[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81831.1

[Show Plain Result]


## Summary of Sequence Search
    1::202
    1::202     e-118 100%  202 aa  NADD_CLOPE RecName: Full=Probable nicotinate-nucleotide
    1::202     e-117  99%  202 aa  NADD_CLOPS RecName: Full=Probable nicotinate-nucleotide
    1::202     e-117  99%  202 aa  NADD_CLOP1 RecName: Full=Probable nicotinate-nucleotide
    1::200     8e-64  55%  200 aa  NADD_CLOBB RecName: Full=Probable nicotinate-nucleotide
    1::200     5e-63  55%  200 aa  NADD_CLOBA RecName: Full=Probable nicotinate-nucleotide
    1::200     1e-58  50%  200 aa  NADD_CLONN RecName: Full=Probable nicotinate-nucleotide
    1::204     2e-57  55%  204 aa  NADD_CLOB8 RecName: Full=Probable nicotinate-nucleotide
    1::203     6e-57  50%  203 aa  NADD_CLOK5 RecName: Full=Probable nicotinate-nucleotide
    1::203     6e-57  50%  203 aa  NADD_CLOK1 RecName: Full=Probable nicotinate-nucleotide
    1::200     2e-54  47%  200 aa  NADD_CLOTE RecName: Full=Probable nicotinate-nucleotide
    1::199     2e-54  48%  200 aa  NADD_CLOAB RecName: Full=Probable nicotinate-nucleotide
    6::201     1e-46  48%  201 aa  NADD_CLOBJ RecName: Full=Probable nicotinate-nucleotide
    6::201     1e-46  48%  201 aa  NADD_CLOBH RecName: Full=Probable nicotinate-nucleotide
    6::201     1e-46  48%  201 aa  NADD_CLOB6 RecName: Full=Probable nicotinate-nucleotide
    6::201     1e-46  48%  201 aa  NADD_CLOB1 RecName: Full=Probable nicotinate-nucleotide
    6::201     2e-46  48%  201 aa  NADD_CLOBL RecName: Full=Probable nicotinate-nucleotide
    6::201     8e-46  48%  201 aa  NADD_CLOBK RecName: Full=Probable nicotinate-nucleotide
    8::206     2e-45  42%  207 aa  NADD_DESHY RecName: Full=Probable nicotinate-nucleotide
    6::201     4e-45  47%  201 aa  NADD_CLOBM RecName: Full=Probable nicotinate-nucleotide
    8::206     3e-44  40%  207 aa  NADD_DESHD RecName: Full=Probable nicotinate-nucleotide
    5::204     3e-40  39%  206 aa  NADD_CLOTH RecName: Full=Probable nicotinate-nucleotide
    6::206     2e-39  38%  211 aa  NADD_THEPX RecName: Full=Probable nicotinate-nucleotide
    6::206     2e-39  38%  211 aa  NADD_THEP3 RecName: Full=Probable nicotinate-nucleotide
    6::206     3e-38  38%  209 aa  NADD_THETN RecName: Full=Probable nicotinate-nucleotide
    5::201     8e-38  39%  201 aa  NADD_CARHZ RecName: Full=Probable nicotinate-nucleotide
    1::187     2e-37  40%  192 aa  NADD_BACSK RecName: Full=Probable nicotinate-nucleotide
    9::207     1e-36  37%  217 aa  NADD_MOOTA RecName: Full=Probable nicotinate-nucleotide
    2::182     2e-35  43%  186 aa  NADD_TROW8 RecName: Full=Probable nicotinate-nucleotide
    1::199     2e-35  34%  200 aa  NADD_CLOPH RecName: Full=Probable nicotinate-nucleotide
    2::182     3e-35  43%  186 aa  NADD_TROWT RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-34  40%  189 aa  NADD_BACA2 RecName: Full=Probable nicotinate-nucleotide
    1::191     2e-34  39%  207 aa  NADD_BACHD RecName: Full=Probable nicotinate-nucleotide
    1::187     2e-34  40%  189 aa  NADD_BACCN RecName: Full=Probable nicotinate-nucleotide
   10::197     4e-34  39%  200 aa  NADD_LEIXX RecName: Full=Probable nicotinate-nucleotide
    1::187     2e-33  38%  189 aa  NADD_BACLD RecName: Full=Probable nicotinate-nucleotide
    1::187     3e-33  38%  189 aa  NADD_BACSU RecName: Full=Nicotinate-nucleotide adenylyltransferase;
    1::187     3e-33  40%  189 aa  NADD_BACWK RecName: Full=Probable nicotinate-nucleotide
    2::195     6e-33  41%  196 aa  NADD_CALS8 RecName: Full=Probable nicotinate-nucleotide
    1::187     6e-33  40%  189 aa  NADD_BACAA RecName: Full=Probable nicotinate-nucleotide
    1::187     8e-33  39%  216 aa  NADD_GEOKA RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-32  39%  189 aa  NADD_BACCR RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-32  39%  189 aa  NADD_BACC4 RecName: Full=Probable nicotinate-nucleotide
    2::196     1e-32  37%  196 aa  NADD_ANATD RecName: Full=Probable nicotinate-nucleotide
    1::186     1e-32  35%  191 aa  NADD_OCEIH RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-32  38%  216 aa  NADD_GEOTN RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-32  39%  196 aa  NADD_GEOSW RecName: Full=Probable nicotinate-nucleotide
   24::210     2e-32  38%  210 aa  NADD_STRP1 RecName: Full=Probable nicotinate-nucleotide
    1::187     2e-32  39%  189 aa  NADD_BACHK RecName: Full=Probable nicotinate-nucleotide
    1::187     2e-32  39%  189 aa  NADD_BACAC RecName: Full=Probable nicotinate-nucleotide
   10::197     3e-32  39%  200 aa  NADD_CLAMS RecName: Full=Probable nicotinate-nucleotide
   10::197     3e-32  39%  200 aa  NADD_CLAM3 RecName: Full=Probable nicotinate-nucleotide
    1::187     3e-32  39%  189 aa  NADD_BACC2 RecName: Full=Probable nicotinate-nucleotide
    1::187     3e-32  39%  189 aa  NADD_BACAH RecName: Full=Probable nicotinate-nucleotide
   24::210     4e-32  37%  210 aa  NADD_STRP3 RecName: Full=Probable nicotinate-nucleotide
    9::208     4e-32  36%  214 aa  NADD_MYCVP RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-32  39%  189 aa  NADD_BACCZ RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-32  39%  189 aa  NADD_BACC3 RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-32  39%  189 aa  NADD_BACC0 RecName: Full=Probable nicotinate-nucleotide
    2::200     8e-32  38%  214 aa  NADD_RUBXD RecName: Full=Probable nicotinate-nucleotide
    2::187     8e-32  37%  189 aa  NADD_EXIS2 RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-31  39%  189 aa  NADD_BACCQ RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-31  39%  189 aa  NADD_BACC1 RecName: Full=Probable nicotinate-nucleotide
   24::210     1e-31  37%  210 aa  NADD_STRP6 RecName: Full=Probable nicotinate-nucleotide
   24::210     2e-31  37%  210 aa  NADD_STRP8 RecName: Full=Probable nicotinate-nucleotide
    1::187     2e-31  39%  189 aa  NADD_BACC7 RecName: Full=Probable nicotinate-nucleotide
