RecName: Full=Ribosomal protein S12
   35::421     1e-37  29%  469 aa  RIMO_VIBVY RecName: Full=Ribosomal protein S12
    8::348     1e-37  29%  425 aa  RIMO_THEYD RecName: Full=Ribosomal protein S12
    8::400     1e-37  29%  450 aa  RIMO_PELPD RecName: Full=Ribosomal protein S12
    9::395     2e-37  30%  441 aa  RIMO_ESCF3 RecName: Full=Ribosomal protein S12
    3::434     2e-37  28%  435 aa  RIMO_PETMO RecName: Full=Ribosomal protein S12
   73::499     2e-37  32%  553 aa  CDKAL_DROPS RecName: Full=CDKAL1-like protein;
    8::425     3e-37  30%  427 aa  RIMO_THEM4 RecName: Full=Ribosomal protein S12
    1::413     3e-37  31%  469 aa  RIMO_HERA2 RecName: Full=Ribosomal protein S12
   10::378     3e-37  29%  432 aa  RIMO_BACFR RecName: Full=Ribosomal protein S12
   10::378     3e-37  29%  432 aa  RIMO_BACFN RecName: Full=Ribosomal protein S12
    7::432     4e-37  30%  493 aa  RIMO_STRCO RecName: Full=Ribosomal protein S12
    2::411     4e-37  30%  471 aa  RIMO_OPITP RecName: Full=Ribosomal protein S12
    4::377     5e-37  29%  439 aa  RIMO_WOLSU RecName: Full=Ribosomal protein S12
   35::421     5e-37  29%  469 aa  RIMO_VIBVU RecName: Full=Ribosomal protein S12
   10::381     5e-37  29%  450 aa  RIMO_GRAFK RecName: Full=Ribosomal protein S12
   10::420     5e-37  29%  433 aa  RIMO_FLAPJ RecName: Full=Ribosomal protein S12
   65::479     5e-37  28%  579 aa  CDKAL_HUMAN RecName: Full=CDK5 regulatory subunit-associated
    9::378     6e-37  31%  441 aa  RIMO_SALPB RecName: Full=Ribosomal protein S12
  108::519     6e-37  29%  607 aa  CK5P1_DICDI RecName: Full=CDK5RAP1-like protein;
   72::499     6e-37  31%  552 aa  CDKAL_DROME RecName: Full=CDKAL1-like protein;
    8::388     1e-36  27%  446 aa  RIMO_THEEB RecName: Full=Ribosomal protein S12
    9::378     1e-36  30%  441 aa  RIMO_SALTI RecName: Full=Ribosomal protein S12
   10::396     1e-36  29%  442 aa  RIMO_ERWCT RecName: Full=Ribosomal protein S12
    1::419     1e-36  27%  424 aa  Y1247_ARCFU RecName: Full=Putative methylthiotransferase AF_1247;  
    9::378     1e-36  31%  441 aa  RIMO_SHIBS RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_SHIB3 RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECOSM RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECOSE RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECOLU RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECOLI RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECOLC RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECOHS RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECODH RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECO8A RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECO7I RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECO5E RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECO57 RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECO55 RecName: Full=Ribosomal protein S12
    9::378     1e-36  31%  441 aa  RIMO_ECO24 RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALTY RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALSV RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALPK RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALPA RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALNS RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALEP RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALDC RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALCH RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALAR RecName: Full=Ribosomal protein S12
    9::378     2e-36  30%  441 aa  RIMO_SALA4 RecName: Full=Ribosomal protein S12
   34::420     2e-36  29%  473 aa  RIMO_PSEA6 RecName: Full=Ribosomal protein S12
    8::441     2e-36  28%  481 aa  RIMO_PROAC RecName: Full=Ribosomal protein S12
    8::393     2e-36  31%  453 aa  RIMO_THICR RecName: Full=Ribosomal protein S12
    9::378     2e-36  31%  441 aa  RIMO_ENTS8 RecName: Full=Ribosomal protein S12
   64::478     2e-36  28%  578 aa  CDKAL_MOUSE RecName: Full=CDK5 regulatory subunit-associated
    9::378     3e-36  30%  441 aa  RIMO_SALHS RecName: Full=Ribosomal protein S12
    9::378     3e-36  30%  441 aa  RIMO_SALG2 RecName: Full=Ribosomal protein S12
    9::378     3e-36  31%  441 aa  RIMO_ECOUT RecName: Full=Ribosomal protein S12
    9::378     3e-36  31%  441 aa  RIMO_ECOL6 RecName: Full=Ribosomal protein S12
    9::378     3e-36  31%  441 aa  RIMO_ECOL5 RecName: Full=Ribosomal protein S12
    9::378     3e-36  31%  441 aa  RIMO_ECOK1 RecName: Full=Ribosomal protein S12
    9::378     3e-36  31%  441 aa  RIMO_ECO81 RecName: Full=Ribosomal protein S12
    9::378     3e-36  31%  441 aa  RIMO_ECO45 RecName: Full=Ribosomal protein S12
   34::420     5e-36  28%  470 aa  RIMO_VIBCH RecName: Full=Ribosomal protein S12
    9::378     5e-36  30%  441 aa  RIMO_SHIFL RecName: Full=Ribosomal protein S12
    9::378     7e-36  30%  441 aa  RIMO_SHISS RecName: Full=Ribosomal protein S12
    9::378     7e-36  30%  441 aa  RIMO_SHIF8 RecName: Full=Ribosomal protein S12
    5::378     9e-36  32%  436 aa  RIMO_BACTN RecName: Full=Ribosomal protein S12
   34::420     1e-35  28%  470 aa  RIMO_VIBC3 RecName: Full=Ribosomal protein S12
   13::397     1e-35  31%  443 aa  RIMO_THIDA RecName: Full=Ribosomal protein S12
    8::400     1e-35  27%  445 aa  RIMO_METI4 RecName: Full=Ribosomal protein S12
    6::390     1e-35  28%  439 aa  RIMO_FRAP2 RecName: Full=Ribosomal protein S12
   17::397     1e-35  27%  460 aa  RIMO_CHLCV RecName: Full=Ribosomal protein S12
   20::453     1e-35  32%  504 aa  RIMO_ACIBL RecName: Full=Ribosomal protein S12
   17::397     2e-35  28%  460 aa  RIMO_CHLAB RecName: Full=Ribosomal protein S12
    6::428     2e-35  25%  439 aa  RIMO_SULNB RecName: Full=Ribosomal protein S12
    1::423     3e-35  30%  443 aa  RIMO_DESPS RecName: Full=Ribosomal protein S12
    5::385     3e-35  31%  447 aa  RIMO_ACIBT RecName: Full=Ribosomal protein S12
    5::385     3e-35  31%  447 aa  RIMO_ACIBS RecName: Full=Ribosomal protein S12
    5::385     3e-35  31%  447 aa  RIMO_ACIBC RecName: Full=Ribosomal protein S12
    5::385     3e-35  30%  447 aa  RIMO_ACIAD RecName: Full=Ribosomal protein S12
    4::380     4e-35  29%  430 aa  RIMO_SULSY RecName: Full=Ribosomal protein S12
    9::397     4e-35  30%  443 aa  RIMO_PSEE4 RecName: Full=Ribosomal protein S12
   11::393     4e-35  28%  450 aa  RIMO_DESAP RecName: Full=Ribosomal protein S12
   98::490     4e-35  28%  586 aa  CK5P1_RAT RecName: Full=CDK5 regulatory subunit-associated protein
    3::393     5e-35  28%  434 aa  RIMO_THET8 RecName: Full=Ribosomal protein S12
    8::425     5e-35  33%  427 aa  RIMO_THEAB RecName: Full=Ribosomal protein S12
   14::431     5e-35  27%  480 aa  RIMO_NOCSJ RecName: Full=Ribosomal protein S12
    1::435     5e-35  29%  462 aa  MIAB_HELHP RecName: Full=(Dimethylallyl)adenosine tRNA
  100::492     5e-35  28%  588 aa  CK5P1_MOUSE RecName: Full=CDK5 regulatory subunit-associated
    9::397     6e-35  30%  443 aa  RIMO_PSEPK RecName: Full=Ribosomal protein S12
    9::397     6e-35  30%  443 aa  RIMO_PSEP1 RecName: Full=Ribosomal protein S12
    6::390     6e-35  28%  439 aa  RIMO_FRATN RecName: Full=Ribosomal protein S12
   17::397     6e-35  27%  460 aa  RIMO_CHLFF RecName: Full=Ribosomal protein S12
    3::336     6e-35  28%  439 aa  RIMO_CAMJJ RecName: Full=Ribosomal protein S12
    4::389     6e-35  28%  469 aa  RIMO_ANASK RecName: Full=Ribosomal protein S12
    9::397     8e-35  30%  443 aa  RIMO_PSEPW RecName: Full=Ribosomal protein S12
    3::336     8e-35  28%  439 aa  RIMO_CAMJR RecName: Full=Ribosomal protein S12
    3::336     8e-35  28%  439 aa  RIMO_CAMJ8 RecName: Full=Ribosomal protein S12
   81::542     8e-35  27%  547 aa  CK5P1_CAEEL RecName: Full=CDK5RAP1-like protein;
    6::392     1e-34  28%  453 aa  RIMO_SYNAS RecName: Full=Ribosomal protein S12
   10::424     1e-34  27%  437 aa  RIMO_FLAJ1 RecName: Full=Ribosomal protein S12
    3::424     1e-34  29%  433 aa  RIMO_CAMHC RecName: Full=Ribosomal protein S12
    5::385     1e-34  31%  447 aa  RIMO_ACIBY RecName: Full=Ribosomal protein S12
    5::385     1e-34  31%  447 aa  RIMO_ACIB3 RecName: Full=Ribosomal protein S12
    9::397     1e-34  30%  443 aa  RIMO_PSEPG RecName: Full=Ribosomal protein S12
    3::336     1e-34  28%  439 aa  RIMO_CAMJD RecName: Full=Ribosomal protein S12
    3::430     2e-34  29%  430 aa  RIMO_ELUMP RecName: Full=Ribosomal protein S12
    3::336     2e-34  28%  439 aa  RIMO_CAMJE RecName: Full=Ribosomal protein S12
    7::429     2e-34  29%  495 aa  RIMO_STRAW RecName: Full=Ribosomal protein S12
    8::396     2e-34  30%  446 aa  RIMO_PASMU RecName: Full=Ribosomal protein S12
    5::390     2e-34  28%  432 aa  RIMO_PARD8 RecName: Full=Ribosomal protein S12
   13::391     2e-34  25%  448 aa  RIMO_HELHP RecName: Full=Ribosomal protein S12
    5::385     2e-34  31%  447 aa  RIMO_ACIB5 RecName: Full=Ribosomal protein S12
    7::386     3e-34  28%  443 aa  RIMO_ACTP7 RecName: Full=Ribosomal protein S12
   12::451     3e-34  25%  453 aa  MIAB_SULMW RecName: Full=(Dimethylallyl)adenosine tRNA
    7::386     4e-34  28%  443 aa  RIMO_ACTPJ RecName: Full=Ribosomal protein S12
   94::507     4e-34  32%  600 aa  CK5P1_ORYSJ RecName: Full=CDK5RAP1-like protein;
    5::392     5e-34  27%  488 aa  RIMO_SORC5 RecName: Full=Ribosomal protein S12
    6::347     5e-34  29%  431 aa  RIMO_FRATO RecName: Full=Ribosomal protein S12
    6::347     5e-34  29%  431 aa  RIMO_FRATF RecName: Full=Ribosomal protein S12
   93::526     5e-34  27%  583 aa  CK5P1_DROME RecName: Full=CDK5RAP1-like protein;
  130::550     7e-34  28%  640 aa  CK5P1_ARATH RecName: Full=CDK5RAP1-like protein;
    7::386     9e-34  28%  443 aa  RIMO_ACTP2 RecName: Full=Ribosomal protein S12
    4::94      1e-33  35%  482 aa  Y269_TREPA RecName: Full=Putative methylthiotransferase TP_0269;   
    1::381     1e-33  29%  465 aa  RIMO_SOLUE RecName: Full=Ribosomal protein S12
    7::443     1e-33  28%  443 aa  RIMO_HAES2 RecName: Full=Ribosomal protein S12
    7::443     1e-33  28%  443 aa  RIMO_HAES1 RecName: Full=Ribosomal protein S12
    3::393     1e-33  28%  434 aa  RIMO_THET2 RecName: Full=Ribosomal protein S12
   34::420     3e-33  26%  472 aa  RIMO_SHEPC RecName: Full=Ribosomal protein S12
   83::469     3e-33  28%  525 aa  RIMO_PSYA2 RecName: Full=Ribosomal protein S12
   22::409     3e-33  30%  455 aa  RIMO_MARAV RecName: Full=Ribosomal protein S12
    6::397     3e-33  31%  438 aa  RIMO_CHRVO RecName: Full=Ribosomal protein S12
    8::433     3e-33  28%  436 aa  RIMO_CAMFF RecName: Full=Ribosomal protein S12
  101::507     3e-33  27%  601 aa  CK5P1_HUMAN RecName: Full=CDK5 regulatory subunit-associated
   34::420     3e-33  26%  472 aa  RIMO_SHESW RecName: Full=Ribosomal protein S12
    4::384     3e-33  28%  435 aa  RIMO_NITSB RecName: Full=Ribosomal protein S12
   10::380     3e-33  30%  432 aa  RIMO_BACV8 RecName: Full=Ribosomal protein S12
   68::459     4e-33  30%  524 aa  RIMO_PSYWF RecName: Full=Ribosomal protein S12
   11::399     4e-33  29%  445 aa  RIMO_PSEPF RecName: Full=Ribosomal protein S12
   11::388     4e-33  30%  486 aa  RIMO_KINRD RecName: Full=Ribosomal protein S12
   14::461     4e-33  30%  461 aa  RIMO_BURPP RecName: Full=Ribosomal protein S12
   11::401     4e-33  29%  443 aa  RIMO_AZOSE RecName: Full=Ribosomal protein S12
    7::357     6e-33  33%  440 aa  RIMO_PSEU5 RecName: Full=Ribosomal protein S12
    7::395     6e-33  30%  440 aa  RIMO_PSEAB RecName: Full=Ribosomal protein S12
    8::383     6e-33  27%  444 aa  RIMO_ACTSZ RecName: Full=Ribosomal protein S12
    5::385     7e-33  29%  437 aa  RIMO_RHILO RecName: Full=Ribosomal protein S12
   11::399     7e-33  29%  445 aa  RIMO_PSEF5 RecName: Full=Ribosomal protein S12
    8::376     7e-33  26%  429 aa  RIMO_CHLL2 RecName: Full=Ribosomal protein S12
    7::386     1e-32  27%  444 aa  RIMO_SYNFM RecName: Full=Ribosomal protein S12