    2::190     3e-31  37%  205 aa  NADD_NOCSJ RecName: Full=Probable nicotinate-nucleotide
    5::197     4e-31  38%  212 aa  NADD_SACEN RecName: Full=Probable nicotinate-nucleotide
    5::204     5e-31  40%  204 aa  NADD_DEHSB RecName: Full=Probable nicotinate-nucleotide
   24::210     7e-31  37%  210 aa  NADD_STRMU RecName: Full=Probable nicotinate-nucleotide
    1::187     7e-31  36%  189 aa  NADD_BACP2 RecName: Full=Probable nicotinate-nucleotide
    2::216     9e-31  37%  216 aa  NADD_SYNAS RecName: Full=Probable nicotinate-nucleotide
    2::185     9e-31  39%  208 aa  NADD_KINRD RecName: Full=Probable nicotinate-nucleotide
    5::204     1e-30  39%  204 aa  NADD_DEHE1 RecName: Full=Probable nicotinate-nucleotide
    2::215     2e-30  35%  218 aa  NADD_PELCD RecName: Full=Probable nicotinate-nucleotide
    5::204     2e-30  40%  204 aa  NADD_DEHSC RecName: Full=Probable nicotinate-nucleotide
    2::195     3e-30  36%  204 aa  NADD_MYCGI RecName: Full=Probable nicotinate-nucleotide
   10::204     3e-30  35%  218 aa  NADD_CORGL RecName: Full=Probable nicotinate-nucleotide
    2::186     5e-30  37%  186 aa  NADD_THET8 RecName: Full=Probable nicotinate-nucleotide
    2::186     5e-30  37%  186 aa  NADD_THET2 RecName: Full=Probable nicotinate-nucleotide
    9::204     6e-30  33%  207 aa  NADD_SYNJA RecName: Full=Probable nicotinate-nucleotide
    6::199     6e-30  38%  199 aa  NADD_ROSS1 RecName: Full=Probable nicotinate-nucleotide
   22::209     6e-30  35%  211 aa  NADD_LACPL RecName: Full=Probable nicotinate-nucleotide
    2::212     6e-30  36%  216 aa  NADD_GEOSF RecName: Full=Probable nicotinate-nucleotide
    7::203     6e-30  37%  208 aa  NADD_ACIC1 RecName: Full=Probable nicotinate-nucleotide
    1::196     1e-29  32%  198 aa  NADD_HERA2 RecName: Full=Probable nicotinate-nucleotide
    2::206     1e-29  35%  216 aa  NADD_DESAD RecName: Full=Probable nicotinate-nucleotide
    2::183     1e-29  37%  205 aa  NADD_ARTS2 RecName: Full=Probable nicotinate-nucleotide
    2::188     2e-29  38%  204 aa  NADD_MYCSS RecName: Full=Probable nicotinate-nucleotide
    2::188     2e-29  38%  204 aa  NADD_MYCSK RecName: Full=Probable nicotinate-nucleotide
    2::188     2e-29  38%  204 aa  NADD_MYCSJ RecName: Full=Probable nicotinate-nucleotide
    2::187     2e-29  37%  190 aa  NADD_FRAAA RecName: Full=Probable nicotinate-nucleotide
   10::203     2e-29  35%  208 aa  NADD_COREF RecName: Full=Probable nicotinate-nucleotide
    2::192     3e-29  38%  214 aa  NADD_MYCLE RecName: Full=Probable nicotinate-nucleotide
    2::212     3e-29  34%  213 aa  NADD_GEOLS RecName: Full=Probable nicotinate-nucleotide
   24::209     4e-29  34%  209 aa  NADD_STRR6 RecName: Full=Probable nicotinate-nucleotide
   24::209     4e-29  34%  209 aa  NADD_STRPN RecName: Full=Probable nicotinate-nucleotide
    2::191     5e-29  38%  211 aa  NADD_MYCTU RecName: Full=Probable nicotinate-nucleotide
    2::191     5e-29  38%  211 aa  NADD_MYCTA RecName: Full=Probable nicotinate-nucleotide
    2::187     5e-29  38%  190 aa  NADD_FRASC RecName: Full=Probable nicotinate-nucleotide
    9::195     7e-29  32%  204 aa  NADD_METI4 RecName: Full=Probable nicotinate-nucleotide
    2::188     9e-29  37%  188 aa  NADD_STRCO RecName: Full=Probable nicotinate-nucleotide
    2::192     9e-29  37%  215 aa  NADD_MYCMM RecName: Full=Probable nicotinate-nucleotide
    2::194     1e-28  38%  212 aa  NADD_MYCPA RecName: Full=Probable nicotinate-nucleotide
    1::198     1e-28  33%  214 aa  NADD_THERP RecName: Full=Probable nicotinate-nucleotide
    2::194     1e-28  38%  212 aa  NADD_MYCA1 RecName: Full=Probable nicotinate-nucleotide
    2::191     3e-28  37%  211 aa  NADD_MYCBP RecName: Full=Probable nicotinate-nucleotide
    2::191     3e-28  37%  211 aa  NADD_MYCBO RecName: Full=Probable nicotinate-nucleotide
    7::194     3e-28  34%  195 aa  NADD_LACLA RecName: Full=Probable nicotinate-nucleotide
    2::197     3e-28  35%  203 aa  NADD_DICTD RecName: Full=Probable nicotinate-nucleotide
    2::195     4e-28  34%  199 aa  NADD_CORJK RecName: Full=Probable nicotinate-nucleotide
   15::192     6e-28  38%  205 aa  NADD_THEMA RecName: Full=Probable nicotinate-nucleotide
    2::212     1e-27  34%  216 aa  NADD_GEOUR RecName: Full=Probable nicotinate-nucleotide
    2::212     1e-27  35%  216 aa  NADD_GEOSM RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-27  36%  189 aa  NADD_STAAT RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-27  36%  189 aa  NADD_STAAE RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-27  36%  189 aa  NADD_STAAC RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-27  36%  189 aa  NADD_STAA8 RecName: Full=Probable nicotinate-nucleotide
    1::187     1e-27  36%  189 aa  NADD_STAA3 RecName: Full=Probable nicotinate-nucleotide
    6::193     2e-27  36%  196 aa  NADD_THEP1 RecName: Full=Probable nicotinate-nucleotide
    2::188     2e-27  37%  188 aa  NADD_SALAI RecName: Full=Probable nicotinate-nucleotide
    2::192     2e-27  32%  195 aa  NADD_OPITP RecName: Full=Probable nicotinate-nucleotide
   26::214     2e-27  32%  219 aa  NADD_ENTFA RecName: Full=Probable nicotinate-nucleotide
    6::193     2e-27  35%  196 aa  NADD_THESQ RecName: Full=Probable nicotinate-nucleotide
    2::212     2e-27  34%  216 aa  NADD_GEOBB RecName: Full=Probable nicotinate-nucleotide
    2::177     2e-27  37%  206 aa  NADD_ARTAT RecName: Full=Probable nicotinate-nucleotide
    1::187     3e-27  35%  189 aa  NADD_STAAB RecName: Full=Probable nicotinate-nucleotide
    2::187     3e-27  35%  193 aa  NADD_BORBZ RecName: Full=Probable nicotinate-nucleotide
    2::187     3e-27  35%  193 aa  NADD_BORBU RecName: Full=Probable nicotinate-nucleotide
    3::188     4e-27  35%  191 aa  NADD_STAES RecName: Full=Probable nicotinate-nucleotide
    3::188     4e-27  35%  191 aa  NADD_STAEQ RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-27  35%  189 aa  NADD_STAAW RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-27  35%  189 aa  NADD_STAAS RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-27  35%  189 aa  NADD_STAAR RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-27  35%  189 aa  NADD_STAAN RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-27  35%  189 aa  NADD_STAAM RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-27  35%  189 aa  NADD_STAA9 RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-27  35%  189 aa  NADD_STAA2 RecName: Full=Probable nicotinate-nucleotide
    1::187     4e-27  35%  189 aa  NADD_STAA1 RecName: Full=Probable nicotinate-nucleotide
    2::188     5e-27  37%  188 aa  NADD_SALTO RecName: Full=Probable nicotinate-nucleotide
    2::215     5e-27  32%  216 aa  NADD_GEOSL RecName: Full=Probable nicotinate-nucleotide
    1::211     5e-27  36%  211 aa  NADD_DESPS RecName: Full=Probable nicotinate-nucleotide
    2::187     5e-27  35%  197 aa  NADD_BORGA RecName: Full=Probable nicotinate-nucleotide
    4::199     6e-27  31%  202 aa  NADD_SYNJB RecName: Full=Probable nicotinate-nucleotide
    5::190     6e-27  35%  192 aa  NADD_STAHJ RecName: Full=Probable nicotinate-nucleotide
   14::212     6e-27  32%  214 aa  NADD_RHOBA RecName: Full=Probable nicotinate-nucleotide
    2::212     6e-27  33%  216 aa  NADD_PELPD RecName: Full=Probable nicotinate-nucleotide
    4::188     6e-27  35%  188 aa  NADD_LISMH RecName: Full=Probable nicotinate-nucleotide
    4::188     6e-27  35%  188 aa  NADD_LISMF RecName: Full=Probable nicotinate-nucleotide
    4::188     6e-27  35%  188 aa  NADD_LISMC RecName: Full=Probable nicotinate-nucleotide
    2::208     8e-27  36%  216 aa  NADD_SHEHH RecName: Full=Probable nicotinate-nucleotide
    4::188     8e-27  35%  188 aa  NADD_LISIN RecName: Full=Probable nicotinate-nucleotide
    3::188     8e-27  35%  189 aa  NADD_HYDS0 RecName: Full=Probable nicotinate-nucleotide
    9::142     8e-27  38%  211 aa  NADD_CORK4 RecName: Full=Probable nicotinate-nucleotide
    5::215     1e-26  35%  217 aa  NADD_DECAR RecName: Full=Probable nicotinate-nucleotide
    2::210     1e-26  36%  212 aa  NADD_SHEON RecName: Full=Probable nicotinate-nucleotide
    2::215     3e-26  32%  216 aa  NADD_GEOMG RecName: Full=Probable nicotinate-nucleotide
    2::187     3e-26  33%  193 aa  NADD_BORAP RecName: Full=Probable nicotinate-nucleotide
    2::210     4e-26  35%  212 aa  NADD_SHESM RecName: Full=Probable nicotinate-nucleotide
    4::188     4e-26  34%  188 aa  NADD_LISW6 RecName: Full=Probable nicotinate-nucleotide
    2::208     5e-26  34%  209 aa  NADD_SHEWM RecName: Full=Probable nicotinate-nucleotide
    2::215     5e-26  33%  216 aa  NADD_DESAA RecName: Full=Probable nicotinate-nucleotide
    2::194     7e-26  35%  195 aa  NADD_DICT6 RecName: Full=Probable nicotinate-nucleotide
    3::188     9e-26  33%  190 aa  NADD_STAS1 RecName: Full=Probable nicotinate-nucleotide
    2::210     1e-25  35%  212 aa  NADD_SHESR RecName: Full=Probable nicotinate-nucleotide
    2::210     1e-25  35%  212 aa  NADD_SHESA RecName: Full=Probable nicotinate-nucleotide
   10::194     1e-25  33%  202 aa  NADD_BACTN RecName: Full=Probable nicotinate-nucleotide
   11::216     2e-25  33%  218 aa  NADD_ACIF5 RecName: Full=Probable nicotinate-nucleotide
   11::216     2e-25  33%  218 aa  NADD_ACIF2 RecName: Full=Probable nicotinate-nucleotide
    2::208     3e-25  34%  216 aa  NADD_SHEPA RecName: Full=Probable nicotinate-nucleotide
    2::186     3e-25  33%  190 aa  NADD_BORHD RecName: Full=Probable nicotinate-nucleotide
    7::190     5e-25  33%  190 aa  NADD_BACV8 RecName: Full=Probable nicotinate-nucleotide
    2::196     6e-25  31%  211 aa  NADD_GEMAT RecName: Full=Probable nicotinate-nucleotide
    2::213     8e-25  36%  215 aa  NADD_SHEPC RecName: Full=Probable nicotinate-nucleotide
    7::216     8e-25  31%  219 aa  NADD_PSEPG RecName: Full=Probable nicotinate-nucleotide
    6::214     8e-25  35%  214 aa  NADD_AERS4 RecName: Full=Probable nicotinate-nucleotide
    1::169     1e-24  40%  193 aa  NADD_UNCTG RecName: Full=Probable nicotinate-nucleotide
    2::213     1e-24  36%  215 aa  NADD_SHESW RecName: Full=Probable nicotinate-nucleotide
    2::211     1e-24  34%  211 aa  NADD_SHEFN RecName: Full=Probable nicotinate-nucleotide
   18::227     1e-24  31%  230 aa  NADD_PSEPK RecName: Full=Probable nicotinate-nucleotide
    5::182     2e-24  36%  201 aa  NADD_BACFR RecName: Full=Probable nicotinate-nucleotide
    5::182     2e-24  36%  201 aa  NADD_BACFN RecName: Full=Probable nicotinate-nucleotide
    1::201     3e-24  28%  208 aa  NADD_SYMTH RecName: Full=Probable nicotinate-nucleotide
    1::211     3e-24  34%  211 aa  NADD_LEGPA RecName: Full=Probable nicotinate-nucleotide
    1::211     4e-24  34%  211 aa  NADD_LEGPL RecName: Full=Probable nicotinate-nucleotide
    1::211     4e-24  34%  211 aa  NADD_LEGPH RecName: Full=Probable nicotinate-nucleotide
    1::201     5e-24  31%  201 aa  NADD_NEIMF RecName: Full=Probable nicotinate-nucleotide
    2::195     5e-24  32%  213 aa  NADD_MYCS2 RecName: Full=Probable nicotinate-nucleotide
    2::193     5e-24  33%  193 aa  NADD_FLAPJ RecName: Full=Probable nicotinate-nucleotide
    2::193     5e-24  32%  193 aa  NADD_FLAJ1 RecName: Full=Probable nicotinate-nucleotide
    2::208     1e-23  34%  211 aa  NADD_SHESH RecName: Full=Probable nicotinate-nucleotide
    7::213     1e-23  32%  213 aa  NADD_SALG2 RecName: Full=Probable nicotinate-nucleotide
    7::213     1e-23  32%  213 aa  NADD_SALEP RecName: Full=Probable nicotinate-nucleotide
    7::216     1e-23  30%  219 aa  NADD_PSEPW RecName: Full=Probable nicotinate-nucleotide
    2::214     1e-23  36%  216 aa  NADD_SHEB5 RecName: Full=Probable nicotinate-nucleotide
    8::214     1e-23  32%  214 aa  NADD_PSYIN RecName: Full=Probable nicotinate-nucleotide
    1::134     1e-23  37%  197 aa  NADD_NEIM0 RecName: Full=Probable nicotinate-nucleotide
    3::194     1e-23  35%  194 aa  NADD_GRAFK RecName: Full=Probable nicotinate-nucleotide
    8::213     1e-23  32%  213 aa  NADD_ERWCT RecName: Full=Probable nicotinate-nucleotide