   90::475     1e-32  30%  531 aa  RIMO_PSYCK RecName: Full=Ribosomal protein S12
   11::399     1e-32  29%  447 aa  RIMO_PSEU2 RecName: Full=Ribosomal protein S12
    7::389     1e-32  29%  440 aa  RIMO_PSEMY RecName: Full=Ribosomal protein S12
   12::391     1e-32  27%  448 aa  RIMO_MANSM RecName: Full=Ribosomal protein S12
   17::397     1e-32  27%  468 aa  RIMO_CHLPN RecName: Full=Ribosomal protein S12
    8::387     1e-32  27%  441 aa  RIMO_RHOPS RecName: Full=Ribosomal protein S12
   12::455     1e-32  29%  456 aa  RIMO_RALME RecName: Full=Ribosomal protein S12
   14::461     1e-32  30%  461 aa  RIMO_BURXL RecName: Full=Ribosomal protein S12
    7::107     2e-32  32%  493 aa  RIMO_STRGG RecName: Full=Ribosomal protein S12
   11::399     2e-32  29%  447 aa  RIMO_PSE14 RecName: Full=Ribosomal protein S12
   34::420     2e-32  26%  472 aa  RIMO_SHEB8 RecName: Full=Ribosomal protein S12
    7::395     2e-32  30%  440 aa  RIMO_PSEAE RecName: Full=Ribosomal protein S12
    7::365     2e-32  30%  448 aa  RIMO_MAGSA RecName: Full=Ribosomal protein S12
    4::386     2e-32  29%  435 aa  RIMO_LEGPL RecName: Full=Ribosomal protein S12
    4::386     2e-32  29%  439 aa  RIMO_LEGPC RecName: Full=Ribosomal protein S12
    4::386     2e-32  29%  439 aa  RIMO_LEGPA RecName: Full=Ribosomal protein S12
   16::463     2e-32  29%  463 aa  RIMO_BURTA RecName: Full=Ribosomal protein S12
   34::420     3e-32  26%  476 aa  RIMO_SHESR RecName: Full=Ribosomal protein S12
   34::420     3e-32  26%  476 aa  RIMO_SHESM RecName: Full=Ribosomal protein S12
   38::424     3e-32  26%  480 aa  RIMO_SHESA RecName: Full=Ribosomal protein S12
   34::420     3e-32  26%  472 aa  RIMO_SHEB9 RecName: Full=Ribosomal protein S12
    5::389     3e-32  27%  434 aa  RIMO_PORG3 RecName: Full=Ribosomal protein S12
    7::384     3e-32  27%  443 aa  RIMO_HAEDU RecName: Full=Ribosomal protein S12
    6::453     3e-32  28%  453 aa  RIMO_BURCH RecName: Full=Ribosomal protein S12
    6::453     3e-32  28%  453 aa  RIMO_BURCA RecName: Full=Ribosomal protein S12
   15::405     4e-32  32%  485 aa  RIMO_DEIGD RecName: Full=Ribosomal protein S12
    6::453     4e-32  28%  453 aa  RIMO_BURCJ RecName: Full=Ribosomal protein S12
   11::396     4e-32  32%  443 aa  RIMO_AZOSB RecName: Full=Ribosomal protein S12
    4::389     4e-32  28%  470 aa  RIMO_ANADE RecName: Full=Ribosomal protein S12
    3::371     4e-32  29%  498 aa  MIAB_SORC5 RecName: Full=(Dimethylallyl)adenosine tRNA
    9::390     5e-32  28%  439 aa  RIMO_UNCTG RecName: Full=Ribosomal protein S12
   11::396     5e-32  29%  455 aa  RIMO_SPHAL RecName: Full=Ribosomal protein S12
   39::425     5e-32  26%  481 aa  RIMO_SHEON RecName: Full=Ribosomal protein S12
   34::420     5e-32  26%  472 aa  RIMO_SHEB5 RecName: Full=Ribosomal protein S12
    8::387     5e-32  27%  441 aa  RIMO_RHOPA RecName: Full=Ribosomal protein S12
    8::387     5e-32  27%  441 aa  RIMO_RHOP2 RecName: Full=Ribosomal protein S12
   13::410     5e-32  27%  464 aa  RIMO_RHOFD RecName: Full=Ribosomal protein S12
   10::398     5e-32  29%  453 aa  RIMO_RALPJ RecName: Full=Ribosomal protein S12
    7::395     5e-32  30%  440 aa  RIMO_PSEA7 RecName: Full=Ribosomal protein S12
   13::388     5e-32  26%  476 aa  RIMO_MYXXD RecName: Full=Ribosomal protein S12
    4::383     5e-32  28%  435 aa  RIMO_LEGPH RecName: Full=Ribosomal protein S12
    6::453     5e-32  28%  453 aa  RIMO_BURS3 RecName: Full=Ribosomal protein S12
    6::453     5e-32  28%  453 aa  RIMO_BURCC RecName: Full=Ribosomal protein S12
    5::392     5e-32  28%  439 aa  RIMO_BORPE RecName: Full=Ribosomal protein S12
    5::392     5e-32  28%  439 aa  RIMO_BORPA RecName: Full=Ribosomal protein S12
   12::409     5e-32  28%  463 aa  RIMO_ACISJ RecName: Full=Ribosomal protein S12
    8::387     6e-32  27%  441 aa  RIMO_RHOPT RecName: Full=Ribosomal protein S12
    5::389     6e-32  27%  434 aa  RIMO_PORGI RecName: Full=Ribosomal protein S12
   10::398     8e-32  30%  453 aa  RIMO_RALSO RecName: Full=Ribosomal protein S12
    7::452     8e-32  28%  475 aa  RIMO_ACIC1 RecName: Full=Ribosomal protein S12
   18::402     1e-31  28%  448 aa  RIMO_RHOCS RecName: Full=Ribosomal protein S12
    6::453     1e-31  28%  453 aa  RIMO_BURVG RecName: Full=Ribosomal protein S12
    6::453     1e-31  28%  453 aa  RIMO_BURM1 RecName: Full=Ribosomal protein S12
   10::388     1e-31  27%  443 aa  RIMO_ZYMMO RecName: Full=Ribosomal protein S12
    7::395     1e-31  29%  443 aa  RIMO_PSESM RecName: Full=Ribosomal protein S12
   40::433     2e-31  27%  479 aa  RIMO_SACD2 RecName: Full=Ribosomal protein S12
   19::405     2e-31  26%  451 aa  RIMO_CELJU RecName: Full=Ribosomal protein S12
   16::463     2e-31  29%  463 aa  RIMO_BURMS RecName: Full=Ribosomal protein S12
   16::463     2e-31  29%  463 aa  RIMO_BURMA RecName: Full=Ribosomal protein S12
   16::463     2e-31  29%  463 aa  RIMO_BURM9 RecName: Full=Ribosomal protein S12
   16::463     2e-31  29%  463 aa  RIMO_BURM7 RecName: Full=Ribosomal protein S12
    6::453     2e-31  28%  453 aa  RIMO_BURCM RecName: Full=Ribosomal protein S12
   19::424     2e-31  26%  435 aa  MIAB_BUCCC RecName: Full=(Dimethylallyl)adenosine tRNA
   38::395     2e-31  27%  474 aa  RIMO_SHEAM RecName: Full=Ribosomal protein S12
    1::392     2e-31  27%  440 aa  RIMO_DESOH RecName: Full=Ribosomal protein S12
   12::459     2e-31  28%  459 aa  RIMO_BURPS RecName: Full=Ribosomal protein S12
   16::463     2e-31  28%  463 aa  RIMO_BURP1 RecName: Full=Ribosomal protein S12
   16::463     2e-31  28%  463 aa  RIMO_BURP0 RecName: Full=Ribosomal protein S12
    9::389     2e-31  28%  441 aa  RIMO_BORPD RecName: Full=Ribosomal protein S12
    5::390     2e-31  28%  470 aa  RIMO_ANADF RecName: Full=Ribosomal protein S12
    4::402     3e-31  32%  452 aa  RIMO_POLSQ RecName: Full=Ribosomal protein S12
   17::366     3e-31  33%  450 aa  RIMO_AZOC5 RecName: Full=Ribosomal protein S12
    4::396     4e-31  28%  452 aa  RIMO_POLNS RecName: Full=Ribosomal protein S12
    3::359     4e-31  31%  436 aa  RIMO_CAMC1 RecName: Full=Ribosomal protein S12
   10::389     5e-31  28%  441 aa  RIMO_METS4 RecName: Full=Ribosomal protein S12
   17::396     5e-31  28%  448 aa  RIMO_METPB RecName: Full=Ribosomal protein S12
   17::402     5e-31  27%  448 aa  RIMO_METEP RecName: Full=Ribosomal protein S12
   10::394     5e-31  31%  440 aa  RIMO_DECAR RecName: Full=Ribosomal protein S12
   10::361     5e-31  32%  446 aa  RIMO_ACIF2 RecName: Full=Ribosomal protein S12
   17::402     7e-31  27%  448 aa  RIMO_METC4 RecName: Full=Ribosomal protein S12
    6::453     7e-31  27%  453 aa  RIMO_BURA4 RecName: Full=Ribosomal protein S12
   16::463     9e-31  30%  463 aa  RIMO_BURP8 RecName: Full=Ribosomal protein S12
    7::433     1e-30  29%  483 aa  RIMO_THEFY RecName: Full=Ribosomal protein S12
   15::394     1e-30  27%  452 aa  RIMO_SPHWW RecName: Full=Ribosomal protein S12
    9::452     1e-30  29%  452 aa  RIMO_RALEJ RecName: Full=Ribosomal protein S12
    1::356     1e-30  35%  401 aa  RIMO_HYDS0 RecName: Full=Ribosomal protein S12
   15::392     1e-30  26%  434 aa  RIMO_CHLTE RecName: Full=Ribosomal protein S12
    5::392     1e-30  28%  439 aa  RIMO_BORBR RecName: Full=Ribosomal protein S12
    7::385     2e-30  29%  457 aa  RIMO_XANCP RecName: Full=Ribosomal protein S12
    7::385     2e-30  29%  457 aa  RIMO_XANC8 RecName: Full=Ribosomal protein S12
    7::385     2e-30  29%  457 aa  RIMO_XANAC RecName: Full=Ribosomal protein S12
    8::387     2e-30  26%  441 aa  RIMO_RHOP5 RecName: Full=Ribosomal protein S12
   16::463     2e-30  28%  463 aa  RIMO_BURP6 RecName: Full=Ribosomal protein S12
    8::387     2e-30  27%  441 aa  RIMO_BRASB RecName: Full=Ribosomal protein S12
    7::385     2e-30  29%  457 aa  RIMO_XANCB RecName: Full=Ribosomal protein S12
   10::398     3e-30  29%  453 aa  RIMO_JANMA RecName: Full=Ribosomal protein S12
   17::372     3e-30  30%  448 aa  RIMO_METRJ RecName: Full=Ribosomal protein S12
   27::415     3e-30  28%  470 aa  RIMO_CUPTR RecName: Full=Ribosomal protein S12
    1::420     4e-30  25%  472 aa  RIMO_ROSS1 RecName: Full=Ribosomal protein S12
    8::387     4e-30  26%  441 aa  RIMO_RHOPB RecName: Full=Ribosomal protein S12
    7::386     4e-30  28%  441 aa  RIMO_METFK RecName: Full=Ribosomal protein S12
   20::405     4e-30  30%  454 aa  RIMO_COLP3 RecName: Full=Ribosomal protein S12
    7::385     6e-30  29%  458 aa  RIMO_XANC5 RecName: Full=Ribosomal protein S12
    7::375     6e-30  28%  441 aa  RIMO_RHORT RecName: Full=Ribosomal protein S12
    7::385     8e-30  30%  453 aa  RIMO_STRMK RecName: Full=Ribosomal protein S12
    7::385     8e-30  30%  453 aa  RIMO_STRM5 RecName: Full=Ribosomal protein S12
    1::388     8e-30  28%  443 aa  RIMO_RALEH RecName: Full=Ribosomal protein S12
   12::391     8e-30  26%  445 aa  RIMO_BRASO RecName: Full=Ribosomal protein S12
   10::413     1e-29  26%  461 aa  RIMO_POLNA RecName: Full=Ribosomal protein S12
   15::392     1e-29  27%  437 aa  RIMO_CHLP8 RecName: Full=Ribosomal protein S12
   16::400     2e-29  30%  447 aa  RIMO_NITEU RecName: Full=Ribosomal protein S12
    8::341     2e-29  27%  439 aa  RIMO_HELPG RecName: Full=Ribosomal protein S12
    7::357     2e-29  32%  442 aa  RIMO_ACIF5 RecName: Full=Ribosomal protein S12
   10::404     2e-29  27%  454 aa  RIMO_HERAR RecName: Full=Ribosomal protein S12
   13::401     2e-29  26%  462 aa  RIMO_ERYLH RecName: Full=Ribosomal protein S12
   38::417     2e-29  30%  485 aa  RIMO_ALTMD RecName: Full=Ribosomal protein S12
    8::341     3e-29  27%  439 aa  RIMO_HELPH RecName: Full=Ribosomal protein S12
   19::369     3e-29  28%  442 aa  RIMO_CHLPB RecName: Full=Ribosomal protein S12
    6::385     3e-29  25%  439 aa  RIMO_BRAJA RecName: Full=Ribosomal protein S12
    5::386     4e-29  26%  438 aa  RIMO_BRUO2 RecName: Full=Ribosomal protein S12
   16::394     5e-29  29%  466 aa  RIMO_XANOR RecName: Full=Ribosomal protein S12
   10::388     5e-29  29%  460 aa  RIMO_XANOP RecName: Full=Ribosomal protein S12
   16::394     5e-29  29%  466 aa  RIMO_XANOM RecName: Full=Ribosomal protein S12
    8::341     5e-29  27%  439 aa  RIMO_HELP2 RecName: Full=Ribosomal protein S12
   18::421     6e-29  26%  469 aa  RIMO_POLSJ RecName: Full=Ribosomal protein S12
    5::385     6e-29  28%  437 aa  RIMO_OCHA4 RecName: Full=Ribosomal protein S12
    5::385     6e-29  28%  437 aa  RIMO_BRUSU RecName: Full=Ribosomal protein S12
    5::385     6e-29  28%  437 aa  RIMO_BRUSI RecName: Full=Ribosomal protein S12
    5::385     6e-29  28%  437 aa  RIMO_BRUME RecName: Full=Ribosomal protein S12
    5::385     6e-29  28%  437 aa  RIMO_BRUC2 RecName: Full=Ribosomal protein S12
    5::385     6e-29  28%  437 aa  RIMO_BRUAB RecName: Full=Ribosomal protein S12
    5::385     6e-29  28%  437 aa  RIMO_BRUA2 RecName: Full=Ribosomal protein S12
    5::385     6e-29  28%  437 aa  RIMO_BRUA1 RecName: Full=Ribosomal protein S12
    5::450     8e-29  26%  467 aa  RIMO_TREDE RecName: Full=Ribosomal protein S12
    8::386     8e-29  27%  440 aa  RIMO_OLICO RecName: Full=Ribosomal protein S12
   20::406     1e-28  27%  471 aa  RIMO_DELAS RecName: Full=Ribosomal protein S12
   11::408     2e-28  27%  462 aa  RIMO_VEREI RecName: Full=Ribosomal protein S12
    8::341     2e-28  28%  439 aa  RIMO_HELPJ RecName: Full=Ribosomal protein S12
    7::340     2e-28  27%  438 aa  RIMO_HELAH RecName: Full=Ribosomal protein S12
   22::424     2e-28  32%  504 aa  RIMO_DEIRA RecName: Full=Ribosomal protein S12
    3::407     2e-28  28%  452 aa  RIMO_AKKM8 RecName: Full=Ribosomal protein S12
    5::385     2e-28  28%  437 aa  RIMO_BART1 RecName: Full=Ribosomal protein S12
    8::341     3e-28  27%  439 aa  RIMO_HELPS RecName: Full=Ribosomal protein S12
   10::378     3e-28  24%  438 aa  RIMO_CHLCH RecName: Full=Ribosomal protein S12
    5::385     3e-28  27%  437 aa  RIMO_BARHE RecName: Full=Ribosomal protein S12
   32::408     5e-28  27%  455 aa  RIMO_RHOS1 RecName: Full=Ribosomal protein S12
    5::378     5e-28  25%  431 aa  RIMO_PELPB RecName: Full=Ribosomal protein S12
    6::375     7e-28  25%  432 aa  RIMO_CHLPD RecName: Full=Ribosomal protein S12
   10::391     9e-28  31%  448 aa  RIMO_NITMU RecName: Full=Ribosomal protein S12
   32::408     1e-27  28%  455 aa  RIMO_RHOS4 RecName: Full=Ribosomal protein S12
    8::341     1e-27  28%  439 aa  RIMO_HELPY RecName: Full=Ribosomal protein S12
   19::412     2e-27  26%  466 aa  RIMO_LEPCP RecName: Full=Ribosomal protein S12
    5::361     2e-27  31%  437 aa  RIMO_METCA RecName: Full=Ribosomal protein S12
    7::376     4e-27  25%  434 aa  RIMO_CHLT3 RecName: Full=Ribosomal protein S12
   32::402     6e-27  26%  457 aa  RIMO_RHOS5 RecName: Full=Ribosomal protein S12
   10::378     1e-26  25%  440 aa  RIMO_PELLD RecName: Full=Ribosomal protein S12
   24::417     1e-26  25%  471 aa  RIMO_METPP RecName: Full=Ribosomal protein S12
   20::384     1e-26  26%  471 aa  RIMO_NOVAD RecName: Full=Ribosomal protein S12
   14::355     1e-26  32%  445 aa  RIMO_NITEC RecName: Full=Ribosomal protein S12
   16::380     2e-26  29%  449 aa  RIMO_XANP2 RecName: Full=Ribosomal protein S12
   14::72      2e-26  30%  507 aa  RIMO_SALTO RecName: Full=Ribosomal protein S12
    8::62      2e-26  32%  523 aa  RIMO_FRASC RecName: Full=Ribosomal protein S12
   16::388     2e-26  23%  446 aa  RIMO_ARCB4 RecName: Full=Ribosomal protein S12
    7::354     3e-26  28%  434 aa  RIMO_PROVI RecName: Full=Ribosomal protein S12
   32::410     4e-26  26%  463 aa  RIMO_PARDP RecName: Full=Ribosomal protein S12
   11::390     4e-26  25%  443 aa  RIMO_ALHEH RecName: Full=Ribosomal protein S12
   14::395     7e-26  26%  440 aa  RIMO_LAWIP RecName: Full=Ribosomal protein S12
    4::378     9e-26  23%  439 aa  RIMO_SULDN RecName: Full=Ribosomal protein S12
   17::397     9e-26  27%  449 aa  RIMO_BEII9 RecName: Full=Ribosomal protein S12
   14::72      1e-25  30%  507 aa  RIMO_SALAI RecName: Full=Ribosomal protein S12
   12::409     2e-25  26%  463 aa  RIMO_ACIAC RecName: Full=Ribosomal protein S12
   12::378     3e-25  25%  433 aa  RIMO_PROA2 RecName: Full=Ribosomal protein S12
    2::389     3e-25  26%  482 aa  RIMO_ROSCS RecName: Full=Ribosomal protein S12
   27::411     3e-25  25%  458 aa  RIMO_JANSC RecName: Full=Ribosomal protein S12
   33::383     1e-24  25%  466 aa  RIMO_SILPO RecName: Full=Ribosomal protein S12
   29::403     3e-24  25%  456 aa  RIMO_DINSH RecName: Full=Ribosomal protein S12
   29::403     6e-24  25%  459 aa  RIMO_ROSDO RecName: Full=Ribosomal protein S12
   29::418     2e-23  25%  467 aa  RIMO_SILST RecName: Full=Ribosomal protein S12
    8::390     2e-23  26%  430 aa  RIMO_DESDG RecName: Full=Ribosomal protein S12
   18::396     5e-23  25%  451 aa  RIMO_HYPNA RecName: Full=Ribosomal protein S12
    1::343     7e-23  27%  425 aa  CDKAL_CAEEL RecName: Full=CDKAL1-like protein;
    8::390     3e-22  27%  430 aa  RIMO_DESVV RecName: Full=Ribosomal protein S12
    8::390     3e-22  27%  430 aa  RIMO_DESVH RecName: Full=Ribosomal protein S12
  189::429     4e-21  29%  545 aa  RIMO_FRAAA RecName: Full=Ribosomal protein S12
  206::498     7e-07  25%  505 aa  Y1620_METJA RecName: Full=Uncharacterized protein MJ1620;
  125::245     5e-05  31%  471 aa  KAMA_BACSU RecName: Full=L-lysine 2,3-aminomutase;       
   16::104     2e-04  30%  290 aa  LIPA_ALKMQ RecName: Full=Lipoyl synthase;       
  184::348     2e-04  31%  612 aa  BCHE_RHOS4 RecName: Full=Anaerobic magnesium-protoporphyrin IX
  193::335     7e-04  32%  555 aa  BCHE_RHOGE RecName: Full=Anaerobic magnesium-protoporphyrin IX
    1::434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQNPEA
YQEV_BACSU      --VAFHTLGCKVNHYETEAIWQLFKEAGYERRDFEQTADVYVINTCTVTNTGDKKSRQVIRRAIRQNPDG
Y474_AQUAE      MKVAFETLGCRMNQFDTDLLKNKFIQKGYEVVSFEDMADVYVINTCTVTVGGDRSSRQAIYQAKRRNPKA
Y16R_MYCIO      ---AIHTLGCKVNLFESNSIKNDLIMNGLVEVPFDSKADVYIINTCTVTNKADAKSRLYIKRAHVQNKDA
MIAB_CLOTE      ------TWGCQMNEEDSEKLSGMLKNIGYKNAEDKNQADIIIFNTCCVRENAELKVYGNLGALKSKNPNL
MIAB_CLOBM      ------TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKNLGILKGLKSKNPNL
MIAB_CLOBK      ------TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKNLGILKGLKSKNPNL
Y830_THEMA      --VRIETFGCKVNQYESEYMAEQLEKAGYVVLPDGNAA-YYIVNSCAVTKEVEKKVKRLIKSIRNRNKNA
MIAB_THEP3      ------TYGCQMNVHDSEKLAGMLEKMGYKYTENLEQADVLLFNTCAVREHAEIR---VLGRVKARNPNL
MIAB_THEPX      ------TYGCQMNVHDSEKLAGMLEKMGYKYTENLEQADVLLFNTCAVREHAEIR---VLGRVKARNPNL
MIAB_PELTS      -KYRIIVFGCQMNEHDSEVLAGILESMGYCQAGNSEDPDIILINTCCVRKTAENKVFSLLGRLRRQNPNL
MIAB_CLOBH      ------TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKNLGILKGLKSKNPNL
MIAB_CLOB1      ------TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKNLGILKGLKSKNPNL
MIAB_CLOBL      ------TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKNLGILKGLKSKNPNL
MIAB_CLOB8      ------TYGCQMNEEDSEKLSGMLKRMGYENTENRDEASIIIFNTCCVRENAENKVFGNLGALKKQNPDL
MIAB_THETN      ------TYGCQMNVHDSEKLAGMLEEMGYKYTEDLEKADVLLFNTCAVREHAEVR---VLGRVKNRNPNL
MIAB_CLOTH      ------TFGCQMNEHDSEKLAGMLAEMGYAETDNVNESDLVIYNTCCVRENAELKVYGHLGMLKNQKPDL
MIAB_CLOBB      ------TWGCQMNEEDSEKLSGMLKSQGYEETENRDEASIVIFNTCCVRENAENKVFGNLGRLKNQNPNL
MIAB_CLOBA      ------TFGCQMNEEDSEKLSGMLKSQGYEETENRDEASIVIFNTCCVRENAENKVFGNLGRLKNQNPNL
MIAB_CLONN      -----STWGCQMNEEDSEKISGLLKGIGYTRTDIRDEADVVIFNTCCVRENAEQKVYGHLGELKRKNPNL
MIAB_ALKOO      -KYMITTYGCQMNEHDSETLSGMLENMGYSITTNKEEANLIIYNTCCVRENAELKVYGNIGALKKKNEDL
MIAB_CLOAB      ------TWGCQMNAEDSEKLAGMLKEMKYEATDNREDADLIIFNTCCVRENAELKVYGNLGTLKKKKPNL
MIAB_NATTJ      ------TFGCQMNEHDSEVLAGMLDQMGFEKAASEEEADLLIINTCAVREKAEQKVLGKIGTLRENKPDM
MIAB_CLOPH      ------TFGCQMNAKDSEKLAGILETIGYVESD-SEEADFVVYNTCTVRENANTRVYGFLGNLKKKNPHM
MIAB_CLOPE      -----STYGCQMNEEDSEKLSGMLKSQGYERTENKEEASIIIFNTCCVRENAENKXXXXXXXXXXXXXXX
MIAB_CLOP1      -----STYGCQMNEEDSEKLSGMLKSQGYERTENKEEASIIIFNTCCVRENAENKXXXXXXXXXXXXXXX
MIAB_CLOPS      -----STYGCQMNEEDSEKLSGMLKSQGYERTENKEEASIIIFNTCCVRENAENKXXXXXXXXXXXXXXX
Y477_CHLPN      -------LGCRVNQYEVQAYRDQLTILGYEVLDSEIPADLCIINTCAVTASAESSGRHAVRQLCRQNPTA
MIAB_AKKM8      -KLYIKTYGCQMNERDSEQVARMFVQKGYTMTDREDEADVILFNSCSIREQAEQKAMGLLAKQQRHRPHV
MIAB_FINM2      ------THGCQMNEHDSEKIKTLLENMGFEKSDEKLDADFIIFNTCLVRENAEMKVYGQLGNLKRENPDM
MIAB_BACCN      -KFYIRTYGCQMNEHDTEVMAGIFTTLGYEPTFTTEDADVILLNTCAIRENAENKVFGELGHLKQKNPDL
MIAB_CARHZ      ------THGCQMNVHDSETIAGILESMGFVPSPEEKTADLIIINTCSVRETAENKVFTKIGKLKRENPDL
MIAB_BACWK      -KFYIRTYGCQMNEHDTEVMAGIFTTLGYEPTFSTEEADVILLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_DESAP      ------TFGCQMNEFDSELMTGLLEGMGYEPAKSLREADLVLINTCCVRESAENRVWGLLGRYKRDKPEL
MIAB_STAAW      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAAS      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAAN      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAAM      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAA9      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAA2      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAA1      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_BACC4      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_STAS1      ------TYGCQMNAHDTEVMAGILGALGYTPTEDINHADVILINTCAIRENAENKVFSEIGNLKKEKPET
MIAB_STAAT      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAAE      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAAC      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAA8      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAA3      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_SYMTH      -RVHIETFGCQMNEHDSEIMYGILAQMGYVKAQGPDDADLLLFNTCAVRESAVEHAFGRIGQLKPTNPDL
MIAB_STAAR      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_STAAB      ------TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKKERPDI
MIAB_BACCR      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELGHLKRRNPDF
MIAB_BACC2      -KFYIRTYGCQMNEHDTEVMAGIFTTLGYEPTFSTEDADVVLLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_CALS8      ------TYGCQMNVHDSEKLAGMLNAMGYVETQNLEEADLIIFNTCAVREHAESRVYGNIGPLKRKKPEL
MIAB_MYCPE      ------TFGCQSNLRDTEVMMGMLELIGYEYNEDVNTSDLVLLNTCAVREHAESKVFADIGRIKKSNPNF
MIAB_GEOKA      -KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTDRPEEANVILLNTCAIRENAENKVFGELGYLKTTNPDL
MIAB_BACHK      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_BACCZ      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_BACC7      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEEADVVLLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_BACC1      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEEADVVLLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_BACC0      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_BACAH      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELGHLKRRNPDL
MIAB_DESRM      ------SFGCQMNERDAESLAGMLEDLGYCPTSAQEEADIILLNTCCVRETAESKVFGLLGRLRKAKPDL
MIAB_METI4      --VFIKTFGCQMNVRDSEQVLQDFIERGYQIASSEKWADIILINTCSVRAMAEEKAIDKLASAKKKNPNL
MIAB_OCEIH      -KFLIRTYGCQMNEHDTEVMAGILSEMGYESTTVTEEADIILLNTCAIRENAENKVFGEIGHLKPENPDL
MIAB_BACA2      -KFYIRTYGCQMNEHDTEVMAGIFMALGYEATNSVDDANVILLNTCAIRENAENKVFGELGHLKKNNPDL
MIAB_AQUAE      -KFFIKTFGCQMNFNDSERIRGLLKTIGYEQTDNWEEADLIILNTCTIREKPDQKVLSHLGKIKEKNPKA
MIAB_BACP2      -KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTNSTEDANVILLNTCAIRENAENKVFGELGHLKREKPDL
MIAB_FUSNN      -KASIITYGCQMNVNESAKIKKIFQNLGYDVTEEIDNADAVFLNTCTVR---EGAATQIFXXXXXXXXXT
MIAB_CLOD6      ------TFGCQMNEHDSEKLCSMLEEMGYQMSMMVEESDLIIYNTCAVRENAELKVYGNLGQLKHKNPDM
MIAB_BACAN      -KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELGHLKRRNSDL
MIAB_SYNWW      LKYRILTYGCQMNVRDSETIAGLLEGSGFNQAEDLSEADLIVFNTCSVRHSAENKVYGKLGEIKKKRPEL
MIAB_RICBR      -KLYIKTYGCQMNVYDSVKMQDLLYPYGYEPTENIEEADVIILNTCHIREKAAEKTYSELGRIKKLQDSA
MIAB_RICB8      -KLYIKTYGCQMNVYDSVKMQDLLYPYGYEPTENIEEADVIILNTCHIREKAAEKTYSELGRIKKLQDSA
MIAB_GEOUR      ------TFGCQMNVSDSEKIAALLKGIGYFPTQDSSQADLVILNTCSVRAKAEEKVYNHLVQLKRKKPGI
MIAB_THEYD      --VYIKTFGCQMNEHDSERMLGILGTKGFIEVDEPKKADIVIFNTCAIRHKAEQKFFSSLGRVKKKNPQL
MIAB_THEAB      MKFFIKTYGCQMNENDSEVARYYLEQEGYESAENENEADIVILNTCVVRKKAEDKFLSTIGELRKKNKK-
MIAB_CAUSK      ------TYGCQMNVYDSERMADVLRPLGYGIVDEPEGADLVVLNTCHIREKATEKVKQMKGRKAEAGGQM
MIAB_ALKMQ      ------TYGCQMNEHDSEKLAGILQNIGYETNDKNE-ANLIIYNTCCVRENAELKVYGNIGNLKKEKHDL
MIAB_MOOTA      ------TYGCQMNQRDSEMMADLLQDAGYEPVAREEEAGVIILDTCCVREKAENKVYGKLGQIEKANPDL
MIAB_CYAP8      ------TFGCQMNKADSERMAGILENMGFIWSEDPNQADLILYNTCTIRDNAEQKVYSYLGRQKHENPDL
MIAB_SULSY      MKFYIKTFGCQMNVNDSEKMAGILQTLGYTPTENWEEADVILVNTCSVREKPDQKVLSALGKVKKHNPNA
MIAB_THESQ      MRFYIKTFGCQMNENDSETMAGLLMKEGFTPASAPEEADVVIINTCAVRRKSEEKAYSELGQMLKRKRKL
MIAB_THEP1      MRFYIKTFGCQMNENDSETMAGLLMKEGFTPASAPEEADVVIINTCAVRRKSEEKAYSELGQMLKRKRKL
MIAB_PARUW      ------TYGCQMNELDSEIMIGQLENRGLTRSHDENDADLLIFNTCSIRDLAERKVMGKLGKGLTKQSQA
MIAB_HYDS0      MKYFIKTYGCQMNINDSEKIKGILQTQGYEPATREEDADLVILNTCTIREKPDQKVWSHLGEIKKLNPNI
MIAB_THEMA      MRFYIKTFGCQMNENDSEAMAGLLVKEGFTPASSPEEADVVIINTCAVRRKSEEKAYSELGQVXXXXXXX
MIAB_RHIL3      -KVFIKTYGCQMNVYDSMRMSDALARDGYEPTEDMEVADLVLLNTCHIREKAAEKVYSALGRLREMKKEM
MIAB_GEOTN      -KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTDRPEDANVILLNTCAIRENAENKVFGELGYLKTTNPDL
MIAB_BRASO      -KLHIKSYGCQMNVYDAQRMVDTLGAEGFETADAGD-ADLVILNTCHIREKASEKVYSELGRLRVAKEEA
MIAB_ANOFW      -KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTDRPEDANVILLNTCAIRENAENKVFGEIGHLKQNNPDL
MIAB_EHRRW      --------GCQMNVYDSLIIENIIKPLGFSIVNEPSEADIVILNTCHIREKAAEKLYSELGRIRKETKNL
MIAB_DESHY      -KVVTLAYGCQMSERDADTLTEISSQKGYVRSQELEQADLIIVNTCCVRESAENKILGKIGELKHANPQL
MIAB_STAHJ      ------TYGCQMNAHDTEVMAGILQALGYTATEDINEADVILINTCAIRENAENKVFSEIGNLKKNRPEA
MIAB_EHRRG      --------GCQMNVYDSLIIENIIKPLGFSIVNELSEADIVILNTCHIREKAAEKLYSELGRIRKETKNL
MIAB_RICFE      -KLYIKTYGCQMNVYDSVKMQDLLYPFGYEPTENIEDADVIILITCHIREKAAEKTYSELGRIKKLQDSA
MIAB_OCHA4      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMKDEL
MIAB_SYNJA      ------TFGCQMNRADSERMAGILESLGYVPAEDELQADLVLFNTCTIRDNAEQKVYSYLGQRKRKNPAI