    4::139     1e-23  40%  212 aa  NADD_CHRVO RecName: Full=Probable nicotinate-nucleotide
    7::209     2e-23  32%  209 aa  NADD_THICR RecName: Full=Probable nicotinate-nucleotide
    1::201     2e-23  33%  201 aa  NADD_NEIG2 RecName: Full=Probable nicotinate-nucleotide
    1::201     2e-23  33%  201 aa  NADD_NEIG1 RecName: Full=Probable nicotinate-nucleotide
    1::211     2e-23  33%  211 aa  NADD_LEGPC RecName: Full=Probable nicotinate-nucleotide
    2::214     2e-23  36%  216 aa  NADD_SHEB9 RecName: Full=Probable nicotinate-nucleotide
    7::213     2e-23  32%  213 aa  NADD_SALTY RecName: Full=Nicotinate-nucleotide adenylyltransferase;
    7::213     2e-23  32%  213 aa  NADD_SALPK RecName: Full=Probable nicotinate-nucleotide
    7::213     2e-23  32%  213 aa  NADD_SALPB RecName: Full=Probable nicotinate-nucleotide
    7::213     2e-23  32%  213 aa  NADD_SALPA RecName: Full=Probable nicotinate-nucleotide
    7::213     2e-23  32%  213 aa  NADD_SALCH RecName: Full=Probable nicotinate-nucleotide
    7::213     2e-23  32%  213 aa  NADD_SALAR RecName: Full=Probable nicotinate-nucleotide
    2::216     3e-23  34%  216 aa  NADD_SHEDO RecName: Full=Probable nicotinate-nucleotide
    2::214     3e-23  36%  216 aa  NADD_SHEB2 RecName: Full=Probable nicotinate-nucleotide
    7::213     3e-23  32%  213 aa  NADD_SALTI RecName: Full=Nicotinate-nucleotide adenylyltransferase;
    2::214     4e-23  36%  216 aa  NADD_SHEB8 RecName: Full=Probable nicotinate-nucleotide
    7::216     4e-23  29%  219 aa  NADD_PSEE4 RecName: Full=Probable nicotinate-nucleotide
    1::134     4e-23  36%  201 aa  NADD_NEIMB RecName: Full=Probable nicotinate-nucleotide
    1::134     4e-23  36%  197 aa  NADD_NEIMA RecName: Full=Probable nicotinate-nucleotide
    7::213     4e-23  31%  213 aa  NADD_ESCF3 RecName: Full=Probable nicotinate-nucleotide
   11::208     6e-23  32%  210 aa  NADD_VESOH RecName: Full=Probable nicotinate-nucleotide
    5::199     7e-23  30%  199 aa  NADD_ROSCS RecName: Full=Probable nicotinate-nucleotide
    3::211     7e-23  30%  214 aa  NADD_PSEF5 RecName: Full=Probable nicotinate-nucleotide
    4::188     7e-23  32%  188 aa  NADD_LISMO RecName: Full=Probable nicotinate-nucleotide
    6::212     9e-23  35%  214 aa  NADD_AERHH RecName: Full=Probable nicotinate-nucleotide
    3::192     1e-22  29%  195 aa  NADD_SALRD RecName: Full=Probable nicotinate-nucleotide
    3::211     2e-22  30%  214 aa  NADD_PSEAE RecName: Full=Probable nicotinate-nucleotide
    3::211     2e-22  30%  214 aa  NADD_PSEAB RecName: Full=Probable nicotinate-nucleotide
    3::211     2e-22  30%  214 aa  NADD_PSEA8 RecName: Full=Probable nicotinate-nucleotide
    3::200     2e-22  32%  206 aa  NADD_GLOVI RecName: Full=Probable nicotinate-nucleotide
   13::216     4e-22  30%  216 aa  NADD_SHEAM RecName: Full=Probable nicotinate-nucleotide
   14::179     4e-22  36%  180 aa  NADD_PELUB RecName: Full=Probable nicotinate-nucleotide
    1::206     4e-22  30%  208 aa  NADD_ANAVT RecName: Full=Probable nicotinate-nucleotide
    5::208     6e-22  33%  209 aa  NADD_IDILO RecName: Full=Probable nicotinate-nucleotide
    5::215     1e-21  34%  215 aa  NADD_COXBU RecName: Full=Probable nicotinate-nucleotide
    5::215     1e-21  34%  215 aa  NADD_COXBR RecName: Full=Probable nicotinate-nucleotide
    9::192     1e-21  30%  197 aa  NADD_THEM4 RecName: Full=Probable nicotinate-nucleotide
    3::211     1e-21  30%  214 aa  NADD_PSEA7 RecName: Full=Probable nicotinate-nucleotide
   12::217     1e-21  34%  219 aa  NADD_ENTS8 RecName: Full=Probable nicotinate-nucleotide
    2::183     1e-21  31%  192 aa  NADD_CYTH3 RecName: Full=Probable nicotinate-nucleotide
    5::215     1e-21  34%  215 aa  NADD_COXBN RecName: Full=Probable nicotinate-nucleotide
    2::160     1e-21  35%  182 aa  NADD_ARCB4 RecName: Full=Probable nicotinate-nucleotide
    7::214     2e-21  32%  219 aa  NADD_HAHCH RecName: Full=Probable nicotinate-nucleotide
    1::208     2e-21  35%  214 aa  NADD_BUCAT RecName: Full=Probable nicotinate-nucleotide
    1::206     2e-21  30%  208 aa  NADD_ANASP RecName: Full=Probable nicotinate-nucleotide
    4::181     2e-21  33%  188 aa  NADD_PARD8 RecName: Full=Probable nicotinate-nucleotide
    1::211     2e-21  34%  216 aa  NADD_BUCAP RecName: Full=Probable nicotinate-nucleotide
    1::195     2e-21  31%  197 aa  NADD_BORA1 RecName: Full=Probable nicotinate-nucleotide
   14::221     3e-21  31%  221 aa  NADD_MARMS RecName: Full=Probable nicotinate-nucleotide
    7::213     3e-21  30%  213 aa  NADD_ECOLU RecName: Full=Probable nicotinate-nucleotide
    7::213     3e-21  30%  213 aa  NADD_CITK8 RecName: Full=Probable nicotinate-nucleotide
    7::213     5e-21  30%  213 aa  NADD_SHIB3 RecName: Full=Probable nicotinate-nucleotide
   10::208     5e-21  32%  219 aa  NADD_CHRSD RecName: Full=Probable nicotinate-nucleotide
    5::211     5e-21  34%  211 aa  NADD_CELJU RecName: Full=Probable nicotinate-nucleotide
    7::213     7e-21  30%  213 aa  NADD_SHIBS RecName: Full=Probable nicotinate-nucleotide
    1::208     7e-21  35%  214 aa  NADD_BUCAI RecName: Full=Probable nicotinate-nucleotide
    1::208     7e-21  35%  214 aa  NADD_BUCA5 RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_SHISS RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_SHIFL RecName: Full=Nicotinate-nucleotide adenylyltransferase;
    7::213     9e-21  30%  213 aa  NADD_SHIF8 RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_ECOSM RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_ECOSE RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_ECOLI RecName: Full=Nicotinate-nucleotide adenylyltransferase;
    7::213     9e-21  30%  213 aa  NADD_ECOLC RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_ECOHS RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_ECO8A RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_ECO7I RecName: Full=Probable nicotinate-nucleotide
    7::213     9e-21  30%  213 aa  NADD_ECO24 RecName: Full=Probable nicotinate-nucleotide
    8::218     1e-20  32%  219 aa  NADD_HERAR RecName: Full=Probable nicotinate-nucleotide
    7::213     1e-20  30%  213 aa  NADD_SHIDS RecName: Full=Probable nicotinate-nucleotide
    2::137     1e-20  36%  193 aa  NADD_FUSNN RecName: Full=Probable nicotinate-nucleotide
    7::213     1e-20  30%  213 aa  NADD_ECOL6 RecName: Full=Nicotinate-nucleotide adenylyltransferase;
    7::213     1e-20  30%  213 aa  NADD_ECOL5 RecName: Full=Probable nicotinate-nucleotide
    7::213     1e-20  30%  213 aa  NADD_ECOK1 RecName: Full=Probable nicotinate-nucleotide
    7::213     1e-20  30%  213 aa  NADD_ECO5E RecName: Full=Probable nicotinate-nucleotide
    7::213     1e-20  30%  213 aa  NADD_ECO57 RecName: Full=Nicotinate-nucleotide adenylyltransferase;
    7::213     1e-20  30%  213 aa  NADD_ECO45 RecName: Full=Probable nicotinate-nucleotide
    2::186     3e-20  29%  190 aa  NADD_BORT9 RecName: Full=Probable nicotinate-nucleotide
   14::220     7e-20  32%  220 aa  NADD_SERP5 RecName: Full=Probable nicotinate-nucleotide
    2::187     1e-19  33%  188 aa  NADD_SOLUE RecName: Full=Probable nicotinate-nucleotide
    4::168     1e-19  36%  184 aa  NADD_PETMO RecName: Full=Probable nicotinate-nucleotide
   10::215     1e-19  33%  216 aa  NADD_KLEP7 RecName: Full=Probable nicotinate-nucleotide
    6::214     1e-19  28%  222 aa  NADD_PSESM RecName: Full=Probable nicotinate-nucleotide
    6::214     2e-19  29%  222 aa  NADD_PSEU2 RecName: Full=Probable nicotinate-nucleotide
    3::199     2e-19  30%  214 aa  NADD_PELPB RecName: Full=Probable nicotinate-nucleotide
   11::218     3e-19  33%  218 aa  NADD_SODGM RecName: Full=Probable nicotinate-nucleotide
   10::215     3e-19  33%  216 aa  NADD_KLEP3 RecName: Full=Probable nicotinate-nucleotide
    4::167     3e-19  34%  168 aa  NADD_AQUAE RecName: Full=Probable nicotinate-nucleotide
   11::146     4e-19  31%  174 aa  NADD_HELPJ RecName: Full=Probable nicotinate-nucleotide
   11::146     5e-19  31%  174 aa  NADD_HELP2 RecName: Full=Probable nicotinate-nucleotide
    9::217     6e-19  32%  220 aa  NADD_LARHH RecName: Full=Probable nicotinate-nucleotide
    6::167     8e-19  34%  197 aa  NADD_THELT RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERPY RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERPS RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERPP RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERPN RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERPG RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERPE RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERPB RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERPA RecName: Full=Probable nicotinate-nucleotide
   13::219     1e-18  33%  220 aa  NADD_YERP3 RecName: Full=Probable nicotinate-nucleotide
   11::146     1e-18  31%  174 aa  NADD_HELPY RecName: Full=Probable nicotinate-nucleotide
   11::146     1e-18  32%  174 aa  NADD_HELPH RecName: Full=Probable nicotinate-nucleotide
    7::202     1e-18  32%  212 aa  NADD_METPP RecName: Full=Probable nicotinate-nucleotide
    9::191     2e-18  31%  193 aa  NADD_COPPD RecName: Full=Probable nicotinate-nucleotide
   13::219     4e-18  33%  220 aa  NADD_YERE8 RecName: Full=Probable nicotinate-nucleotide
    2::174     5e-18  33%  177 aa  NADD_NITSB RecName: Full=Probable nicotinate-nucleotide
    4::133     5e-18  34%  216 aa  NADD_MARAV RecName: Full=Probable nicotinate-nucleotide
    3::196     7e-18  30%  197 aa  NADD_CHLPD RecName: Full=Probable nicotinate-nucleotide
   11::218     9e-18  28%  220 aa  NADD_SACD2 RecName: Full=Probable nicotinate-nucleotide
   15::215     9e-18  29%  219 aa  NADD_PSEMY RecName: Full=Probable nicotinate-nucleotide
    2::194     1e-17  30%  195 aa  NADD_CHLP8 RecName: Full=Probable nicotinate-nucleotide
    2::136     2e-17  30%  344 aa  Y336_MYCPN RecName: Full=Uncharacterized protein MG240 homolog;
    1::195     2e-17  31%  195 aa  NADD_BORBR RecName: Full=Probable nicotinate-nucleotide
    3::197     3e-17  29%  198 aa  NADD_CHLL2 RecName: Full=Probable nicotinate-nucleotide
    5::197     3e-17  30%  197 aa  NADD_BORPE RecName: Full=Probable nicotinate-nucleotide
    2::203     6e-17  28%  204 aa  NADD_TREPS RecName: Full=Probable nicotinate-nucleotide
    2::203     6e-17  28%  204 aa  NADD_TREPA RecName: Full=Probable nicotinate-nucleotide
    3::191     6e-17  30%  193 aa  NADD_PROVI RecName: Full=Probable nicotinate-nucleotide
    5::197     6e-17  31%  197 aa  NADD_BORPA RecName: Full=Probable nicotinate-nucleotide
    8::138     3e-16  35%  219 aa  NADD_PSEA6 RecName: Full=Probable nicotinate-nucleotide
    2::198     4e-16  27%  198 aa  NADD_CHLPB RecName: Full=Probable nicotinate-nucleotide
    2::208     7e-16  31%  392 aa  NADD_UREPA RecName: Full=Probable nicotinate-nucleotide
    4::185     7e-16  29%  197 aa  NADD_PORG3 RecName: Full=Probable nicotinate-nucleotide
    2::139     7e-16  35%  181 aa  NADD_CAMJJ RecName: Full=Probable nicotinate-nucleotide
    5::203     9e-16  28%  218 aa  NADD_HALHL RecName: Full=Probable nicotinate-nucleotide
    1::137     9e-16  34%  199 aa  NADD_CHLT3 RecName: Full=Probable nicotinate-nucleotide
    1::188     9e-16  33%  218 aa  NADD_BURS3 RecName: Full=Probable nicotinate-nucleotide
   10::217     9e-16  33%  217 aa  NADD_BAUCH RecName: Full=Probable nicotinate-nucleotide
    2::189     1e-15  28%  190 aa  NADD_AZOPC RecName: Full=Probable nicotinate-nucleotide
    4::185     2e-15  28%  197 aa  NADD_PORGI RecName: Full=Probable nicotinate-nucleotide
    3::192     2e-15  28%  194 aa  NADD_PELLD RecName: Full=Probable nicotinate-nucleotide
    2::139     2e-15  34%  181 aa  NADD_CAMJR RecName: Full=Probable nicotinate-nucleotide
    2::139     2e-15  34%  181 aa  NADD_CAMJE RecName: Full=Probable nicotinate-nucleotide
    5::196     4e-15  30%  196 aa  NADD_CHLCH RecName: Full=Probable nicotinate-nucleotide
    2::131     7e-15  32%  181 aa  NADD_CAMJ8 RecName: Full=Probable nicotinate-nucleotide