MIAB_SYNAS      ------TLGCQMNVHDSEQIAALMEEKGYICTEDANEADLIILNTCSIREKAAQKAKSQLGRXXXXXXXX
MIAB_MARMM      ------TYGCQMNVYDSDRMKDVLTPLGYESAETPEGADLVILNTCHIREKAAEKVYSELGRLRPLKDEK
MIAB_UNCTG      MNYLIETIGCQMNVCDSDMLVSIFSAYGASKANNLSEADVVILNTCSVRSQAEQKAFSYLGRVKQKNPCI
MIAB_THEM4      -KIHIKTYGCQMNENDSEVAKFYLEEEGYEITNNENDADIVILNTCVVRKKSEDKFYSHIGELKKQNK--
MIAB_ANAVT      ------TFGCQMNKADSERMAGILEDMGFEFSEDPNNADVILYNTCTIRDNAEQKVYSYLGRQKHEQPDL
MIAB_DICT6      -KYYIITYGCQMNKSDSEKVAGILENLGYTPSEKMEEADIILLNTCSVRERAEEKXXXXXXXXXXXXXXX
MIAB_RICRS      -KLYIKTYGCQMNVYDSIKMQDLLYPFGYEPTENIEEADVIILNTCHIREKAAEKTYSELGRIKKLQDSA
MIAB_RICRO      -KLYIKTYGCQMNVYDSIKMQDLLYPFGYEPTENIEEADVIILNTCHIREKAAEKTYSELGRIKKLQDSA
MIAB_PETMO      MKFYIRTFGCQMNINESEIMAGLLKEEGFEWTENPKEADIILINSCAVREKAENKMYGAIGKLKDENKNL
MIAB_BACSK      -KFLIRTYGCQMNVHDSENMSGLLLGMGFXXXXXXXXADIILLNTCAIRENAENKVFGEIGNXXXXXXXX
MIAB_ARCB4      -KLFIQTLGCQMNDTDSQHIQAELEKKGYVTTQNIEDADLIIINTCSVRERPVQKLFSEIGQFNKKKKEA
MIAB_SYNP2      ------TFGCQMNKADSERMAGILEEMGYHFTEDPYAADLVLYNTCTIRDNAEQKVYSYLGRQKQEKPDL
MIAB_SYNJB      ------TFGCQMNRADTERMAGILESLGYVATEDELQADLVLYNTCTIRDNAEQKVYSYLGQRKRKNPAI
MIAB_SYNFM      ------TFGCQMNEYDSQRALRLLCAVGYRPTSDIADADVIFLNTCSVRDKAEQKVYSFLGRLRRHRPWL
MIAB_SILST      -KLYIKTYGCQMNVYDSERMAETLGGQGYVETQTPDDADMILLNTCHIREKAAEKVYSELGRLKAEKPDL
MIAB_ANAPZ      --------GCQMNVYDALMMEDLLRPVGYAAVSRPEDADIILINTCHIREKASEKLYSTLGRMRVKKEEC
MIAB_RICCN      -KLYIKTYGCQMNVYDSVKMQDLLYPFGYEPTENIEEADVIILNTCHIREKAAEKTYSELGRIKKLQDSA
MIAB_BURPP      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLVKTDTPEDADVILFNTCSVREKAQEKVFSDLGRVREANPNL
MIAB_RHIME      -KVFVKTYGCQMNVYDSDRMSDALSRDGYVATDVLEDADFVLLNTCHIREKAAEKVYSELGRLREEGREM
MIAB_EHRCJ      --------GCQMNVYDSLIMENIIKPLGFTVVSEPSEADVVILNTCHIREKASEKLYSELGKIRKENKDL
MIAB_DESPS      ------TYGCQMNLRDSEIIAQILNNNGYVETSEIGGADLVLLNTCSIRAKAEQKVMSKLGELRRNNPRM
MIAB_DECAR      -KLFIRTFGCQMNEYDSDKMADVLASEGVIKTDNPEEADIILFNTCSVREKAQEKVFHDLGRVRKLNPNL
MIAB_BUCBP      -KIYIKTWGCQMNEYDSALITQILKQKGYENTKDPKLANVLILNTCSIREKAQEKVFHQLGRLKQKNPNL
MIAB_BURXL      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLVKTDTPEDADVILFNTCSVREKAQEKVFSDLGRVREANPNL
MIAB_RICAH      ------TYGCQMNVYDSVKMQDLLYPFGYEPTENIEEADVIILNTCHIREKAAEKTYSELGRIKKLQDSA
MIAB_ROSDO      -KLFIKTYGCQMNVYDSERMSEALVAEGYVETKTAEDADMILLNTCHIREKAAEKVYSELGRLKSDNPDL
MIAB_RICCK      -KLYIKTYGCQMNVYDSVKMQDLLYPFGYESTENIKEADVIILNTCHIREKAAEKIYSELGRIKKLQDSA
MIAB_FERNB      MKVHIFTYGCQMNENDSEIVKQLLKDEGIELTDDENDADVVILNTCAVRKKSEEKVYS--HXXXXXXXXX
MIAB_SALTO      ------TYGCQMNVHDSERIAGLLEQAGYRAGAADDTPDVVVFNTCAVRENADNRLYGNLGQLRPQHPEM
MIAB_BRASB      -KLHIKSYGCQMNVYDAQRMVDTLGAEGFVETAEAGDADLVILNTCHIREKASEKVYSELGRLRVAKEEA
MIAB_SINMW      -KVFVKTYGCQMNVYDSDRMSDALSRDGYVATDVLEEADFVLLNTCHIREKAAEKVYSELGRLRREGREM
MIAB_PROMS      ------TFGCQMNKADSERMAGTLEKMGYTRADNELNADLVLYNTCTIRDNAEQKVYSFLGRQKHKTPSL
MIAB_COPPD      MKYYIFTYGCQMNKNDSEMVSGILKSSGWEEAKNVVDSDLVVINTCSVRLHAEERAIGTI--SAXXXXXX
MIAB_THEFY      ------TYGCQMNVHDSERLSGLLEAAGYQRAAEGTTPDVVVFNTCAVRENADNRLYGNLGQLRPANPDM
MIAB_RHOP5      -KLHIKSFGCQMNVYDAQRMVDALAPEGFVETQSADDADLVILNTCHIREKAAEKVYSELGKLRLLKQDA
MIAB_PROMM      ------TFGCQMNKADSERMAGILEAMGYHEAPAELEADLVLYNTCTIRDNAEQKVYSYLGRQKRTHPHL
MIAB_PARL1      -KIFVKTYGCQMNVYDSARMVDVMAPSGYTEVDAPEDADIVILNTCHIREKAAEKVYSELGRLRERGEEL
MIAB_EHRCR      --------GCQMNVYDSLIMENIIKPLGFTVVNEPSEANIVILNTCHIREKASEKLYSELGKMRKETKDL
MIAB_BURS3      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPGL
MIAB_BACSU      -KFYIRTYGCQMNEHDTEVMAGIFMALGYEATNSVDDANVILLNTCAIRENAENKVFGELGHLKKNNPDL
MIAB_BACLD      -KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTDSTEDANVILLNTCAIRENAENKVFGEIGHLKKDNPDL
MIAB_RICM5      -KLYIKTYGCQMNVYDSVKMQDLLYPFGYEPTENIEEAAVIILNTCHIREKAAEKTYSELGRIKKLQDSA
MIAB_RHIEC      -KVFIKTYGCQMNVYDSTRMSDALARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALGRLREMKKEM
MIAB_PROM3      ------TFGCQMNKADSERMAGILEAMGYHEAPAELEADLVLYNTCTIRDNAEQKVYSYLGRQKRTHPHL
MIAB_METFK      -RIFIKTFGCQMNEYDSSRMLDMLAAEGMQTTDNPEEADVILLNTCSVREKAQEKVFSHLGRLKEKNPDL
MIAB_DESOH      ------TIGCQMNVYDSSQLSAILTAMGHRSVNAPEQADLVFVNTCTIRAKAKQKATSFVGRLKRARPDM
MIAB_COREF      ------TFGCQMNVHDSERLSGLLEEAGYTAAGEGDTPDLIVFNTCAVRENADQRLYGTLGNLRENHPGM
MIAB_RHIE6      -KVFIKTYGCQMNVYDSTRMSDALARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALGRLREMKKEM
MIAB_ALHEH      -RVYVKTHGCQMNEYDSDKMADVLVKEGYTRVDSPGDADVILLNTCSVREKAQEKVFSELGRWKKTRNGA
MIAB_TRIEI      ------TFGCQMNKADSERMAGILDNMGLISSEDPNKADIILYNTCTIRDNAEQKVYSYLGRQKHKQPDL
MIAB_RALSO      -KVFIKTFGCQMNEYDSDKMADVLAAEGLVPTDTPEDADVILFNTCSVREKAQEKVFSDLGRVKARNPDL
MIAB_LEPBP      -KVYVETYGCQMNEYDSGIVKELFRKEHYETTNVVEESDIIFLNTCAVRENAHAKRLQSLGYLKKKNPNL
MIAB_LEPBA      -KVYVETYGCQMNEYDSGIVKELFRKEHYETTNVVEESDIIFLNTCAVRENAHAKRLQSLGYLKKKNPNL
MIAB_DESDG      ------TFGCQMNVNDSDWLARALEARGFTQVPEHEAA-IYIINTCSVRDKPEQKVYSLLGRIRRETKNV
MIAB_BURM1      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDSPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_CYAA5      ------TFGCQMNKADSERMAGILEDMGFKWSEDPNTADLILYNTCTIRDNAEQKVYSYLGRQKHEHPDL
MIAB_CLAM3      ------TYGCQMNVHDSERLTGSLEAAGYVSAEGAE-ADIVVINTCAVRENADNKLYGNLGHVKRRHEGM
MIAB_BURTA      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDSPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_SILPO      -KLFIKTYGCQMNVYDSERMAEALGGQGYVETQSAEDADMILLNTCHIREKAAEKVYSELGRLKAAKPDL
MIAB_BURA4      -KVYIKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPGL
MIAB_BARQU      -KVFIKTYGCQMNVYDSQRMTDSLSSKGYVATQTPNDADLILLNTCHIREKAAEKLYSDLGRARTLDKPL
MIAB_ACTP7      -KLHITTWGCQMNEYDSSKMADLLSTHGLELTDKPEEADVLLLNTCSIREKAQEKVFSQLGRWKKDKPDL
MIAB_ACTP2      -KLHITTWGCQMNEYDSSKMADLLSTHGLELTDKPEEADVLLLNTCSIREKAQEKVFSQLGRWKKDKPDL
MIAB_SYNR3      ------TFGCQMNKADSERMAGILESMGYCAGSGEDQADLVLYNTCTIRDNAEQKVYSYLGRQKRDNPAL
MIAB_RHOS1      -KLFIKTYGCQMNVYDSERMAEALGAKGYVLTEVAEEADMVLLNTCHIREKAAEKVYSDLGRLRTAKPDL
MIAB_BURCM      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPGL
MIAB_BRAJA      -KLHIKSYGCQMNVYDAQRMVDTLAPEGFVETASAEDADLVILNTCHIREKASEKVYSELGRLRVAKDEA
MIAB_BART1      -KVFIKTYGCQMNVYDSQRMTDSLSSQGYVTTQTPNDADLILVNTCHIREKAAEKLYSDLGRLRVMRQER
MIAB_RHILW      -KVFIKTYGCQMNVYDSTRMSDALARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALGRLRDMKKEM
MIAB_HAES2      -KLHIKTWGCQMNEYDSSKMADLLLNHGLELTDVPEEADVLLLNTCSIREKAQEKVFHQLGRLKKQNPSL
MIAB_HAES1      -KLHIKTWGCQMNEYDSSKMADLLLNHGLELTDVPEEADVLLLNTCSIREKAQEKVFHQLGRLKKQNPSL
MIAB_CORDI      ------TFGCQMNVHDSERLSGLLEEAGYHAVADGEEPDLVVFNTCAVRENADKRLYGTLGQAKEKNPRM
MIAB_ACTPJ      -KLHITTWGCQMNEYDSSKMADLLSTHGLELTDKPEEADVLLLNTCSIREKAQEKVFSQLGRWKKDKPDL
MIAB_METEP      MKKAYVSYGCQMNAYDAGRMADVLAAEGYSATDTVEEADVVVLNTCHIREKAAEKVYSELGRLRESGHDT
MIAB_BURP8      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLVKTDTPEDADVILFNTCSVREKAQEKVFSDLGRVREANPNL
MIAB_BURCJ      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPGL
MIAB_BURCH      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPGL
MIAB_BURCC      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPGL
MIAB_BURCA      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPGL
MIAB_BACHD      -KFLVRTYGCQMNIHDSENMAGMLKEMGFEATDETTDADVILINTCAIRENAENKVFGEIGQLKREKPEL
MIAB_ANASP      ------TFGCQMNKADSERMAGILEDMGFKFSEDPNNADLILYNTCTIRDNAEQKVYSYLGRQKHEQPDL
MIAB_SALPK      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALPA      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SACEN      ------TYGCQMNVHDSERLAGMLEDAGYVRAGTDVDPDVVVFNTCAVRENADNRLYGNLGHAKDRNPGM
MIAB_NEIM0      -KVFIRTFGCQMNEYDSDKMLAVLAEEGIEQVTQADEADIILFNTCSVREKAQEKVFSDLGRVREKNPGL
MIAB_LYSSC      ------TYGCQMNEHDTEVMAGIFMQLGYTPTEIIEEADVVLLNTCAIRENAENKVFGELGKYKRKNPEM
MIAB_BURVG      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPGL
MIAB_BURPS      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_BURP6      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_BURP0      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_BURMS      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_BURMA      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_BURM9      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_BURM7      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_BRUSU      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMKDEL
MIAB_BRUO2      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMKDEL
MIAB_BRUC2      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMKDEL
MIAB_BRUAB      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMRDEL
MIAB_BRUA2      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMRDEL
MIAB_BRUA1      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMRDEL
MIAB_THELT      MRVFFKTYGCQMNLNDTETMAGILSQHGYEVVNLPEEADIVILNTCVVRQKSQEKYHSALGQXXXXXXXX
MIAB_SALAR      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_PROMA      ------TFGCQMNKADSERMAGILQAMGYQKAKTELCADLVLYNTCTIRDNAEQKVYSYLGRQKKSSPHL
MIAB_JANMA      -KIYIKTFGCQMNEYDSDKMVDVLASEGLIKTDTPEDADVILLNTCSVREKAQEKVFSDLGRLRENNPDL
MIAB_GLOVI      ------TFGCQMNKADSERMAGALTHLGYRIVDESDTADLVLFNTCTIRDNAEQKVYSYLGRRKQRDPHI
MIAB_CYAP7      ------TFGCQMNKADSERMAGILEDIGYQWSDDPNEADLVLYNTCTIRDNAEQKVYSYLGRQKHEKPDL
MIAB_CORGL      ------TYGCQMNVHDSERLSGLLEEAGYVAAPEDTTPDLVVFNTCAVRENADMRLYGTLGNLREKNPGM
MIAB_CHRVO      -KVYIKTFGCQMNEYDSDKMADVLSAEGMVKTDNPEEADVILFNTCSVREKAQEKVFSDLGRIREANPDL
MIAB_BRUSI      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMKDEL
MIAB_SALTY      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALTI      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALSV      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALPB      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALNS      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALHS      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALG2      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALEP      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALDC      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALCH      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_SALA4      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWREKNPDL
MIAB_NEIG2      -KVFIRTFGCQMNEYDSEKMLSVLAEEGIEQVTQADEADIILFNTCSVREKAQEKVFSDLGRVREKNPGL
MIAB_HAEIN      -KLHIKTWGCQMNEYDSSKMADLLLSHGLELTEAPEEADVLLLNTCSIREKAQEKVFHQLGRLKKNNPNL
MIAB_HAEIG      -KLHIKTWGCQMNEYDSSKMADLLLSHGLELTEAPEEADVLLLNTCSIREKAQEKVFHQLGRLKKNNPNL
MIAB_CORJK      ------TFGCQMNVHDSERLSGLLEDSGYVPASEGVTPDVVVFNTCAVRENADKRLYGTLGQMKAEHPGM
MIAB_CORGB      ------TYGCQMNVHDSERLSGLLEEAGYVAAPEDATPDLVVFNTCAVRENADMRLYGTLGNLREKNPGM
MIAB_BORA1      -KIYIRTFGCQMNEYDSDKMVDVLREDGLEMTDNPEEADVILFNTCSVREKAQEKVFSDLGRVKKLNPNL
MIAB_RHOS4      -KLFIKTYGCQMNVYDSERMAEALGAKGYVLTEVAEEADMVLLNTCHIREKAAEKVYSDLGRLRTAKPDL
MIAB_ORITB      ------TYGCQMNVYDSNRMVDLLETQGYNIVANMADASVIILNTCHIREKASEKMYSELGRIKKLQQKA
MIAB_ECO81      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_CLAMS      ------TYGCQMNVHDSERLTGSLEAAGYVSAEGAE-ADIVVINTCAVRENADNKLYGNLGHVKRRHEGM
MIAB_STAES      ------TYGCQMNAHDTEVMAGILNALGYSATDINE-ADVILINTCAIRENAENKVFSEIGNLKKERPDC
MIAB_STAEQ      ------TYGCQMNAHDTEVMAGILNALGYSATDINE-ADVILINTCAIRENAENKVFSEIGNLKKERPDC
MIAB_NITHX      -KLHIKSYGCQMNVYDAQRMVDTLAAEGFVETASAEEADLVILNTCHIREKASEKVYSELGRLRRDGREM
MIAB_NEIMF      -KVFIRTFGCQMNEYDSDKMLAVLAEEGIEQVTQADEADIILFNTCSVREKAQEKVFSDLGRVREKNPGL
MIAB_NEIG1      -KVFIRTFGCQMNEYDSEKMLSVLAEEGIEQVTQADEADIILFNTCSVREKAQEKVFSDLGRVREKNPGL
MIAB_BARBK      -KVFIKTYGCQMNVYDSQRMNDSLSAQGYVTTQTPNDADLILVNTCHIREKAAEKLYSDLGRLRMMRQKR
MIAB_ARTAT      ------TFGCQMNVHDSERMAGLLEEAGYVPAD-GEVADVVVFNTCAVRENADNKLYGNLGQLRQANPGM
MIAB_PROM0      ------TFGCQMNKADSERMAGTLEKMGYTRADNELNADLVLYNTCTIRDNAEQKVYSFLGRQKHKTPRL
MIAB_NOSP7      ------TFGCQMNKADSERMAGVLEDMGFEWSEDPNNADVILYNTCTIRDNAEQKVYSYLGRAKRKHPDL
MIAB_MESSB      -KVFVKTYGCQMNVYDSQRMADALAAEGYRATDVIEDADLVLLNTCHIREKAAEKVYSELGRIRKQGRET
MIAB_HAEIE      -KLHIKTWGCQMNEYDSSKMADLLLSHGLELTEAPEEADVLLLNTCSIREKAQEKVFHQLGRLKKNNPNL
MIAB_HAEI8      -KLHIKTWGCQMNEYDSSKMADLLLSHGLELTEAPEEADVLLLNTCSIREKAQEKVFHQLGRLKKNNPNL