    8::218     1e-14  33%  222 aa  NADD_STRMK RecName: Full=Probable nicotinate-nucleotide
   10::211     2e-14  31%  211 aa  NADD_WIGBR RecName: Full=Probable nicotinate-nucleotide
    1::188     2e-14  31%  218 aa  NADD_BURCJ RecName: Full=Probable nicotinate-nucleotide
    2::199     2e-14  26%  203 aa  NADD_PROA2 RecName: Full=Probable nicotinate-nucleotide
   12::207     2e-14  28%  215 aa  NADD_FERNB RecName: Full=Probable nicotinate-nucleotide
    2::210     1e-13  23%  210 aa  NADD_METCA RecName: Full=Probable nicotinate-nucleotide
    6::140     1e-13  33%  219 aa  NADD_ERYLH RecName: Full=Probable nicotinate-nucleotide
    2::193     4e-13  25%  195 aa  NADD_CHLTE RecName: Full=Probable nicotinate-nucleotide
    2::131     2e-12  29%  189 aa  NADD_CAUSK RecName: Full=Probable nicotinate-nucleotide
    4::139     4e-12  29%  188 aa  NADD_ACHLI RecName: Full=Probable nicotinate-nucleotide
    1::196     6e-12  27%  198 aa  NADD_RHOFD RecName: Full=Probable nicotinate-nucleotide
   12::143     7e-12  31%  201 aa  NADD_PARL1 RecName: Full=Probable nicotinate-nucleotide
    1::160     1e-11  30%  182 aa  NADD_SULDN RecName: Full=Probable nicotinate-nucleotide
    3::131     1e-11  30%  189 aa  NADD_SILST RecName: Full=Probable nicotinate-nucleotide
    3::132     1e-11  32%  192 aa  NADD_RHILW RecName: Full=Probable nicotinate-nucleotide
   14::142     2e-11  30%  213 aa  NADD_SILPO RecName: Full=Probable nicotinate-nucleotide
    3::132     2e-11  32%  192 aa  NADD_RHIE6 RecName: Full=Probable nicotinate-nucleotide
    3::132     3e-11  30%  188 aa  NADD_RHIME RecName: Full=Probable nicotinate-nucleotide
   10::139     3e-11  32%  199 aa  NADD_RHIL3 RecName: Full=Probable nicotinate-nucleotide
   14::142     5e-11  34%  199 aa  NADD_ROSDO RecName: Full=Probable nicotinate-nucleotide
    3::132     5e-11  34%  192 aa  NADD_RHIEC RecName: Full=Probable nicotinate-nucleotide
    6::184     5e-11  28%  190 aa  NADD_MYXXD RecName: Full=Probable nicotinate-nucleotide
    3::132     6e-11  28%  187 aa  NADD_AGRT5 RecName: Full=Probable nicotinate-nucleotide
    8::137     1e-10  27%  188 aa  NADD_SULNB RecName: Full=Probable nicotinate-nucleotide
    8::199     1e-10  31%  199 aa  NADD_LEPIN RecName: Full=Probable nicotinate-nucleotide
    8::199     1e-10  31%  199 aa  NADD_LEPIC RecName: Full=Probable nicotinate-nucleotide
    9::151     1e-10  28%  218 aa  NADD_HELHP RecName: Full=Probable nicotinate-nucleotide
    2::132     3e-10  28%  195 aa  NADD_GLUOX RecName: Full=Probable nicotinate-nucleotide
    8::139     4e-10  28%  222 aa  NADD_XYLFT RecName: Full=Probable nicotinate-nucleotide
    8::139     4e-10  28%  222 aa  NADD_XYLF2 RecName: Full=Probable nicotinate-nucleotide
   10::139     4e-10  28%  195 aa  NADD_RHILO RecName: Full=Probable nicotinate-nucleotide
    8::139     5e-10  28%  222 aa  NADD_XYLFM RecName: Full=Probable nicotinate-nucleotide
    8::197     5e-10  28%  197 aa  NADD_LEPBL RecName: Full=Probable nicotinate-nucleotide
    8::197     5e-10  28%  197 aa  NADD_LEPBJ RecName: Full=Probable nicotinate-nucleotide
    8::139     7e-10  28%  222 aa  NADD_XYLFA RecName: Full=Probable nicotinate-nucleotide
    3::132     9e-10  27%  194 aa  NADD_BRUME RecName: Full=Probable nicotinate-nucleotide
    3::132     9e-10  27%  194 aa  NADD_BRUAB RecName: Full=Probable nicotinate-nucleotide
    3::132     9e-10  27%  194 aa  NADD_BRUA2 RecName: Full=Probable nicotinate-nucleotide
    3::131     3e-09  29%  192 aa  NADD_RHOSK RecName: Full=Probable nicotinate-nucleotide
    3::131     3e-09  29%  189 aa  NADD_RHOS4 RecName: Full=Probable nicotinate-nucleotide
    3::131     3e-09  29%  192 aa  NADD_RHOS1 RecName: Full=Probable nicotinate-nucleotide
    2::133     5e-09  26%  185 aa  NADD_METEP RecName: Full=Probable nicotinate-nucleotide
    2::133     5e-09  26%  185 aa  NADD_METC4 RecName: Full=Probable nicotinate-nucleotide
    3::131     6e-09  28%  185 aa  NADD_RHOS5 RecName: Full=Probable nicotinate-nucleotide
    1::195     8e-09  24%  195 aa  NADD_BORPD RecName: Full=Probable nicotinate-nucleotide
    5::186     8e-09  28%  187 aa  NADD_ANADE RecName: Full=Probable nicotinate-nucleotide
    1::127     1e-08  27%  292 aa  Y240_MYCGE RecName: Full=Uncharacterized protein MG240;
    3::132     2e-08  28%  194 aa  NADD_BRUSU RecName: Full=Probable nicotinate-nucleotide
    5::186     2e-08  28%  187 aa  NADD_ANAD2 RecName: Full=Probable nicotinate-nucleotide
    5::186     4e-08  28%  187 aa  NADD_ANASK RecName: Full=Probable nicotinate-nucleotide
   14::150     1e-07  26%  215 aa  NADD_GLUDA RecName: Full=Probable nicotinate-nucleotide
    2::131     7e-07  26%  193 aa  NADD_BRAJA RecName: Full=Probable nicotinate-nucleotide
   13::232     1e-06  29%  245 aa  NMNA3_MOUSE RecName: Full=Nicotinamide mononucleotide
   13::235     6e-06  27%  252 aa  NMNA3_HUMAN RecName: Full=Nicotinamide mononucleotide
    1::129     6e-06  33%  158 aa  COAD_VESOH RecName: Full=Phosphopantetheine adenylyltransferase;   
   90::258     8e-06  26%  285 aa  NMNA1_MOUSE RecName: Full=Nicotinamide mononucleotide
    1::59      8e-06  41%  164 aa  COAD_PELUB RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::69      8e-06  38%  161 aa  COAD_CLOAB RecName: Full=Phosphopantetheine adenylyltransferase; 
  154::257     1e-05  29%  279 aa  NMNA1_HUMAN RecName: Full=Nicotinamide mononucleotide
    1::117     1e-05  32%  165 aa  COAD_SYNAS RecName: Full=Phosphopantetheine adenylyltransferase;   
  156::259     2e-05  28%  281 aa  NMNA1_BOVIN RecName: Full=Nicotinamide mononucleotide
  275::380     2e-05  25%  395 aa  NMA2_YEAST RecName: Full=Nicotinamide-nucleotide
  131::346     3e-05  24%  365 aa  NMAH_SCHPO RecName: Full=Putative nicotinamide-nucleotide
    3::158     3e-05  26%  181 aa  NADD_CAMFF RecName: Full=Probable nicotinate-nucleotide