MIAB_BURP1      -KVYVKTFGCQMNEYDSDKMVDVLAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVREAKPDL
MIAB_BRUME      -KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALGRLRKMKDEL
MIAB_BARHE      -KVFIKTYGCQMNVYDSQRMTDSLSSKGYVATQTPNDADLILVNTCHIREKAAEKLYSDLGRLRVMRQER
MIAB_SHISS      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_SHIBS      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_RICTY      -KLYIKTYGCQMNVYDSVKIQDLLYPFGYESTEDIKEADIIILNTCHIREKAAEKTYSELGRIKKQNTRA
MIAB_NEIMB      -KVFIRTFGCQMNEYDSDKMLAVLAEEGIEQVTQADEADIILFNTCSVREKAQEKVFSDLGRVREKNPGL
MIAB_HAEDU      -KLHITTWGCQMNEYDSSKMADLLSTHGLELTDKPEEADILLLNTCSIREKAQEKVFSQLGRWKKDKPDL
MIAB_CITK8      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTEVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_SHIFL      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_SHIF8      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_SHIDS      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_RHOPA      -KLHIKSYGCQMNVYDAQRMVDALAPEGFVETANVDDADLVILNTCHIREKASEKVYSELGRLRVARDEA
MIAB_NITMU      -KLYIKTFGCQMNEYDSKKMADVLRAQHMEKTDDPAAADVILFNTCSVREKAQEKVFHDLGRVRHANPDL
MIAB_KLEP3      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTEVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ESCF3      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOUT      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOSM      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOSE      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOLU      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOLI      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOLC      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOL6      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOL5      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOK1      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECOHS      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECODH      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECO8A      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECO7I      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECO5E      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECO57      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECO55      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECO45      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ECO24      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_POLNS      -KLYIKTFGCQMNEYDSGKMADLLADEGMVMTDRPEDADVVLLNTCSIREKAEDKVFSDLGRLRKTKPNL
MIAB_PELCD      ------TFGCQMNVVDSEQIVGLVQSLGYSSVDSPEQANLIILNTCSIRARAERKVYGHLGRLKQRRPEL
MIAB_PROM2      ------TFGCQMNKADSERMAGTLEKMGYTRADDELKADLVLYNTCTIRDNAEQKVYSFLGRAKRKHPSL
MIAB_PROAC      ------TYGCQMNVHDSERIAGLLEEAGYVPTDTLAPADVVVFNTCAVRENADNRLYGTLGHVKSAHPGM
MIAB_HERAR      -KIYIKTFGCQMNEYDSDKMADVLASDGLIKTDKAEDADVILLNTCSVREKAQEKVFSDLGRLRELKPDL
MIAB_DELAS      -KVFIKTFGCQMNEYDSDKMADVLAAQGYESTDDPEQADLILFNTCSVREKAQEKVFSDLGRYKHLKERG
MIAB_ACISJ      -KVFIKTFGCQMNEYDSDKMADVLAAQGYEPTDDPEQADLILFNTCSVREKAQEKVFSDLGRVKHLKDKG
MIAB_SULDN      -KLFIETLGCAMNSRDSEHMAELSEKEGYETTNDLSSADLIIINTCSVREKPVAKLFSELGVFNKRKKEA
MIAB_POLSQ      -KLYIKTFGCQMNEYDSGKMADLLADEGMVMTDTPEDADVVLLNTCSIREKAEDKVFSDLGRLRKTKPHM
MIAB_JANSC      -KLFVKTYGCQMNVYDSERMAEALGGEGYEQVNTPEGADMILLNTCHIREKAAEKMYSELGRLRPANPDL
MIAB_RICPR      -KLYIKTYGCQMNVYDSVKIQDLLYPFGYESTEDIKEADIIILNTCHIREKAAEKTYSELGRIKKQNTRA
MIAB_NEIMA      -KVFIRTFGCQMNEYDSDKMLAVLAEEGIEQVTQADEADIILFNTCSVREKAQEKVFSDLGRVREKKPGL
MIAB_MYCA9      ------TYGCQMNVHDSERVSGLLDAAGYVKAPEGTDADIVIFNTCAVRENADNKLYGNISHLKAANPNM
MIAB_KOCRD      ------TLGCQMNAHDSERITGLLENAGY-VPAVGREPDLVVFNTCAVRENADNKLYGQLGQVKRRNDRL
MIAB_KLEP7      -KLHIKTWGCQMNEYDSSKMADLLATHGYQLTEVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_ENT38      -KLHIKTWGCQMNEYDSSKMADLLATHGYELTELAEEADVLLLNTCSIREKAQEKVFHLLGRLKKKNPDL
MIAB_ANAMM      --------GCQMNVYDS-LMVEDILRPGFAAVQRPEDADIIMVNTCHVREKAAEKLYSALGRMRMLRKEA
MIAB_SHIB3      -KLHIKTWGCQMNEYDSSKMADLLATHSYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRLKEKNPDL
MIAB_AGRT5      -KVFIKTYGCQMNVYDSVRMSDALAKDGYVQTEDMGEADLVLLNTCHIREKAAEKVYSALGRLREQGREF
MIAB_YERPN      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_YERPE      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_YERPA      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_RHOPT      -KLHIKSYGCQMNVYDAQRMVDALAPEGFVETANVDDADLVILNTCHIREKASEKVYSELGRLRVARDEA
MIAB_PROM5      ------TFGCQMNKADSERMAGTLEKMGYSRAIDELKADLVLYNTCTIRDSAQQKVYSFLGRQIKRKPKL
MIAB_BIFAA      ------TLGCQMNVHDSERIAGVLEADGYEEQYLNHDIDLIVMNTCAVRENAAERMYGTIGELKRERPNL
MIAB_TROWT      MTYTVRTYGCQMNVHDSERIAGVLEDEGY-VKSGSDDADVVVLNTCAVRENADNRFYGNLGQLQKKNNGR
MIAB_THIDA      -KIYIKTFGCQMNEYDSDKMADVLAAEGLTPTSTPEDADVILFNTCSVREKAQEKVFHDLGRVRQANPNL
MIAB_PASMU      -KLHIKTWGCQMNEYDSSKMADLLSTHGLELTEIPEEADVLLLNTCSIREKAQEKVFHQLGRLKKHKPGL
MIAB_ORITI      ------TYGCQMNVYDSNRMVDLLETQGYNIVANMADASVIILNTCHIREKASEKMYSELGRIKKLQQKA
MIAB_NOCSJ      ------TYGCQMNVHDSERLTGLLEDAGYVAAPDGQQADVVVFNTCAVRENADNKLYGNLGHVKAATPGM
MIAB_ENTS8      -KLHIKTWGCQMNEYDSSKMADLLTTHGFTLTDVAEEADILLLNTCSIREKAQEKVFHQLGRLKEKNPDV
MIAB_YERPY      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_TROW8      MTYTVRTYGCQMNVHDSERIAGVLEDEGY-VKSGSDDADVVVLNTCAVRENADNRFYGNLGQLQKKNNGR
MIAB_DESVV      ------TFGCQMNVNDSDWLARALMERGFSPAPFGE-ARLTIVNTCSVRDKPEQKVYSLLGRIRQKKPDA
MIAB_MYCGI      ------TYGCQMNVHDSERLSGLLEQAGYQRAGAGVDADIVVFNTCAVRENADNKNLSHLAPRKQADPQM
MIAB_DESVH      ------TFGCQMNVNDSDWLARALMERGFSPAPFGE-ARLTIVNTCSVRDKPEQKVYSLLGRIRQKKPDA
MIAB_YERPP      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_YERPG      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_WOLPP      ------TYGCQMNVYDSILMENIVKPLGFNVVSDAEQADLVILNTCHIREKAAEKLYSELGRSSQKNKEM
MIAB1_MYCMM     ------TLGCLMNAHDSERMAGLLEDAGYIKADPGAPADLVVFNTCAVRENADNKSLAHLAPIKASRPGM
Y416_RICPR      LRQEIVTFGCRLNIYESEIIRKNLELSGLD--------NVAIFNTCAVTKSXXXXXXXXXXXXXXNNPDL
MIAB_YERPS      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_YERPB      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_YERP3      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPQL
MIAB_SPHAL      ------SFGCQMNVYDGERMAEMLGAEGYVPXXXXXXXXLVVLNTCHIREKAAEKVYSDIGRLKRDDGST
MIAB_ACTSZ      -KLHIKTWGCQMNEYDSAKIADLLLSHGLELTEEAEQADVLLLNTCSIREKAQEKVFSQLGRWKNEKPGL
RIMO_DESHY      -KVAVVTLGCPKNQVDSEIMTGHMMTK-YQIVNEPEQADIIIINTCTFIESAKAESIDMILQMSQYKEEG
MIAB_STRCO      ------TYGCQMNVHDSERLSGLLEDAGYEGADGD--ADVVVFNTCAVRENADNKLYGNLGHLKASRPGM
MIAB_RHILO      -KVFIKTYGCQMNVYDSQRMGDALAADGYTATDAIDEADLVLLNTCHIREKAAEKVYSELGRIRDMKAER
MIAB_PSEA6      -KLFIKTWGCQMNEYDSQKMADLLSTHGYQVADTAEEADIILLNTCSIREKAQEKVFHQLGRLKQDKPEL
MIAB_NITSB      ------TLGCAMNVRDSEIIAELTQKEDYELTQNLQEADLILINTCSVREKPVHKLFSEIGYFNKKKKEA
MIAB_LEPBL      -KVYIETYGCQMNEYDSGIVSSLMKDAEYSSSPDPENSDIIFLNTCAIRENAHAKRLQSLGYLKKRNPEL
MIAB_LEPBJ      -KVYIETYGCQMNEYDSGIVSSLMKDAEYSSSPDPENSDIIFLNTCAIRENAHAKRLQSLGYLKKRNPEL
MIAB_XANCP      -KLYIKTHGCQMNEYDSAKMADVLAAEGLELTDNPEDADVVLVNTCSIREKAQEKVFSQLGRLKAGGKPV
MIAB_XANCB      -KLYIKTHGCQMNEYDSAKMADVLAAEGLELTDNPEDADVVLVNTCSIREKAQEKVFSQLGRLKAGGKPV
MIAB_XANC8      -KLYIKTHGCQMNEYDSAKMADVLAAEGLELTDNPEDADVVLVNTCSIREKAQEKVFSQLGRLKAGGKPV
MIAB_SHELP      -KLHIKTWGCQMNEYDSSKMADLLDEQGYTLTEEAEEADVLLLNTCSIREKAQEKVFHQLGRLKDKNPNL
MIAB_RALPJ      -KVFIKTYGCQMNEYDSDKMSDVLAAEGLVPTDTPEDADVILFNTCSVREKAQEKVFSELGRVKALKPDL
MIAB_MANSM      -KLHIKTWGCQMNEYDSSKMADLLQSHGLELTEEAEQADVLLLNTCSIREKAQEKVFHQLGRLKKKNPNL
MIAB_LEPCP      -KVYIRTFGCQMNEYDSDKMSDVMAAEGYTPTDDPEQADLILFNTCSVREKAQEKVFSDLGRVKHLKARG
MIAB_ACIBL      ------TFGCQMNFHDSEKVVGTLISQGYRQVETELDAGLILYNTCSIRDKAEQKVFHRLSEFRQLQKEG
MIAB_NITWN      -KLHIKSYGCQMNVYDAQRMADTLAVEGYVETTSAEDADLVILNTCHIREKASEKVYSELGRLRAAKDQA
MIAB_AZOC5      -KLYVKSFGCQMNVYDSQRMADALAKEGYVETQDPADADLVILNTCHIREKAAEKVYSELGRLRKAKQDA
RIMO_CLOD6      LKIALESLGCSKNLVDAEIMMGILNNKGYKLIGDFEEADVIIVNTCGFIESAKQESIDTIAELKKTGNLK
MIAB_ZYMMO      ------SFGCQMNSYDGERMSELLESQGMKAAEEAATADLVVLNTCHIREKAAEKVYSEIGRLRRPDGSS
MIAB_CORU7      ------TFGCQMNVHDSERLSGLLEDSGYQPAANGEEPDVLVFNTCAVRENADNRTLAMVKPMKDRNPGM
MIAB_XANP2      -KLYVKSFGCQMNVYDSHRMADTLAREGFVETQDPAEADLVILNTCHIREKAAEKVYSELGRLRKQKQEA
MIAB_RHOPB      -KLHIKSFGCQMNVYDAQRMVDALAPEGFVETANADEADLVILNTCHIREKASEKVYSELGRLRVAKDEA
MIAB_PARDP      -KLFIKTYGCQMNVYDSQRMAEAMGAEGYVLTENQSDADMVLLNTCHIREKAAEKLYSDLGRLKAERPDL
MIAB_MYCUA      ------TYGCQMNVHDSERMAGLLEAAGYRRAAEGTDADVVVFNTCAVRENADNKNLSHLAPRKRTSPDM
MIAB_MYCS2      ------TYGCQMNVHDSERLSGLLESAGYQRAAEGTDADIVVFNTCAVRENADNKNLSHLAPRKQADPNM
MIAB_GEOLS      -KLYIDTVGCQMNVNDSERIVTMLQPLGYTQTSRRHEAALILFNTCTVRAGAEECLLQNIANLKRKKPGT
MIAB_GEOBB      -KLYLETFGCQMNVSDSEKIVTLMKGMGYQQTQDPVDADLVLLNTCSIRATAEQRVYGHLGKIKKTKPGL
MIAB_ACAM1      ------TYGCQMNKADSERMAGVLENMGYQWSENPDDANLILCNTCTIRDNAEHKVYSYLGRAKRKHPDL
MIAB2_MYCMM     ------TYGCQMNVHDSERMAGLLEAAGYRRAAEGTDADVVVFNTCAVRENADNKNLSHLAPRKRTSPDM
MIAB_YERE8      -KLHIKTWGCQMNEYDSSKMADLLASHGYQLTEIPEEADLLLLNTCSIREKAQEKVFSLLGQLKEKNPEL
MIAB_SHESH      -KLHIKTWGCQMNEYDSSKMADLMDEEGYTLTEEASEADVLLLNTCSIREKAQEKVFHQLGRWKKKNPDL
MIAB_SHEAM      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQLGRLKDKNPDL
MIAB_RHOS5      -KLFIKTYGCQMNVYDSERMAEALGAKGYVLTEVAEEADMVLLNTCHIREKAAEKVYSDLGRLRPARPDL
MIAB_PROMP      ------TFGCQMNKADSERMAGTLEKMGYSRAIDELKADLVLYNTCTIRDSAQQKVYSFLGKQKHSTPKL
MIAB_PHOLL      -KLYIKTWGCQMNEYDSSKMADLLESHGYQLTDVAEEADILLLNTCSIREKAQEKVFHQLGRWKNTNPDL
MIAB_NITEC      -KLYIKTFGCQMNEYDSAKMADILLSENMELTEVPEEADLILFNTCSVREKAQEKVFHDLGRVRHSKPDL
MIAB_COLP3      -KLYIKTWGCQMNEYDSQKMAELLSTHGFSLVEEAEQADVILLNTCSIREKAQEKVFHQLGRWKNKKPDL
MIAB_PSYWF      -KVYIATQGCQMNVYDSEKMGNVLGDSHDMVVTDNEEADVLLMNTCSIREKAQEKVFSELGRWRKEKPDL
MIAB_PARD8      -KLFIETYGCQMNVADSEVVASIMKMDGYSMTENIEEADAIFVNTCSVRDNAEQKRLQYFQSLKRKKKSL
MIAB_SYNY3      ------TFGCQMNKADSERMAGILENLGMTYTDDPNQADLVLYNTCSIRDNAEQKVYSYLGRQAKRKPEL
MIAB_LEPIN      -KVYIETYGCQMNEYDSGIVSSLMRDAEYSTSSDPENSDIIFLNTCAIRENAHAKRLQSLGYLKKRNPNL
MIAB_LEPIC      -KVYIETYGCQMNEYDSGIVSSLMRDAEYSTSSDPENSDIIFLNTCAIRENAHAKRLQSLGYLKKRNPNL
MIAB_GRAFK      -KLFIESYGCAMNFSDSEIVASILSKEGFNTTQNLEEADLVLVNTCSIREKAEQTVRKRLEKVKRINPGM
MIAB_RHOBA      --VYIKTVGCQMNVLDSEMVIADLKRHGYTVVDTPGEADLLLYNTCSIREQAEEKTYSALGKLKERHPEK
MIAB_LAWIP      ------TFGCQMNTNDSFWLSCSLQKKGFQEVSLED-ASIIIINTCSVREKPEQKVYSILGKIRKNNPDS
MIAB_STRAW      ------TYGCQMNVHDSERLSGLLEDAGYRAPDGSDGADVVVFNTCAVRENADNRLYGNLGRLKTKRPGM
MIAB_RENSM      ------TYGCQMNVHDSERMAGLLERSGLVKAE-GKVADVVVFNTCAVRENADNKLYGNLGMAKEANPGM
MIAB_CAMFF      -KLFIETLGCAMNVRDSEIIAELSQKENYEVTNIIEDADLILINTCSVREKPVHKLFSEVGTYEKAKKKA
MIAB_PSESM      -KLYIETHGCQMNEYDSSRMVDLLEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQLGRWREANPEM
MIAB_SERP5      -KLHIKTWGCQMNEYDSSKMADLLSTHGYQWTDNAEEADVLLLNTCSIREKAQEKVFAMLGRWREKNPAL
MIAB_SALAI      ------TYGCQMNVHDSERIAGLLEQAGYRAGXXXXXXXXXXFNTCAVRENADNRLYGNLGQLRPRHPGM
MIAB_RALEH      -KVFVKTYGCQMNEYDSDKMVDVLASQGLEPTDNVEEADVILFNTCSVREKAQEKVFSELGRMKALKPDL
MIAB_MYCTU      ------TYGCQMNVHDSERLAGLLEAAGYRRATDGSEADVVVFNTCAVRENADNRNLSHLAPRKRANPDM
MIAB_MYCTA      ------TYGCQMNVHDSERLAGLLEAAGYRRATDGSEADVVVFNTCAVRENADNRNLSHLAPRKRANPDM
MIAB_MYCBP      ------TYGCQMNVHDSERLAGLLEAAGYRRATDGSEADVVVFNTCAVRENADNRNLSHLAPRKRANPDM
MIAB_MYCBO      ------TYGCQMNVHDSERLAGLLEAAGYRRATDGSEADVVVFNTCAVRENADNRNLSHLAPRKRANPDM
MIAB_MICAN      ------TFGCQMNKADSERMAGILEDLGFQWSEDANEADLILYNTCTIRDNAEQKVYSYLGRQAKRKPDL
MIAB_LEGPL      -KLYIKTNGCQMNEYDSSKMAEVYASHGLVKTDQVEDADVILLNTCSIREKAQEKVFSQLGQWREKNPHV
MIAB_LEGPH      -KLYIKTNGCQMNEYDSSKMAEVYASHGLVKTDQVEDADVILLNTCSIREKAQEKVFSQLGQWREKNPHV
MIAB_LEGPC      -KLYIKTNGCQMNEYDSSKMAEVYASHGLVKTDQVEDADVILLNTCSIREKAQEKVFSQLGQWREKNPHV
MIAB_LEGPA      -KLYIKTNGCQMNEYDSSKMAEVYASHGLVKTDQVEDADVILLNTCSIREKAQEKVFSQLGQWREKNPHV
MIAB_DINSH      -KLYIKTYGCQMNVYDSERMAEAMGGEGYVQTDRAEDADMILLNTCHIREKAAEKVYSELGRLKAEKPDL
MIAB_CUPTR      -KVFVKTYGCQMNEYDSDKMVDVLASQGLEATDNVEDADVILFNTCSVREKAQEKVFSELGRMKALKPDL
MIAB_SODGM      -KLHIKTWGCQMNEYDSSKMADLLSTHGYQLTDNPEEADVLLLNTCSIREKAQEKVFHQLGRLKEARPEL
MIAB_SHEWM      -KLHIKTWGCQMNEYDSSKMADLMDEKGYTLTEEAEEADVLLLNTCSIREKAQEKVFHQLGRWKKKNPNL