   11::73      3e-05  32%  160 aa  COAD_PYRFU RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::163     3e-05  28%  163 aa  COAD_CLOPH RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::59      4e-05  40%  163 aa  COAD_FUSNN RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::200     5e-05  27%  200 aa  NADD_SYNY3 RecName: Full=Probable nicotinate-nucleotide
    1::155     5e-05  27%  173 aa  COAD_METI4 RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::120     5e-05  28%  157 aa  COAD_ALKMQ RecName: Full=Phosphopantetheine adenylyltransferase;   
    5::73      9e-05  35%  158 aa  COAD_PYRHO RecName: Full=Phosphopantetheine adenylyltransferase; 
    4::106     9e-05  31%  160 aa  COAD_KOSOT RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::120     9e-05  32%  168 aa  COAD_CALS8 RecName: Full=Phosphopantetheine adenylyltransferase;   
    1::43      9e-05  47%  165 aa  COAD_BUCAP RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::66      9e-05  34%  163 aa  COAD_BORGA RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::66      9e-05  35%  163 aa  COAD_BORAP RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::120     9e-05  32%  167 aa  COAD_ANATD RecName: Full=Phosphopantetheine adenylyltransferase;   
  281::386     2e-04  24%  401 aa  NMA1_YEAST RecName: Full=Nicotinamide-nucleotide
   58::92      2e-04  50%  421 aa  NADR_HAEIN RecName: Full=Transcriptional regulator nadR;
    4::71      2e-04  36%  156 aa  COAD_PYRAB RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::44      3e-04  43%  157 aa  COAD_HELPS RecName: Full=Phosphopantetheine adenylyltransferase; 
    6::164     3e-04  26%  171 aa  COAD_BLOPB RecName: Full=Phosphopantetheine adenylyltransferase;   
    9::73      3e-04  29%  159 aa  COAD_THEGJ RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::136     3e-04  26%  178 aa  COAD_SYNP2 RecName: Full=Phosphopantetheine adenylyltransferase;   
    7::149     3e-04  24%  150 aa  COAD_MYCPE RecName: Full=Probable phosphopantetheine
    2::76      3e-04  33%  162 aa  COAD_CARHZ RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::66      3e-04  35%  163 aa  COAD_BORBZ RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::66      3e-04  35%  163 aa  COAD_BORBU RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::30      4e-04  47%  157 aa  COAD_HELPY RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::30      4e-04  47%  157 aa  COAD_HELPJ RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::30      4e-04  47%  157 aa  COAD_HELPH RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::30      4e-04  47%  157 aa  COAD_HELPG RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::30      4e-04  47%  157 aa  COAD_HELP2 RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::30      4e-04  47%  157 aa  COAD_HELAH RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::106     4e-04  31%  165 aa  COAD_BORT9 RecName: Full=Phosphopantetheine adenylyltransferase;   
    1::61      6e-04  36%  165 aa  COAD_RHOP2 RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::77      6e-04  35%  160 aa  COAD_LEPBP RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::77      6e-04  35%  160 aa  COAD_LEPBA RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::62      6e-04  34%  161 aa  COAD_CLONN RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::115     7e-04  28%  157 aa  COAD_MICAN RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::76      7e-04  31%  161 aa  COAD_DESRM RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::62      7e-04  41%  164 aa  COAD_CLOBJ RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::62      7e-04  41%  164 aa  COAD_CLOBH RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::62      7e-04  41%  164 aa  COAD_CLOB1 RecName: Full=Phosphopantetheine adenylyltransferase; 
    6::33      0.001  50%  168 aa  COAD_WOLWR RecName: Full=Phosphopantetheine adenylyltransferase; 
    6::33      0.001  50%  168 aa  COAD_WOLPP RecName: Full=Phosphopantetheine adenylyltransferase; 
    6::33      0.001  50%  168 aa  COAD_WOLPM RecName: Full=Phosphopantetheine adenylyltransferase; 
    5::34      0.001  47%  149 aa  COAD_MYCPU RecName: Full=Probable phosphopantetheine
    4::58      0.001  44%  161 aa  COAD_LISW6 RecName: Full=Phosphopantetheine adenylyltransferase; 
    4::58      0.001  44%  161 aa  COAD_LISIN RecName: Full=Phosphopantetheine adenylyltransferase; 
    5::105     0.001  32%  164 aa  COAD_COPPD RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::62      0.001  41%  164 aa  COAD_CLOBM RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::62      0.001  41%  164 aa  COAD_CLOBL RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::62      0.001  41%  164 aa  COAD_CLOBK RecName: Full=Phosphopantetheine adenylyltransferase; 
    2::62      0.001  41%  164 aa  COAD_CLOB6 RecName: Full=Phosphopantetheine adenylyltransferase; 
    1::123     0.001  25%  170 aa  COAD_CHLL2 RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::106     0.001  29%  165 aa  COAD_BORHD RecName: Full=Phosphopantetheine adenylyltransferase;   
    1::202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
NADD_CLOPE      MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
NADD_CLOPS      MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
NADD_CLOP1      MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
NADD_CLOBB      MKRYGIIGGTFDPIHYGHLYIAYEAKKQLNLDNVIFMPAGNPPHKEGKKVTDSLLRYKMVKKAIEDFSGF
NADD_CLOBA      MKRYGIIGGTFDPIHYGHLYIAYEAKKQLSLDKIIFMPAGNPPHKEGKKITSAKLRYEMVKSSIKDFSGF
NADD_CLONN      MKKKGIFGGTFDPIHNGHLHIAYEALYKLNLDRVIFIPSGNPPHKTDKVITDANIRYKLVKDVIQNEEKF
NADD_CLOB8      MKRFGIIGGTFDPIHNAHLYIAYEAKEKLSLDEVIFMPAGIQPLKANNIITDPGLRYSMVKAAIEHFSEF
NADD_CLOK5      MVKKAIFGGTFDPIHNGHIHIAYEAIYRLGLDEIVFMPTGNPPHKAKKSITDAFLRYEMVKVAIRSESKF
NADD_CLOK1      MVKKAIFGGTFDPIHNGHIHIAYEAIYRLGLDEIVFMPTGNPPHKAKKSITDAFLRYEMVKVAIRSESKF
NADD_CLOTE      MKKKAIFGGTFDPIHNGHLHIAYKALNRLKLDKIIFIPSGNPPHKHKECITDKNIRYNMVKYAIEQEDKF
NADD_CLOAB      MKKKAIFGGTFNPIHNAHLNIAAKSIEKLQLDELIFVPSGNPPHKSEKGIAPAELRYEMVKEAIKDNCKF