MIAB_SHEHH      -KLHIKTWGCQMNEYDSSKMADLLDEEGYTLTDNAEEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPEL
MIAB_RHOFD      -KVFIKTYGCQMNEYDSDKMSDVLAAQGYEPTDNVEEADLILFNTCSVREKAQEKVFSDLGRVKHLKKKA
MIAB_PSEU2      -KLYIETHGCQMNEYDSSRMVDLLEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQLGRWREANPEM
MIAB_POLNA      -KVFIKTFGCQMNEYDSDKMSDVLAAEGYENTQNIDEADLILFNTCSVREKAQEKVFSDLGRVKHLKAKG
MIAB_NOCFA      ------TFGCQMNVHDSERLSGLLEDAGYVKAAPGATADLVVFNTCAVRENADNKLYGTLGHVKAGRPGM
MIAB_WOLTR      ------TYGCQMNVYDSILMENIIKPLGFNVVNDVEKADLVILNTCHIREKAAEKLYSELGKSSRKNKEI
MIAB_MARMS      -KLFIQTHGCQMNEYDSSRMAD-LLGESHEMTDNAEEADVLLLNTCSIREKAQDKVYHQLGRLKQKNPNL
MIAB_HYPNA      ------TYGCQMNVYDSERIRDVLRPLGYAPVETPESADLVVVNTCHIREKATEKVYSELGQLKRMKEAS
MIAB_ERWCT      -KLHIKTWGCQMNEYDSSKMADLLSTHGYELTEIAEEADVLLLNTCSIREKAQEKVFHQLGRLKDLNPNL
MIAB_ACIAC      -KVFVKTFGCQMNEYDSDKMVDVLAAQGYEPTQDVEEADLILFNTCSVREKAQEKVFSDLGRIKHLKARG
MIAB_WOLSU      -KLFIQTLGCAMNVRDSEHMAELEAKEGYTLTDDPKEADLILINTCSVREKPERKLFSEIGQSKEKKEEA
MIAB_VIBVU      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEEPEEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPGV
MIAB_STRMK      -KLYIKTHGCQMNEYDSAKMADVLAADGLELTDTPEDADVILVNTCSIREKAQEKVFSQLGGLKNKGREV
MIAB_SHESA      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQLGRLKDKNPDL
MIAB_PSE14      -KLYIETHGCQMNEYDSSRMVDLLEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQLGRWREANPEM
MIAB_PROMH      -KLYIKTWGCQMNEYDSSKMADLLESHGYQLTDVAEDADILLLNTCSIREKAQEKVFHQLGRWKNNKPDI
MIAB_NEOSM      -KFHIKTYGCQMNVYDSE-MIEKIVSGGFTLSERAEDADLIILNTCNIREKAAEKLYSELGQIRKKQERI
MIAB_GEOMG      ------TFGCQMNVSDSEKVASLLRGEGYSQTPDSSEADLIIVNTCSVRAKAEHKSYXXXXXXXXXXXXX
MIAB_VIBVY      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEEPEEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPGV
MIAB_STRM5      -KLYIKTHGCQMNEYDSAKMADVLAADGLELTDSPDDADVILVNTCSIREKAQEKVFSQLGSLKNKGREV
MIAB_SHEPA      -KLHIKTWGCQMNEYDSSKMADLLDEEGYTLTDNAEEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPGL
MIAB_METPP      -KVFIKTFGCQMNEYDSDKMADVLAAEGYEPTTDVEQADLILFNTCSVREKAQEKVFSDLGRVKHLKARG
MIAB_HELP2      MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKMADLILINTCSVREKPERKLFSEIGQAKIKKPNA
MIAB_SHESR      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQLGRLKDKNPDL
MIAB_ERYLH      ------SFGCQMNVYDGERMAEMLDEKGIEPAPEGEDADLVVLNTCHIREKAVDKVYSDIGRGKTQTKAP
MIAB_WOLPM      ------TYGCQMNVYDSVLMENVIKPLGFNVVSDAGKADLVILNTCHIREKAAEKLYSELGKIHSLRKEM
MIAB_PROM4      ------TFGCQMNKADSERMAGILERMGYKQAEEELQADLVLYNTCTIRDNAEQKVYSYLGRQKKLFPQL
MIAB_GLUDA      ------TWGCQMNVYDSARMTDVLRPLGYHPVDTPDTADMVILNTCHIRDRAAEKVFSELGRLRTEGQQT
MIAB_THET8      MRAHIITYGCQMNEYDSHLVASELVSLGWELVDSVEEADFVLVNTCAVRGKPVEKVRSLLGQLRKEKERR
MIAB_THET2      MRAHIITYGCQMNEYDSHLVASELVSLGWELVDSVEEADFVLVNTCAVRGKPVEKVRSLLGQLRKEKERR
MIAB_SHEFN      -KLHIKTWGCQMNEYDSSKMADLLDDQGYTLTEDASEADVLLLNTCSIREKAQEKVFHQLGRLKDKNPNL
MIAB_RHOPS      -KLHIKSYGCQMNVYDAQRMVDVLAPEGFVETATVDDADLVILNTCHIREKASEKVYSELGRLRLARDEA
MIAB_HELPJ      MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKMADLILINTCSVREKPERKLFSEIGQAKIKKPNA
MIAB_SHEON      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQLGRLKDKNPDL
MIAB_POLSJ      -KVFIKTFGCQMNEYDSDKMSDVLAAEGYEPTQNVDEADLILFNTCSVREKAQEKVFSDLGRVKHLKEKG
MIAB_ALTMD      -KLYIKTWGCQMNEYDSEKMADLLSTHGFSAAQSAEEADVILLNTCSIREKAQEKVFHQLGRLKQDKPEL
MIAB_SHESM      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQLGRLKDKNPDL
MIAB_RHOP2      -KLHIKSYGCQMNVYDAQRMVDVLAPEGFVETASVDDADLVILNTCHIREKASEKVFSELGRLRLARDEA
MIAB_HELPH      MKVYIETMGCAMNSRDSEHLLSELSKLDYKETNDPKIADLILINTCSVREKPERKLFSEIGQAKIKKPNA
MIAB_STRGG      ------TYGCQMNVHDSERLSGLLEGAGYEGSDGD--ADVVVFNTCAVRENADNKLYGNLGRLKTKRPGM
MIAB_HELAH      LKVYIETMGCAMNSRDSEHLLSELSKLDYKETNDPKIADLILINTCSVREKPERKLFSEIGQAKIKKPNA
MIAB_AERS4      -KLHIKTWGCQMNEYDSSKMADLLASNGYTLTEEPEEADVLLLNTCSIREKAQEKVFHQLGRWKKNKPGL
MIAB_SHEDO      -KLHIKTWGCQMNEYDSSKMADLLDEQGYTLTDDATEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPGL
MIAB_RALME      -KVFVKTYGCQMNEYDSDKMVDVLATQGMEPTDNVEDADVILFNTCSIREKAQEKVFSELGRMKAAKPDL
MIAB_RALEJ      -KVFVKTYGCQMNEYDSDKMVDVLASQGLEPTDNVEDADVILFNTCSVREKAQEKVFSELGRMKALKPDL
MIAB_BUCAI      ------TWGCQMNEYDSSMIITLLEKNNYSLTKSAENADILILNTCSIREKAQEKVFHQLGRXXXXXXXX
MIAB_ACIC1      ------TFGCQMNMHDSERIAGLLEAAGYVRAADDEPADVVVFNTCAVRENADNRLYGNLGLVKKAKPDM
RIMO_ALKMQ      LSVYVESLGCSKNLIDAEVMLGILNQYGYKLTNNEVKADVIIVNTCGFIEAAKEESNKIIELGQXXXXXX
MIAB_VIBCH      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEIPEEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPGV
MIAB_VIBC3      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEIPEEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPGV
MIAB_HELPY      MKVYIETMGCAMNSRDSEHLLSELSKLDYKETNDPKTADLILINTCSVREKPERKLFSEIGQAKIKKPNA
MIAB_ARTS2      ------TFGCQMNVHDSERMAGMLEDAGY-VPASGENADVVVFNTCAVRENADNKLYGNLGMVKAANPGM
MIAB_VIBPA      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEEPEEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPGV
MIAB_SACD2      -KLYIQTHGCQMNEYDSSRMRD-LLGASHDMVDNPEEADVLLVNTCSIREKAQEKLFHQLGRLKEAKPDL
MIAB_PROM9      ------TFGCQMNKADSERMAGTLEKMGYTRADDELNADLVLYNTCTIRDNAEHKVYSFLGRAKRKHPSL
MIAB_PELUB      -KIFIKTFGCQMNEYDSNRIFDTVKKIGFEKTEKYEDANCYLLNTCHIRDKAKEKVYHEIGRVKREKKKP
MIAB_ERWT9      -KLHIKTWGCQMNEYDSSKMADLLSTHGYTLTEQAEDADVLLLNTCSIREKAQEKVFALLGRWKKSNPDM
MIAB_COXBU      -KLYLKTHGCQMNEYDSAKMADKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSELGRWREKRPHV
MIAB_COXBR      -KLYLKTHGCQMNEYDSAKMADKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSELGRWREKRPHV
MIAB_COXB2      -KLYLKTHGCQMNEYDSAKMADKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSELGRWREKRPHV
MIAB_COXB1      -KLYLKTHGCQMNEYDSAKMADKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSELGRWREKRPHV
MIAB_AERHH      -KLHIKTWGCQMNEYDSSKMADLLASNGYTLTEEPEEADVLLLNTCSIREKAQEKVFHQLGRWKKNKPGL
MIAB_PSEPF      -KLYIETHGCQMNEYDSSRMVDLLEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQLGRWREANPDM
MIAB_LEIXX      ------TFGCQMNVHDSERLSGSLEAAGYVPAN-GEEADIVVINTCAVRENADNKLYGNLGHVKRRHAGM
MIAB_HELPG      MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKTADLILINTCSVREKPERKLFSEIGQAKIKKPNA
MIAB_COXBN      -KLYLKTHGCQMNEYDSAKMADKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSELGRWREKRPHV
MIAB_BORPA      -KLYIRTFGCQMNEYDSDKMADVLADQGLELTDNPEDADVILFNTCSVREKAQEKVFSDLGRVKKQNPNL
MIAB_SYNS3      ------TFGCQMNKADSERMAGILETMGYQEANAELDADLVLYNTCTIRDNAEQKVYSYLGRQKRTNPNL
MIAB_AZOSB      -KLYIRTFGCQMNEYDSEKMADVLAGEGIAKTDNPEEADVILFNTCSVREKAQEKVFHDLGRVKQLKPDL
RIMO_CLOPE      -KVGMVSLGCDKNRVDSEIMLG-MVQNEYELTNNPKEADIIIVNTCGFIEKAKQESINTIAKYKTSHNCK
RIMO_CLOP1      -KVGMVSLGCDKNRVDSEIMLG-MVQNEYELTNNPKEADIIIVNTCGFIEKAKQESINTIAKYKTSHNCK
MIAB_PSEF5      -KLYIETHGCQMNEYDSSRMVDLLEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQLGRWREANPDM
MIAB_NITOC      -KLYIKTHGCQMNEYDSSRMAD-VLREGLELTSDPEQAEVLLLNTCSVREKAQEKVFSQLGRWRQSRPEL
MIAB_MYCSS      ------TYGCQMNVHDSERLAGLLEXXXXXXXXXXXXXXVVVFNTCAVRENADNKNLSHLAPRKRSEPQM
MIAB_MYCSK      ------TYGCQMNVHDSERLAGLLEXXXXXXXXXXXXXXVVVFNTCAVRENADNKNLSHLAPRKRSEPQM
MIAB_HERA2      ------TVGCQMNVSDSERLESALQGVGYTPAEQAEDADFIVLNSCSVRANAEEK---IIGRIKRERPDT
MIAB_GEOSL      ------TFGCQMNVNDSEKIATLLKDEGYLPTDDPERADLVILNTCSVRAKAEQKVYGHLGRVRSRKKGF
RIMO_CLOPS      -KVGMVSLGCDKNRVDSEIMLG-MVQNEYELTNNPKEADIIIVNTCGFIEKAKQESINTIAKYKTSHNCK
MIAB_VIBHB      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEEPEEADVLLLNTCSIREKAQEKVFHQLGRLKDKKPGV
MIAB_SHEB9      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEEASEADILLLNTCSIREKAQEKVFHQLGRLKDKNPNL
MIAB_SHEB8      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEEASEADILLLNTCSIREKAQEKVFHQLGRLKDKNPNL
MIAB_OLICO      -KLHIKSYGCQMNVYDAQRMVDTLAPEGFVETADPAEADLVILNTCHIREKASEKVFSELGRLRRTGREM
MIAB_MYCSJ      ------TYGCQMNVHDSERLAGLLEXXXXXXXXXXXXXXVVVFNTCAVRENADNKNLSHLAPRKRSEPQM
MIAB_BAUCH      LKLHIKTYGCQMNQYDSSKIVDLLKNHKYQLTDIAEEADILLLNTCSIREKAQEKLFHQLGRWRRLNPNL
MIAB_SULNB      -KLFIETLGCAMNVRDSEHMAELNQKEPYELTQNVEEADLIIINTCSVREKPVAKLFSEIGVFNKKKPGA
MIAB_SHEB5      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEEASEADILLLNTCSIREKAQEKVFHQLGRLKDKNPNL
MIAB_NITEU      -KLYIRTFGCQMNEYDSAKMADILLSEGMELAETPEEADLILFNTCSVREKAQEKVFHDLGRVRHSKPDL
MIAB_MYCVP      ------TYGCQMNVHDSERLAGLLXXXXXXXXXXXXXXXIVVFNTCAVRENADNKNLSHLAPRKQSDPDM
RIMO_CLOPH      MKIFFISLGCDKNLVDSEVMLGLIRDRGFELTNDESEADIIVVNTCCFIHDAKEESNTILEMAEYKKSGS
MIAB_HELPS      MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKAADLILINTCSVREKPERKLFSEIGQAKIKKPNA
MIAB_ACICJ      ------TWGCQMNVYDSGRMADVLRPLGYRQVATQD-ADMVILNTCHIRERASEKLFSELGRLRARGGAM
MIAB_PSEMY      -KLYIETHGCQMNEYDSSRMVDLLEHQALEVTEKPEEADVILLNTCSIREKAQDKVFSQLGRWRQANPDL
MIAB_FRATW      -KVFIKTLGCQMNEYDSARMHE-VLNEHFDTVKTDDYADIILINTCSIREKAQEKVFHELGRLKKTNEDL
MIAB_FRATT      -KVFIKTLGCQMNEYDSARMHE-VLNEHFDTVKTDDYADIILINTCSIREKAQEKVFHELGRLKKTNEDL
MIAB_FRATN      -KVFIKTLGCQMNEYDSARMHE-VLNEHFDTVKTDDYADIILINTCSIREKAQEKVFHELGRLKKTNEDL
MIAB_FRATM      -KVFIKTLGCQMNEYDSARMHE-VLNEHFDTVKTDDYADIILINTCSIREKAQEKVFHELGRLKKTNEDL
MIAB_FRAT1      -KVFIKTLGCQMNEYDSARMHE-VLNEHFDTVKTDDYADIILINTCSIREKAQEKVFHELGRLKKTNEDL
RIMO_CLOK5      LKVGLISLGCDKNRVDSEIILGN-VKSAYEIVTDPKLADFIIINTCGFIESAKQESIDTILEMSQYKGKY
MIAB_THICR      ------TYGCQMNEYDSDRMAKLLEKTGLNLVETPEEADMLLLNTCSVREKAQEKVFDELGRWKKAKPNR
MIAB_RHOSR      ------TYGCQMNVHDSERLSGLLEDAGYTKAAAGQAPDLVVFNTCAVRENADNKNLSHLAPAKERNPDM
MIAB_HAHCH      -KLFIKTYGCQMNEYDSSRMADLLGESSVELTDNPDEADILLLNTCSIREKAQEKVFHQLGRLKEKNPNL
MIAB_CAMC5      -KLFIQTLGCAMNVRDSEIIAELSQKEDYTLTQNLEEADLILINTCSVREKPVHKLFSEVGAFEKAKKNA
RIMO_CLOTE      IKYGVVSLGCDKNRIDSEVMINEIKKEGIITNDPKE-ADVIIVNTCGFIEDSKKESIDTILEMSKNNNCK
MIAB_SOLUE      ------TFGCQMNAHDSEKVVGTLLAEGYEQVATPEAAELVFYNTCSIRDKAEQKVFNRLQNFKREGMKG
MIAB_SHESW      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEDASEADILLLNTCSIREKAQEKVFHQLGRLKDKNPNL
MIAB_SHEPC      -KLHIKTWGCQMNEYDSSKMADLLGEQGYTLTEDASEADILLLNTCSIREKAQEKVFHQLGRLKDKNPNL
MIAB_OPITP      -RVHIKTYGCQMNERDSEAVAAMLRARGYRIVADENDCDILLLNTCSVRDAAEQKA---IGKAKKKQPDF
MIAB_FRAP2      -KVFIKTLGCQMNEYDSQKMHEVLDEHFHTVTDDYKEADIILINTCSIREKAQEKVFHELGRLKKKKEDL
MIAB_AZOSE      -KLYIRTFGCQMNEYDSDKMADVLASEELVKTDNPEEADVILFNTCSVREKAQERVFHDLGRVKQSNPNL
MIAB_VIBFM      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEEPTEADVLLLNTCSIREKAQEKVFHQLGRWKNKKPDL
MIAB_VIBF1      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEEPTEADVLLLNTCSIREKAQEKVFHQLGRWKNKKPDL
MIAB_CHRSD      -KLFIKTHGCQMNEYDSARMADLLGESALELTDDERDADVILLNTCSIREKAQEKVFHQLGRWKKANPDL
MIAB_PSEHT      -KLHIKTWGCQMNEYDSQKMAELLATNGYQLTDDATDADVILLNTCSIREKAQEKVFHQLGRLKDDKPDL
MIAB_PELPD      --VYIETFGCQMNVNDSERILTMLADIGYVPTQEPARARLILLNTCSVRAGAEEKVYRRLENLKRHNSRL
MIAB_SYNPX      ------TFGCQMNKADSERMAGILESMGYRAANAELEADLVLYNTCTIRDNAEQKVYSYLGRQKRLDPNL
MIAB_PSYCK      -KVFVTTQGCQMNVYDSGKMLDVLGSHGMEVTHNIDEADVLLMNTCSIREKAQEKVFSELGRWRKKRPDL
MIAB_PSEU5      -KLFIETHGCQMNEYDSSRMVDLLEHQAMEITENPAEADVILLNTCSIREKAQEKVFSQLGRWRQDNPQL
MIAB_MYCLE      ------TYGCQMNVHDSERLAGLLEAAGYQXXXXXXXXXXXXFNTCAVRENADNRNLSHLAPRKRNNPDM
RIMO_PROMS      -KVAFSHVGCEKNLVDTEHMQGLLDKEGYEVDSNINDANVVVVNTCSFIETAREESIRKILEYTNQGKEV
RIMO_PROM2      -KVAFSHVGCEKNLVDTEHMQGLLDKEGYEVDSNINEANVVVVNTCSFIQTAREESIRKILEYTNQGKEV
MIAB_PHOPR      -KLLIKTWGCQMNEYDSSKMADLLAANGFELTEVPEEADVLLLNTCSIREKAQEKVFHQLGRWKRKKPDL
MIAB_PHEZH      ------TYGCQMNVYDSERMADVLAPLGYGVTDDPAAADLVVLNTCHIREKATEKVYSELGQIKREGQGM
MIAB_PSYIN      MKLHVKTWGCQMNEYDSSKMADLLSTNGYISVEHAEDADVVLLNTCSIREKAQEKVFHQLGRWKKNKPNL
RIMO_PROM0      -KIAFSHVGCEKNLVDTEHMQGLLHKEGYEVDSNINDANVVVVNTCSFIETAREESIRKILEYTNQGKEV
MIAB_MAGSA      ------TYGCQMNVYDSARMADVLAPLGYGPADHAEEADMVILNTCHIREKAAEKVFSELGRLRKLQARM
MIAB_PSEAE      -KLFIETHGCQMNEYDSSRMADLLEHQALEVTENAAEADVILLNTCSIREKAQEKVFSKLGMWRQQNPDL
MIAB_PSEAB      -KLFIETHGCQMNEYDSSRMADLLEHQALEVTENAAEADVILLNTCSIREKAQEKVFSKLGMWRQQNPDL
MIAB_KINRD      ------TFGCQMNVHDSERLSGLLEDAGY--VRFDEAGDVVVFNTCAVRENADNKLYGNLGHVKERRPGM
RIMO_CLOBA      -KVGMVSLGCDKNRVDSEIILGKMSSE-YEITNNAKEADVIIVNTCGFIESAKQESIDILEMAEYKNNYK
MIAB_PSEA7      -KLFIETHGCQMNEYDSSRMADLLEHQALEVTENAAEADVILLNTCSIREKAQEKVFSKLGMWRQQNPDL
MIAB_DEIRA      MKAHLITYGCQMNEYDTHLVQSQLVSFGADIVESPDEADFVLVNTCAVRGKPVDKVRSLLGDLRKQKAQR
MIAB_AZOPC      -RIFIETYGCQMNIADSEIVIAIVQMDGFEYTENILEADVVLINTCSVRENAEKKSRQYFQSLKKKRNQL
MIAB_SYNP6      ------TFGCQMNKADSERMAGILEDLGYIWSEEANDADLVLYNTCTIRDNAEQKVYSYLGRQKRQQPDL
MIAB_SYNE7      ------TFGCQMNKADSERMAGILEDLGYIWSEEANDADLVLYNTCTIRDNAEQKVYSYLGRQKRQQPDL
MIAB_ALISL      -KLLIKTWGCQMNEYDSSKMADLLAANGYELTEDPKEADVLLLNTCSIREKAQEKVFHQLGRWKHKKPDL
RIMO_SYNS9      -KVAFAHLGCEKNRVDTEHMVGLLAEAGYGVSTDEEDASVVVVNTCSIQDAREESVRTLVGLAE-QGKEL
MIAB_SYNS9      ------TFGCQMNKADSERMAGILESMGYCEATAELDADLVLYNTCTIRDNAEQKVYSYLGRQKRDNPNL
MIAB_HALHL      -RVYVETQGCQMNDYDAERLVDVLVSQGARRVDRPEEADLLLLNTCSVREKAQEKVFSQLGRWRRDNPTV
MIAB_FRATO      -KVFIKTLGCQMNEYDSARMHE-VLNEHFDTVKTDDYADIILINTCSIREKAQEKVFHELGRLKKTNEDL
MIAB_FRATH      -KVFIKTLGCQMNEYDSARMHE-VLNEHFDTVKTDDYADIILINTCSIREKAQEKVFHELGRIKKTNEDL
MIAB_FRATF      -KVFIKTLGCQMNEYDSARMHE-VLNEHFDTVKTDDYADIILINTCSIREKAQEKVFHELGRLKKTNEDL
MIAB_CAMC1      -KLFIQTLGCAMNVRDSEIIAELSQKEDYSLTQNIEEADLILINTCSVREKPVHKLFSEVGAFEKAKKRA
MIAB_ACIBS      -KLYIETQGCQMNEYDSHRMADLLGSHGYVLTNNPNEADILLMNTCSIREKAQEKVFSELGRWRKQNPDL
RIMO_THETN      --VGIISLGCPKNSVDSEKMLALLKEKGYNIVNDEKKADVIIINTCAFIEDAKKESIEYIGELKKKRLKY
RIMO_PROM4      --VAFLHLGCEKNLVDTEHMMGLLASEGYGVSSNTDDAEVVVVNTCSFIEQAREESRALVGLAD-QGKEI
RIMO_BDEBA      -KVHFISLGCPKNLVDSEIMAGTLMKDGYEVVGEADQADTVIVNTCGFIEDSKKESIQRISDLKQEGKIK
MIAB_PSYA2      -KVFVTTQGCQMNVYDSGKMLDVLGSHGMEVTHDIDEADVLLMNTCSIREKAQEKVFSELGRWRKKRPDL
MIAB_IDILO      -KLYIKTWGCQMNEYDSTKMAELLSTHGYDVAEEAEDADLILLNTCSIREKAQEKVFHQLGRXXXXXXXX
MIAB_BUCAP      ------TWGCQMNEYDSSMITVFLEKTGYLITKEVEKADILILNTCSIREKAQEKVFHQLGRWKKKKPDV
MIAB_BDEBA      --VYISTYGCQMNVNDTERMYALLEMQNFVPVTDPKKASLIIINSCSVREKPVHKVYSEVGTMKRKNPEL
MIAB_ACIBY      -KLYIETQGCQMNEYDSHRMADLLGSHGYVLTNNPNEADILLMNTCSIREKAQEKVFSELGRWRKQNPDL
MIAB_ACIBC      -KLYIETQGCQMNEYDSHRMADLLGSHGYVLTNNPNEADILLMNTCSIREKAQEKVFSELGRWRKQNPDL
MIAB_ACIB5      -KLYIETQGCQMNEYDSHRMADLLGSHGYVLTNNPNEADILLMNTCSIREKAQEKVFSELGRWRKQNPDL
MIAB_ACIB3      -KLYIETQGCQMNEYDSHRMADLLGSHGYVLTNNPNEADILLMNTCSIREKAQEKVFSELGRWRKQNPDL
RIMO_THEPX      --VGIISLGCHKNTIDSEKMLAILKEKGYNIVNDENKADILIINTCGFIEDAKRESIECIGKLKKHRLKY
MIAB_GLUOX      ------TWGCQMNVYDSARMADVLRPLGYGPVERPEDADMVILNTCHIRERATEKVFSELGRLRKIRDET
MIAB_BIFLI      ------TLGCQMNVHDSERIAGVLEANGYVPATEDQIXXXXXXXTCAVRENAAERMYGTIGRFNRVKPNL
MIAB_ACIAD      -KLYIETQGCQMNEYDSHRMADLLGSHGYVLTTDPKEADILLMNTCSIREKAQEKVFSELGRWRKQNPDL
RIMO_PELTS      IKIGLVSLGCPKNLVDSEIMLGILKKAGYEITAREKEADVLIVNTCSFINDAKEESRTIIELARNKGRCR
MIAB_XANOR      -KLYIKTHGCQMNEYDSAKMADVLAAEGLELTDNPEEADVVLVNTCSIREKAQEKVFSQLGRLKAGGKPV
MIAB_TREDE      MTYFFETYGCQMNQAESSSMEQILLEKGWTNSSDAEHCDLLIINTCSVRITAENRVLGRLGHGLKKKRKF
MIAB_CHLT3      -RVYLETYGCQMNFSDTEIISSILSDAGYAIAESEQVADIIFLNTCAVRENAEQRIRNRLQNLRKQNPKL
RIMO_PROMP      -KVAFSHVGCEKNLVDTEHMQGLLDKEGYEVGNDIEDANVVVVNTCSFIETAREESIRKIIEFTDQGKEV
MIAB_XANC5      -KLYIKTHGCQMNEYDSAKMADVLAAEGLELTDNPEEADVVLVNTCSIREKAQEKVFSQLGRLKAGGKPV
MIAB_XANAC      -KLYIKTHGCQMNEYDSAKMADVLAAEGLELTDDPEEADVVLVNTCSIREKAQEKVFSQLGRLKAGGKPV
MIAB_SYNSC      ------TFGCQMNKADSERMAGILEAMGYREASAELDADLVLYNTCTIRDNAEQKVYSYLGRQKRSNPNL
MIAB_METCA      -KLYIETFGCQMNEYDSAKMRDLLVSDSFELARSPEEADVLLLNTCSIRDKAQEKVFSQLGRWRPRRPEV
MIAB_CHLCH      ------TFGCQMNQADSGIMTAILQNEGYVAASNEADAGIVLLNTCAVREHATERVGHLLGRKKRSKGRL
MIAB_BACTN      -KLFIETYGCQMNVADSEVIASVMQMAGYSVAETLEEADAVFMNTCSIRDNAEQKRLEFFHSLKKKKKAL
RIMO_THEP3      --VGIISLGCPKNTVDSEKMLAILKEKGYNIVNDKNKADILIINTCGFIEDAKRESIEYIGKLKNRRLKY
RIMO_PROM9      -KVAFSHVGCEKNLVDTQHMQGLLDKDGYEVESNINDANIVVVNTCSFIETAREESIRKILEYTNQGKEV
MIAB_CAMJ8      -KLFIQTLGCAMNVRDSEHMIAELTKENYALTEDIKEADLILINTCSVREKPVHKLFSEVGGFEKVKKEA
MIAB_BIFLO      ------TLGCQMNVHDSERIAGVLEANGYVPATEDQIXXXXXXXTCAVRENAAERMYGTIGRFNRVKPNL
MIAB_BIFLD      ------TLGCQMNVHDSERIAGVLEANGYVPATEDQIXXXXXXXTCAVRENAAERMYGTIGRFNRVKPNL
Y867_METJA      MRVYVEGYGCVLNTADTEIIKNSLKKHGFEVVNNLEEADIAIINTCVVRLETENRMIYRINELKNLGKEV
MIAB_ROSS1      ------TVGCQMNVSDSERLEAALQGVGYAPAERPEDASFIVLNSCSVRASAEERKLSEVQRLKRKHPDT
MIAB_BEII9      -KLFVKSYGCQMNVYDAERMADLLAPEGYAETSAPEDADLVILNTCHIREHAAEKVFSELGKLRLLKAEV
MIAB_ACIF5      ------TYGCQMNEYDSERMADTLVSHGXXXXXXXXXXXXXXXNTCSIREKAEDKVFTQLGFWRERRPEV
MIAB_ACIF2      ------TYGCQMNEYDSERMADTLVSHGXXXXXXXXXXXXXXXNTCSIREKAEDKVFTQLGFWRERRPEV
RIMO_GEOSL      -KVSMVSLGCPKNLVDAEVMLGRLAKDRYEITTDEREADIIIVNTCSIDTILDLADRKQDGRCR------
RIMO_CLONN      -KIGLISLGCDKNRIDSELLLGK-LNEKNDIVNDPNKADIIIVNTCGFIESSKQESIDTIAKYKEENCKM
MIAB_CELJU      -KLYIKTHGCQMNEYDSNRMRDLLGESHNMVATENEEADVILINTCSIREKAQEKLFHELGRLKKQNPEL
Y285_HELPY      -KVYFKTFGCRTNLFDTQVMSENL--KDFSTTLEEQEADIIIINSCTVTNGADSAVRSYAKKMARLDKEV
MIAB_XANOP      -KLYIKTHGCQMNEYDSAKMADVLAAEGLELTDNPEEADVVLVNTCSIREKAQEKVFSQLGRLKAGGKPV
MIAB_XANOM      -KLYIKTHGCQMNEYDSAKMADVLAAEGLELTDNPEEADVVLVNTCSIREKAQEKVFSQLGRLKAGGKPV
MIAB_THEEB      ------TFGCQMNKADSERMAGILEAMGLELAAEPDEADVLLYNTCTIRDNAEQKLYSYLGRQKHQDPNL
MIAB_SPHWW      ------SFGCQMNVYDGARMAELLEAQGMHXXXXXXXXXLVVLNTCHIREKAAEKVYSDIGRIVKKAADA
MIAB_GRABC      ------TWGCQMNVYDSARMTDVLSPLGYTAHAEPEGADMIVLNTCHIRDKATEKXXXXXXXXXXXXQPM
MIAB_FRAAA      ------TFGCQMNVHDSERLSGLLESAGYVPAPPGSEADVVVFNTCAVRENADNRLYGNLGQVKKGHPGM
MIAB_CAMJJ      -KLFIQTLGCAMNVRDSEHMIAELTKENYALTEDIKEADLILINTCSVREKPVHKLFSEVGGFEKVKKEA
MIAB_CAMJE      -KLFIQTLGCAMNVRDSEHMIAELTKENYALTEDIKEADLILINTCSVREKPVHKLFSEVGGFEKVKKEA
Y285_HELPJ      -KVYFKTFGCRTNLFDTQVMGENL--KDFSATLEEQEADIIIINSCTVTNGTDSAVRSYARKMARLDKEV
RIMO_TRIEI      --IAFTHLGCEKNRIDTEHIIGLLVQAGYEVDANEELADYVVVNTCSFIQAAREESVKTLVELAEANKKI
RIMO_DESRM      --IGLLSLGCPKNLVDSEVMLGLLRENNFTITNNEANADALIVNTCGFIESAKEESRHIFELAQRGKCKA
RIMO_ALKOO      MNVGFISLGCSKNLVVTEEIIGLFKSNHFNIVNKKEDAEIIVINTCGFIESAKQEANTILEMAKLKNNKC
MIAB_VEREI      -KVFIKTFGCQMNEYDSDKMADVLAAQGYEPTQNVEEADLILFNTCSVREKAQEKVFSDLGRVKHLKARG
MIAB_CAMJD      -KLFIQTLGCAMNVRDSEHMIAELTKENYALTEDIKEADLILINTCSVREKPVHKLFSEVGGFEKVKKEA
MIAB_METS4      MKKAFVSYGCQMNVYDAARMVDLLGREGFAETEAMEEADVVILNTCHIREKAAEKVYSELGRVRDAGRET
MIAB_METPB      MKKAYVSYGCQMNAYDAGRMADVLAAEGYSATESVEEADVVVLNTCHIREKAAEKVYSELGRLRESGQDT
MIAB_BACV8      -KLFIETYGCQMNVADSEVIASIMQMAGYHVCETLDEADAVFMNTCSIRDNAEQKNRLEFFHSMKKNKRR
MIAB_BACFR      -KLFIETYGCQMNVADSEVIASVMQMAGYSVAETLEEADAVFMNTCSIRDNAEQKRLEFFHSMKKKKKHL
MIAB_BACFN      -KLFIETYGCQMNVADSEVIASVMQMAGYSVAETLEEADAVFMNTCSIRDNAEQKRLEFFHSMKKKKKHL
MIAB_ANADF      -KVYVHTFGCQMNASDSDRMIELLGRHAFARAETPDDADLILLNTCAVREKAEQKLLSALGRYREVKARA
RIMO_CLOTH      -KVGIISLGCPKNLVDSEIMLGLLKKNDFEITSDSEEANVIIVNTCGFIESAKEESINTIANYKNKNCEM
RIMO_CLOBB      -KVGMVSLGCDKNRVDSEIILGKMSNE-YEITNNAKEADVIIVNTCGFIESAKQESIDILEMAEYKNNYK
MIAB_PROM1      ------TFGCQMNKADSERMSGILEYMGYYPAEEELKADLVLYNTCTIRDSAEQKVYSYLGRQKRSLPNL
MIAB_METC4      MKKAYVSYGCQMNAYDAGRMADVLAAEGYSATDTVEEADVVVLNTCHIREKAAEKVYSELGRLRESGQET
MIAB_FLAJ1      -KLFIESYGCAMNFSDSEVVASILSDGGYNTTSVLEEADLVLVNTCSIRDKAEQTIRKRLEKVKRTNPKM
MIAB_CHLTE      ------TFGCQMNQADSEIVTALLRAEGFVPSADETNADIVLLNSCAVRENAEERLGNILGRKRRCK-EL
MIAB_NOVAD      ------SFGCQMNVYDGERMAELLXXXXXXXXXXXXXXXLVVLNTCHIREKATEKVYSDIGRLRRADGSA
MIAB_MYCA1      -------------------------------------------NTCAVRENADNKNLSHLAPRKRSNPQM
MIAB_MAGSM      ------TFGCQMNSYDSTRMADLLGESAFQSTDDPEKADLIILNTCHIREKAEDKLFSELGRLRPLAERG
MIAB_FRASC      ------TFGCQMNVHDSERLCGLLESAGYSPVDPGGEADVVVFNTCAVRENADNRLYGNLGQVKKGHPGM
MIAB_FLAPJ      -KLFIESYGCAMNFSDSEIVASILSGNGYNTTNVLEEADLVLVNTCSIRDKAEQTIRKRLEKVKRINPKM
MIAB_CAMJR      -KLFIQTLGCAMNVRDSEHMIAELTKENYALTEDIKEADLILINTCSVREKPVHKLFSEVGGFEKVKKEA
MIAB_BORBR      -KLYIRTFGCQMNEYDSDKMADVLADQGLELTDNPEDADVILFNTCSVREKAQEKVFSDLGRVKKQNPNL
MIAB_SYNPW      ------TFGCQMNKADSERMAGILESMGYREASAELDADLVLYNTCTIRDNAEQKVYSYLGRQKRTNPNL
RIMO_RHOBA      -RYAVVSLGCPKNLVDTEQMLGRLDADGYRMVDSVDGADFVVVNTCGFIDSARDESMAAIDEMKRDGKLR
MIAB_MYCPA      -------------------------------------------NTCAVRENADNKNLSHLAPRKRGNPEM
MIAB_DEHE1      ------TIGCQMNQAESERLGRLFELWGYSLADKAEDAELVLVNSCVVREHAENKRLHILRKLKDKNPRL
MIAB_BORPE      ------TFGCQMNEYDSDKMADVLADQGLELTDNPEDADVILFNTCSVREKAQEKVFSDLGRVKKQNPNL
Y1729_PYRAB     VKIYIENYGCARNRADGEIMAALLHLAGHEIVYDPDEGEIVVVNSCAVKDPTERKIARRIKELLDSGKKV
MIAB_PROMT      ------TFGCQMNKADSERMSGILEYMGYYPAEEELKADLVLYNTCTIRDSAEQKVYSYLGRQKRSLPNL
MIAB_FRASN      ------TFGCQMNVHDSERLAGLLESAGYVPAPEGSDADVVVFNTCAVRENADNRLYGNLGHAKKSNPAM
RIMO_THELT      MKIGIKVLGCPKNEADCDVLEAILKDRGHEIVSDIEEAEAVIIDTCGFIESAKKESDEIITFANKKYRPF
RIMO_SYNPW      --VAFAHLGCEKNRVDTEHMLGLLSEAGYGVSSDESVANVVVVNTCSFIQEAREESRTLVGLAE-QGKEL
MIAB_MYXXD      ------TFGCQMNVNDSLRMSEVLSQMSYAPTPVPDNADLIILNTCSIREKAEDKMLSALGRYKKASRGA
RIMO_ANAVT      --IAISHLGCEKNRIDTEHMLGLLVKAGYGVDTNEELADYVIVNTCSFIESAREESVKTLVELAEANKK-
RIMO_SYNPX      --VAFAHLGCEKNRVDTEHMVGLLAQAGYGVSTNENDAAVVVVNTCSIQDAREESVRTLVGLAE-QGKEL
MIAB_RHOCS      -KLYIKTYGCQMNVYDSGRMADVLAPLGYEPTDAPDGADMVILNTCHIREKAAEKVYSDLGRLRATGGRM
MIAB_CHLP8      ------TFGCQMNMADTEIVTAILVEGGFAPAEDEGTADMVLLNTCAVRANAVDRAGNVLSHLKRRRKGL
MIAB_CYTH3      -KLYIESYGCQMNFSDSEIVMSILTEEGFDTTSTPNNADVILLNTCSIRDNAEQKVRHRLVHLKRNKPSM
MIAB_ANASK      ------TFGCQMNESDSDRMVELLGRHXXXXXXXXXXXDLILLNTCAVREKAEQKLLSALGRYREVKARA
RIMO_GEOUR      -KVSLVSLGCPKNLVDAEVMLGYLAKEKYEVTTDEREADIIIVNTCSFIKEAKQESIDTILDLADRKHDA
RIMO_PROM5      -KVAFSHVGCEKNLVDTEHMQGLLDKEGYEVGNNLEDAKVVVVNTCSFIETAREESIRKILEFTDQGKQV
RIMO_PROM3      --VAFAHLGCEKNRVDTEHMLGLLTEAGYSVSSDENDAAVVVVNTCSIQDAREESVRTLIGLAE-QGKEL
RIMO_CALS8      VKVGFVSLGCNKNLVDSEIMMGACKEAGFEITPNAEDADVIVINTCGFINDAKQESIDILEMAEYKNKKC
MIAB_PROVI      ------TFGCQMNQADSAIITAILMDGGFRVAGSQEDADIVILNTCAVRENAVERQLQFLRGAKRRKKSL
MIAB_MARAV      -KLYIKTHGCQMNEYDSARMADLLTGEAVEVTXXXXXXXXXXXXTCSIREKAQEKVFHQLGRLKTKKPDL
RIMO_ANASP      --IAISHLGCEKNRIDTEHMLGLLVKAGYGVDTNEELADYVIVNTCSFIESAREESVRTLVELAEANKK-
MIAB_DICNV      --VYIETYGCQMNEYDSSKMLAVLKNSGITPVATPEEADVLLLNTCSVREKAQEKVFSQLGRLKERKPHL
MIAB_DEHSB      ------TIGCQMNQAESDRLGRLFELWGYSLADKAEDAELVLVNSCVVREHAENKRLHLLRSLKNENPKL
RIMO_SYNSC      --VAFAHLGCEKNRVDTEHMVGLLAEAGYGVSTDESDAAVVVVNTCSFIQDAREESVRTLVELAEQGKEL
RIMO_MOOTA      IRVAVITLGCPKNQVESEYMLGILEKNHLEVVSDPRQAEVVIINTCSITAAREEALDTILELARAANHPR
MIAB_DEHSC      ------TIGCQMNQAESDRLGRLFELWGYSLADKAEDAELVLVNSCVVREHAENKRLHLLRSLKNKNPKL
RIMO_CLOAB      LKFGLVSLGCDKNRVDSEIILGSMNRD-YEIVNDPREADVILVNTCGFIESAKQESINTILEMNKYKEKK
MIAB_PORGI      -KLYIETYGCQMNVADSEVVASVMQMDGYNLTDNVDEADTILVNTCSVRDNAEQKVLNRLAXXXXXXXXX
MIAB_METRJ      MKKAFVSYGCQMNAYDAARMADVLGAEGYXXXXXXXXXXXXXLNTCHIREKAAEKVYSELGRLRAQGLDT
MIAB_BORPD      -KLYIRTFGCQMNEYDSDKMADVLRGDGLELTDNPEDADVILFNTCSVREKAQEKVFSDLGRVKKLNPDL
RIMO_MICAN      --IAISHLGCEKNRIDSEHMLGLLAKAGYPVDNDEELADYVIVNTCSFIQAAREESVRTLVELAEANKKI
RIMO_GEOMG      -KVSMVSLGCPKNLVDAEVMLGCLAKDQYEITTDEHEADIIIVNTCSF--IGDAKKESILADRKHDGRCK
RIMO_DICT6      -KAGIIHLGCSKNQVDTEILMGFLKELGYTFTPYLGEADLVLVNTCAFIKPAWQEAEENIXXXXXXXXXX
RIMO_CYAP7      --IAISHLGCEKNRIDSEHMLGLLAQAGYPVDANEELADYVIVNTCSFIQSAREESVRTLVELAEANKKV
RIMO_SYNY3      --IAINHLGCEKNRIDSEHMLGLLVEAGYQVDANEELADYVIVNTCSFIQDARQESVRTLVELAEAKKKI
RIMO_SYNS3      --VAFAHLGCEKNRVDTEHMLGLLAEAGYGVSSDENDANLVVVNTCSIQDAREESVRTLVGLAE-QGKEL
RIMO_NATTJ      MKVGIISLGCAKNQVDTEVMQGILENSNYKMTDDYYDADIIIVNTCGFID--DAKEESVVAQLKETGKLK
MIAB_DEIGD      MRAHLITYGCQMNEYDTHLVESQLVSFGADIVSSVDEADFVLINTCAVRGKPVDKVRSLLGDLRKQKAQR
MIAB_TREPS      MTYFFETYGCQMNVAESASVEQLLLARGWTKAVDAQTCDVLIINTCSVRITAETRVFGRLGSSLKKKRAF
MIAB_TREPA      MTYFFETYGCQMNVAESASVEQLLLARGWTKAVDAQTCDVLIINTCSVRITAETRVFGRLGSSLKKKRAF
RIMO_PROMM      --VAFAHLGCEKNRVDTEHMLGLLTEAGYSVSSDENDAAVVVVNTCSIQDAREESVRTLIGLAE-QGKEL
RIMO_CLOB8      -KVGMVSLGCDKNRVDSEIILGKMSDE-YEITNNPKNADIIIVNTCGFIESAKQESIDTILEMANYKINK
MIAB_PORG3      -KLYIETYGCQMNVADSEVVASVMQMDGYSLTDNVDEADTILVNTCSVRDNAEQKVLNRLAXXXXXXXXX
MIAB_CAMHC      ------TLGCAMNVRDSEHIVAE-LKDEYKLTDDISKADLILINTCSVREKPVHKLFSEIGAFNKVRKNG
MIAB_PELPB      ------TFGCQMNQADSATITSLLQQAGYVAAESEDRAGIILLNTCAVRNAVDRIEHQHLQGLKKRDKRL
MIAB_ANADE      -KVYVHTFGCQMNESDSDRMVELLGRHXXXXXXXXXXXDLILLNTCAVREKAEQKLLSALGRYREVKARA
RIMO_SYNP2      --IAISHLGCEKNRIDSEHMIGLLVNAGYEVDANEELADYVIVNTCSFIEDARAESVRTLVELAEANKKI
MIAB_SALRD      -QVYIETYGCQMNVNDSGIVASVLEESGYGLTRDQAAADVVLLNTCAIRENAERKIRARLSMLRKRDGEL
RIMO_SACEN      -RVAMVTLGCARNEVDSEELAGNLHQRGWDLIDDESSADVVVVNTCGFVESAKKDSVDTLLAA--SDTGA
RIMO_NOSP7      --IAISHLGCEKNRIDTEHMLGMLVEAGYGVDTNEELADYVIVNTCSFIEAARQESVRTLVELAEANKK-
RIMO_SYMTH      VKVGFISLGCAKNLVDTESMIGLLRNTGYQITNRAEEADVLVVNTCGFIDAAKQESVDAILEAAQHKTRG
RIMO_CYAA5      --ISVSHLGCEKNRIDSEHMLGILAQQGYSIDANEELADYVIVNTCSFIQEAREESVRTLVELAEANKKI
MIAB_RHORT      -KLFIKSYGCQMNVYDAGRMADVMAPLGYDLVSEADGADLVILNTCHIREKAAEKVFSDLGRLRAEGRRM
RIMO_SYNE7      --IAFSHLGCEKNRIDTEHMIGLLAEAGYGIDANEALADVVVVNTCSFIQAAREESVRTLVELAESGKKI
MIAB_CHLAA      ------TVGCQMNISDSERLEAALQGVGYSPATRPEDASFIVLNSCSVRASAEERILGKLGRVKRQHPDT
RIMO_SYNP6      --IAFSHLGCEKNRIDTEHMIGLLAEAGYGIDANEALADVVVVNTCSFIQAAREESVRTLVELAESGKKI
RIMO_GEOBB      -KVSLVSLGCPKNLVDAEVMLGYLSQDEYEVTTDETQADIIVVNTCSFIKEAKQESIDTILDLADRKHDA
MIAB_VESOH      -KLYIRTFGCQMNEYDSNKMVDILXXXXXXXXXXXXXXXXXXXNTCSIREKAQDKLFHQLGRLKNKNPNL
MIAB_AMOA5      --------GCQMNIADSEVVVSILRPHGFEITDTYEKADVIFINTCAIRDKAEQTVRKRLSQLKRRNPDL
RIMO_CYAP8      --IAISHLGCEKNRIDSEHMLGLLAEAGYQIDGNEELADYVIVNTCSFIQEARQESVRTLVELAEANKKI
RIMO_CARHZ      MKYFILSLGCTKNQADSEVIMGILESKGYVRSLNPEESDLLIVNTCGFXXXXXXXXXXXLNLVHLKKPGQ
RIMO_PROMA      -------LGCEKNLVDTEHMMGLLDQGGYSISTNPSEASLVVVNTCSFIQDAREESVRVLVGLAEQDKEI
RIMO_LEPBP      ------TLGCPKNTVDSMAMHQSLLKEGLLPAAGPEASDFHLVNTCTFIQDATKETIQTILDSKKQNKQK
RIMO_LEPBA      ------TLGCPKNTVDSMAMHQSLLKEGLLPAAGPEASDFHLVNTCTFIQDATKETIQTILDSKKQNKQK
RIMO_SYNJB      --VAVLHLGCEKNRVDTEHMLGLLAQAGYRVDGDEESANYVIVNTCSFIEAARRESVSTLMELAVQGKKI
RIMO_HELMI      MKIHITSLGCAKNRVDTEVMMGLLREAGYELTQREEDAHVLLVNTCGFILPAKEESIQTIARYKETGRCR
RIMO_CLOBM      IKVALVSLGCDKNRIDSELMLYKLNEEAELVKDPKE-AQVIIVNTCGFIETAKEESINTIASYKKTHNCK
RIMO_MAGSM      --VGVISLGCSKNTVDSEQMLGRFVREGYLLVADPLEADLLVVNTCGFIADAERESRESIAHIKQLYPHK
RIMO_CLOBL      IKVALVSLGCDKNRIDSELMLYKLNEEA-ELVKNPKEAQVIIVNTCGFIETAKEESINTIASYKKTHNCK
RIMO_LEPBL      -KFYITTLGCPKNTADSMSMHHSLLEEGFTPATFAEESDFHFINTCTFIQSATEETIQTIAQVKKQNHQK
MIAB_XYLFT      -KLFIKTHGCQMNEYDSAKMADVLTTEALELTDNPEEADIILINTCSIREKAQEKVFSQLGRWRANGRDV
MIAB_XYLF2      -KLFIKTHGCQMNEYDSAKMADVLTTEALELTDNPEEADIILINTCSIREKAQEKVFSQLGRWRANGRDV
RIMO_CLOBH      IKVALVSLGCDKNRIDSELMLYKLNEEAELVKDPKE-AQVIIVNTCGFIETAKEESINTIASYKKTHNCK
RIMO_CLOB1      IKVALVSLGCDKNRIDSELMLYKLNEEAELVKDPKE-AQVIIVNTCGFIETAKEESINTIASYKKTHNCK
MIAB_CHLPD      ------TFGCQMNQADSGIITALLEKEGYQQAASEEEAGIIMLNTCAVRNAVERISHQHVKGFKRKCPEL
MIAB_CHLPB      -KVYIRTFGCQMNQADTEIITALLQDEGYVMTGSEERADLVILNTCAVRENAVEKILHTLDHMRRSRPGL
Y1875_PYRHO     VKVYIENYGCARNRADGEIMAALLYLSGHXXXXXXXXXXXXXXNSCAVKDPTERKIARRI-RELLDNGKK
RIMO_HAHCH      -KVGFVSLGCPKNTVDSERILTQLRTEGYEISASYEDADVVLVNTCGFIDSAVQESLDAIGEALRENGKV
RIMO_CLOBK      IKVALVSLGCDKNRIDSELMLYKLNEEA-ELVKNPKEAQVIIVNTCGFIETAKEESINTIASYKKTHNCK
RIMO_AQUAE      MKIGVVSLGCAKNLVDSEILLGKLKGAGVELTPNPEEADVIIVNTCGFIEPAKLESIETILEFAESGKEV
MIAB_XYLFM      -KLFIKTHGCQMNEYDSAKMADVLTTEALELTDNPEEADIILINTCSIREKAQEKVFSQLGRWRANGRDV
MIAB_PROA2      -KVSIRTFGCQMNQADTEIISSLLTAEGYCLVAEEDDADLVMLNTCAVRENAVEKIMHHLDSXXXXXXXX
RIMO_GEOLS      -KVSMVSLGCPKNLVDAEVMLGVLAQQGYEITMDEKEADVIIVNTCSFIKEAREESVDILDLADRKSDGK
RIMO_PELCD      -KVSMISLGCAKNLVDAEVMLGYLPQDRFEITTDEAQADIIIVNTCGFISDAKEESVETLLEAKKSGNCT
RIMO_LEPIN      -KFYITTLGCPKNIADSMSMHHSLLEEGFTLASLPEESDFHFINTCTFIQSATEETIQTIAQVKKQNHQK
RIMO_CHLAA      MKYHIVTLGCPKNAVDSEGMDGLLSTQGHQAVASAEEADVIIVNTCSFIAAARAETLGVLKEAGRKRPGQ
RIMO_ACAM1      --VAVAHLGCEKNRVDTEHMLGLLVEAGYPVDSDEAFADYVIVNTCSFIQAAREESVRTLVELAEANKK-
RIMO_KLEP7      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPTYDNADMVIVNTCGFIDSAVQESLEAIGEALKENGKV
RIMO_KLEP3      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPTYDNADMVIVNTCGFIDSAVQESLEAIGEALKENGKV
RIMO_LEPBJ      -KFYITTLGCPKNTADSMSMHHSLLEEGFTPATFAEESDFHFINTCTFIQSATEETIQTIAQVKKQNHQK
MIAB_PELLD      ------TFGCQMNEADSGIIARVLLDAGFRRADTEQDADVVLLNTCAVRENAVEKIAHLLEHAKKRRKTL
RIMO_SYNR3      --VAFAHLGCEKNRVDTEHMLGLLAQAGYGVSADEADAQVVVVNTCSFIQDARAESVRTLVDLAEQGKQI
RIMO_GLOVI      --IAVTHLGCEKNRIDTEHMLGLLAQAGYQIDSDEDKAEYVLVNTCSFIGPARTESVRTLVNLAEQGKKI
MIAB_CHLL2      ------TFGCQMNQADSGIIAALLEQDGYQQASSEEEAGIIMLNTCAVRENAVERIAHYLQHVKRKCPEL
RIMO_LEPIC      -KFYITTLGCPKNIADSMSMHHSLLEEGFTPASLPEESDFHFINTCTFIQSATEETIQTIAQVKKQNHQK
RIMO_FERNB      LKLYVIVLGCAKNEADFSLFKYHLKQLGHEXXXXXXXXXXXXXXTCGFIVDAKQESIDTIASIKKQKPDF
RIMO_CYTH3      -KVNIVTLGCSKNLVDSENLLTQLRGNGIEAESKNDNSNVVVINTCGFIDNAKQESIDTILRAKENGLID
RIMO_AERS4      -KVGFVSLGCPKNLVDSERILTQLRTEGYDVVPSYDDAELVVVNTCGFIDSAVQESLEAIGEALAENGKV
MIAB_XYLFA      -KLFIKTHGCQMNEYDSAKMADVLTTEALELTDNPEEADIILINTCSIREKAQEKVFSQLGRWRASGRDV
CDKAL_XENTR     -KIWIRTWGCSHNNSDGEYMAGQLAAYGYSITEQPEQADLWLLNSCTVKSPAEDHFRNSIKKAQEANKKV
RIMO_SYNJA      --VAVLHLGCEKNRVDTEHMLGLLAQAGYRVEGDEDSADYVIVNTCSFIEAARRESVSTLMELAVQGKKI
Y826_METTH      IRVYIETFGCTFNQADSEIMAGVLREEGAVLTGIDD-ADVIIINTCYVKHPTEHKVINRIKKIQETYPEK
RIMO_PROMH      -KIGFVSLGCPKNLVDSERILTELRTEGYQVVPTYDDADLVIVNTCGFIDSAVQESLEAIGEALDENGKV
RIMO_CITK8      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALTENGKV
CDKAL_DANRE     -KVWLKTWGCSHNSSDGEYMAGQLAVAGYQITEDSSDADLWLLNSCTVKSPAEDHFRNAIRKAQEQNKKV
RIMO_SYNWW      MNIGFISLGCSKNRVDTEVMMAALKKAGHRIVNSLERADLVVVNTCGFITXXXXXXXXXXXXLKKKGSLQ
RIMO_AERHH      -KVGFVSLGCPKNLVDSERILTQLRTEGYDVVPSYDDAEVVVVNTCGFIDSAVQESLEAIGEALAENGKV
MIAB_RUTMC      -KLYIRTFGCQMNEYDSNKIADVLNHSGLVLTDDAASANVLLLNTCSIREKAQEKLFHQLGRWRKKNSNL
MIAB_ALCBS      -KLFIQTHGCQMNEYDSTRMVDLLESSGLEPTDNPEEADVLLLNTCSIREKAQEKVFHQLGRWKKAKPDM
CDKAL_XENLA     -KIWIRTWGCSHNNSDGEYMAGQLAAYGYSITEQPEKADLWLLNSCTVKSPAEDHFRNSIKKAQEANKKV
RIMO_PARUW      -KINFISLGCPRNLVDSEVMLGILLKAGYEVAPTLEEADYLVINTCGFLEASRQESMDTVEEVLSQRKKA
RIMO_THESQ      MRVGIKVLGCPKNEADCEILAGVLRERGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSAKDQYSYK
RIMO_THEMA      MRVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSAKDQYGYK
RIMO_THEP1      MRVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSAKDQYGYK
RIMO_VIBVY      -KIGFVSLGCPKNLVDSERILTQLRTEGYEIVNSYHDSDVVIVNTCGFIDSAVQESLDTIGEALKENGKV
RIMO_THEYD      ------TLGCPKNTVDSRHLIDALTKEGFYYVEEFKKADFVFINTCCFINDAKEESIDEILTAAKFKIDR
RIMO_PELPD      -KVSMVSLGCSKNLVDAEVMLGLLARQEYEITTDEREADIIIVNTCSFIKEAKQESIDILDLAERKNDGR
RIMO_ESCF3      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_PETMO      -KFHIVKLGCPKNDADMEIFKGLLQSKGYKYESNPQLANYIFIDTCGFIEEAKKESIETIFELKDNNKNL
CDKAL_DROPS     -KVFVKTWGCAHNNSDSEYMAGQLAAYGYKLSGKDE-ADLWLLNSCTVKNPSEDTFRNEIESGMSNGKHI
RIMO_THEM4      -------LGCPKNEADCALLKSHLRKMGNNIVDNLSDADAVIIDTCGFILDAKKESEEILSYVEYKKGKN
RIMO_HERA2      MKFHIITLGCPKNTVDSEGMHGILTREGHTAVDSSDGADVVIVNTCSFINAAREETVGVLQEANNKAPGQ
RIMO_BACFR      ------TLGCSKNLVDSEQLMRQLEEAGYDVTHDSEKGEIAVINTCGFIGDAKEESINMILEFAQEKEEG
RIMO_BACFN      ------TLGCSKNLVDSEQLMRQLEEAGYDVTHDSEKGEIAVINTCGFIGDAKEESINMILEFAQEKEEG
RIMO_STRCO      --VALVTLGCARNEVDSEELAGRLEADGWKLXXXXXXXXXXXXNTCGFVEAAKKDSVDALLEANHGRTQA
RIMO_OPITP      IKVSLISLGCAKNLVDSEIMVGHLHQAGMAVIPEAEKADVVIVNTCSFIDSSKEESHQHRGLRKRRKEQK
RIMO_WOLSU      -KLHLISLGCTKNLVDSEVMLGRL--KSYEITPLIEKADVIIVNTCGFIEAAKQESLSVLFEAERRKKGA
RIMO_VIBVU      -KIGFVSLGCPKNLVDSERILTQLRTEGYEIVNSYHDSDVVIVNTCGFIDSAVQESLDTIGEALKENGKV
RIMO_GRAFK      -RINVVTLGCSKNVYDSEILMGQLKANDKDVVH-EEDGNIVVINTCGFIDNAKEQSVNTIVEKKQQGDVD
RIMO_FLAPJ      -KINVITLGCSKNVYDSEVLMGQLKASGKNVVH-EEEGNIVVINTCTILEYADKKERGLVDK--------
CDKAL_HUMAN     -KIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKI
RIMO_SALPB      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
CK5P1_DICDI     -KVWIETYGCQMNVSDEEVICSIMKSSGYTISNDFNTADIVFLNTCSIRENAEAKIRAI--RRKQGRPNL
CDKAL_DROME     -KVFVKTWGCAHNNSDSEYMAGQLAAYGYRLSG-KEEADLWLLNSCTVKNPSEDTFRNEIESGMRNGKHV
RIMO_THEEB      -KIAFAHLGCDKNRVDTEHMIGLLAAAGYGVGTDETEADYVIVNTCSFIQAAREESVRTLVELAEANKK-
RIMO_SALTI      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPHYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ERWCT      -RIGFVSLGCPKNLVDSERILTELRTEGYQVVPRYDDAELVIVNTCGFIDSAVQESLEAIGEALNENGKV
Y1247_ARCFU     MRVAIETYGCTTNQADSDIM-RGFLSGEFELSSVED-AEVVIINSCGVIDFTERKIIRRMLDLKREGKKV
RIMO_SHIBS      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SHIB3      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOSM      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOSE      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOLU      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOLI      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOLC      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOHS      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECODH      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECO8A      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECO7I      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECO5E      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECO57      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECO55      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECO24      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALTY      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALSV      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALPK      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALPA      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALNS      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALEP      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALDC      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALCH      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALAR      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALA4      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_PSEA6      -RIGFVSLGCPKNLVDSERILTQLRTEGYDVVNTYNDADLVIVNTCGFIDTAVQESLDTIGEALAENGKV
RIMO_PROAC      MTVHLVSMGCARNDVDSEELAARMEAGGFRLVDDPAEAETVVVNTCGFIEQAKKDSVDTLLAAADLKGNG
RIMO_THICR      --VGIVSLGCPKATVDSERILTQLKAEGYHLTNSYEEADAVIVNTCGFIDSAVQESLDTIGEALDENGRV
RIMO_ENTS8      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
CDKAL_MOUSE     -KIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKV
RIMO_SALHS      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SALG2      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPRYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOUT      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOL6      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOL5      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECOK1      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECO81      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_ECO45      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_VIBCH      -KIGFVSLGCPKNLVDSERILTQLRTEGYEIVNSYHDSDVVIVNTCGFIDSAVQESLDTIGEALKENGKV
RIMO_SHIFL      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDANMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SHISS      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_SHIF8      -KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKV
RIMO_BACTN      -RIDIITLGCSKNLVDSEQLMRQLEEAGYSVTHDTENGEIAVINTCGF--IGDAKEESIFAERKEEGDLK
RIMO_VIBC3      -KIGFVSLGCPKNLVDSERILTQLRTEGYEIVNSYHDSDVVIVNTCGFIDSAVQESLDTIGEALKENGKV
RIMO_THIDA      --VGFVSLGCPKATVDSERILTQLRAEGYGIVGSYDDADVVVVNTCGFIDAAVQESLEAIGEAIAENGKV
RIMO_METI4      IRVGMISLGCSKNLVDSEIMLGKLLEAGAVLTASPHQADILLINTCGFILPAKKESIDTIHRRTTTSKKQ
RIMO_FRAP2      -KIGFVSLGCPKNLVDSERIITKLKAEGYDLVDSYDNADMVIVNTCGFLNSAIDESLEVIGEAIAENGK-
RIMO_CHLCV      -KIHFISLGCSRNLVDSEVMLGILLKAGYEATETLEEADYLILNTCAFLKAARDESKDYLQRXXXXXXXX
RIMO_ACIBL      -KVGFVSLGCPKNLVDSEVMMGLLATNGAEITARAEDADIIVVNTCSFIDTAKQESVDTIGRAQK-----
RIMO_CHLAB      -KIHFISLGCSRNLVDSEVMLGILLKAGYEATELLREADYLILNTCGFLKAARDESTDYLQRIINEKKEA
RIMO_SULNB      -KLHLISLGCTKNLVDSEVMLGRL--KEYEITDDNTEADVIIVNTCGFIDAAKEESNTVLNLHDERKEDS
RIMO_DESPS      MKFHLISLGCAKNLVDSEVVLGCLRDAGWEMTDEQD-ADLLLVNTCGFIQPXXXXXXXXXXXXKADFPEK
RIMO_ACIBT      -KVGFVSLGCPKALVDSERILTQLKTEGYQVASDYDGADLVVVNTCGFIESAVQESLDAIGEAMSENGRV
RIMO_ACIBS      -KVGFVSLGCPKALVDSERILTQLKTEGYQVASDYDGADLVVVNTCGFIESAVQESLDAIGEAMSENGRV
RIMO_ACIBC      -KVGFVSLGCPKALVDSERILTQLKTEGYQVASDYDG