NADD_CLOBJ      -----ILGGTFDPIHNAHINVAYEALERFNLEEVIFIPAGNPPHKIKLKKTPAHIRYEMVKLAIEKETRF
NADD_CLOBH      -----ILGGTFDPIHNAHINVAYEALERFNLEEVIFIPAGNPPHKIKLKKTPAHIRYEMVKLAIEKETRF
NADD_CLOB6      -----ILGGTFDPIHNAHINVAYEALERFNLEEVIFIPAGNPPHKIKLKKTPAHIRYEMVKLAIEKETRF
NADD_CLOB1      -----ILGGTFDPIHNAHINVAYEALERFNLEEVIFIPAGNPPHKIKLKKTPAHIRYEMVKLAIEKETRF
NADD_CLOBL      -----ILGGTFDPIHNAHINVAYEALERFNLEEVIFIPAGNPPHKINLKKTPAHIRYEMVKLAIEKETRF
NADD_CLOBK      -----ILGGTFDPIHNAHINVAYEALERFNLEEVIFIPAGNPPHKINLKKTPAHIRYEMVKLAIEKETRF
NADD_DESHY      -KRIGIMGGTFDPLHYGHLVAAEMARHEFALEKVIFIPTGNPPHKVGRRVTSPGDRYEMVKRAVQDNSFF
NADD_CLOBM      -----ILGGTFDPIHNAHINVAYEALERFNLEEVIFIPAGNPPHKIKLKKTPAHIRYEMVKLAIEKETRF
NADD_DESHD      -KRIGIMGGTFDPLHYGHLVAAEMARHEFALEKVIFIPTGNPPHKVGRRVTSSGDRYEMVKRAVQDNSFF
NADD_CLOTH      VKRIGILGGTFDPIHNGHLIMAEIIRGAFELDRVLFIPSGNPPHKKNQTVTDAEHRYNMVCEALKGNPYF
NADD_THEPX      --RLGIMGGTFDPIHYGHLVTAEAVRSEFKLDKVIFVPAGNPPHKVKRKVTDKKHRYLMTILATITNPFF
NADD_THEP3      --RLGIMGGTFDPIHYGHLVTAEAVRSEFKLDKVIFVPAGNPPHKVKRKVTDKKHRYLMTILATITNPFF
NADD_THETN      --RLGIMGGTFDPIHYGHLVTAEAVRDEFKLDKVIFVPAGNPPHKVKRKVTDKKHRYLMTILATITNPFF
NADD_CARHZ      --KIGIFGGSFNPVHLGHLVLAREAFWQAKLNQVIFIPAKIPPHKK-EGVISEQHRFQMLRLALKKYPEF
NADD_BACSK      MKRIGLFGGTFDPPHLGHLLIAQEALTAVKLDEVWFVPVSTPPHKERAGLTSGKDRYDMVKAALVQEERF
NADD_MOOTA      --RVGIMGGTFDPIHYGHLVTAEAARWEFALQKVIFVPSGRPPHKKDYPVTDAEYRYQMTLLATASNPYF
NADD_TROW8      -------GGTFDPIHHGHLVVASEVASRFCLDEVIFVPTGRPPHKK--EVSDPWHRYLMAVIATASNQRF
NADD_CLOPH      MRKVGIMGGTFNPIHFVHLLLAEAAYEQYHLEEIIFLPSKRPAYKPLSELIEEEHRFHMIELAISDNPHF
NADD_TROWT      -------GGTFDPIHHGHLVVASEVASRFCLDEVIFVPTGRPPHKK--EVSDPWHRYLMAVIATASNQRF
NADD_BACA2      MKKIGIFGGTFDPPHNGHLLMANEVLHQAELDEIWFMPNKIPPHKQNEDFTDSRHRVEMLKLAISSNSGF
NADD_BACHD      MKRIGLLGGTFDPPHIGHLLLAQEAIHCADLDEVWFVPVGIPPHKEREEIASNDDRLAMIKRAIKKETLF
NADD_BACCN      MKKIGIIGGTFDPPHYGHLLIANEVYHTLELDEVWFLPNQIPPHKRNRNVTSAEDRRKMLELAIEKEGYF
NADD_LEIXX      --RIGVMGGTFDPIHHGHLVAASEVAQSFDLDEVVFVPTGRPWQKG--AVTPAEHRYLMTVIATASNPRF
NADD_BACLD      MRKIGIFGGTFDPPHNGHLLMANEVLYKLDLDEIWFMPNQIPPHKQKNSFSLSMHRVEMLKLAISGKEQF
NADD_BACSU      MKKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIPPHKQNEDYTDSFHRVEMLKLAIQSNPSF
NADD_BACWK      MRKIGIIGGTFDPPHNGHLLIANEVYHALGLEEVWFLPNQVPPHKQGRNITSVKSRLNMLQIAIEEEAYF
NADD_CALS8      --KVAIFGGTFNPIHIGHLIMAQYVKNFSEVDRVIFVPNGVPPHKN-VDIALPEDRFEMVKLSIEDNPDF
NADD_BACAA      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHF
NADD_GEOKA      MGKIGIFGGTFDPPHYGHLLMANEVLDALQLSEIWFLPNRLPPHKQHEQVTKSEDRLRMLELAVAGHPRF
NADD_BACCR      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLHMLELATEAEEHF
NADD_BACC4      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLHMLELATEAEEHF
NADD_ANATD      --KVALFGGTFNPIHIGHLIMAQYVLNFSQVQKVIFVPNGHPPHKV-EDVADAFDRFEMVKLSIEDNPYF
NADD_OCEIH      MREIGILGGTFDPPHLGHLLIAEEVRRAKELDEIWFIPTNTPPHKE-DTTTSADHRTSMIQLAIDSHPSF
NADD_GEOTN      MGKIGIFGGTFDPPHYGHLIMANEVLDALQLSQIWFLPNRIPPHKQNEQVTRSEDRLRMLELAVAGHPRF
NADD_GEOSW      MRKIGIFGGTFDPPHYGHLLMANEVLHALQLSEIWFMPNRIPPHKQHEQVTKSEDRLRMLELAIADHPRF
NADD_STRP1      -KQIGILGGNFNPIHNAHLVVADQVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLRMLELAIEDVEGL
NADD_BACHK      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
NADD_BACAC      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
NADD_CLAMS      --RIGVMGGTFDPIHNGHLVAASEVQQHLQLDEVIFVPTGQPWQKQ--TVTDGEHRYLMTVIATAANPRF
NADD_CLAM3      --RIGVMGGTFDPIHNGHLVAASEVQQHLQLDEVIFVPTGQPWQKQ--TVTDGEHRYLMTVIATAANPRF
NADD_BACC2      MRKIGIIGGTFDPPHYGHLLIANEVYHALDLEEVWFLPNQIPPHKQGRNITSIERRLHMLELATEAEEHF
NADD_BACAH      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
NADD_STRP3      -KQIGILGGNFNPIHNAHLVVADQVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLRMLELAIEDVEGL
NADD_MYCVP      -RRLGVMGGTFDPIHNGHLVAASEVADRFDLDEVVFVPTGQPWQKRARAVTAAEDRYLMTVIATASNPRF
NADD_BACCZ      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
NADD_BACC3      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
NADD_BACC0      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
NADD_RUBXD      --RVGIFGGTFDPIHVGHMIVAEQVMDELGMERVVFVPSGIPPHKEASSVAPAEDRYEMVLAAIAGNERF
NADD_EXIS2      --KIGLMGGTFDPPHIGHLLIAEQAKEQLQLDAVWFLPAKLPPHKQ-STVTSAAKRLELVRAAVRDNQDF
NADD_BACCQ      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEEEEHF
NADD_BACC1      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEEEEHF
NADD_STRP6      -KQIGILGGNFNPIHNAHLVVADQVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLCMLELAIEDVEGL
NADD_STRP8      -KQIGILGGNFNPIHNAHLVVADQVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLCMLELAIEDVEGL
NADD_BACC7      MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKHGRNITSVESRLQMLELATEEEEHF
NADD_NOCSJ      -------GGTFDPIHHGHLVAASEVQAWFDLDEVLFVPTGDPWQKSDRDVSPAEHRYLMTVIATAANPRF
NADD_SACEN      -RRIGVMGGTFDPIHHGHLVAASEVQAQFGLEQVIFVPTGQPWQKTHEVVSPAEDRYLMTVVATASNPRF
NADD_DEHSB      --KTGILGGTFDPIHTGHLILADEVKNRLGLDEVIFIPTGQPYYKADKTISPAEDRLNMVKLAISDKPYF
NADD_STRMU      -KQIGILGGNFNPVHNAHLLVADQVRQQLGLDEVLLMPEYKPPHVDKKATIDEKHRLKMLELAIKGIEGL
NADD_BACP2      MKKIGLFGGTFDPPHNGHLLMANEVRFQVGLDEIWFIPNHKPPHKTDRKRADSRHRVKMVEAAIESNPHF
NADD_SYNAS      --KWGLLGGTFDPIHMGHLRCAEEIREIFDLNRIIFIPASHPPHKLDAAVTSFYHREQMVRLAIEGNPSF
NADD_KINRD      -------GGTFDPIHHGHLVAASEVAARFALDEVVFVPTGKPWQKSRVDIAPAEHRYLMTVIATASNPRF
NADD_DEHE1      --KTGILGGTFDPIHTGHLILAEEVKKRLGLDEIIFIPTGQPYYKADKTISPAADRLNMVKLAISGKPYF
NADD_PELCD      --KLGILGGTFNPIHSAHLRIAEEVRERCRLDRILFIPAATPPHKELAGEIPFADRHAMVAAAIADNPDF
NADD_DEHSC      --KTGILGGTFDPIHTGHLILADEVKNRLGLDEVIFIPTGQPYYKADKTISPAEDRLNMVKLAISDKPYF
NADD_MYCGI      -------GGTFDPIHNGHLVAASEVADLFDLHEVVFVPTGQPWQKRSRPVTPAEDRYLMTVIATASNPRF
NADD_CORGL      --RIGIMGGTFDPIHNGHLVAGSEVADRFDLDLVVYVPTGQPWQKANKKVSPAEDRYLMTVIATASNPRF
NADD_THET8      --RIGLFGGSFDPIHLGHLLAASQAQEVLCLDRVLFVVAARPPHKV--PVAPAEARYEMTLLAVAEDPRF
NADD_THET2      --RIGLFGGSFDPIHLGHLLAASQAQEVLCLDRVLFVVAARPPHKV--PVAPAEARYEMTLLAVAEDPRF
NADD_SYNJA      -RRIGILGGTFNPVHHGHLIMAEQALWQFNLDQVLWMPAGDPPHKPLAAGASKADRLAMVKLAIADHERF
NADD_ROSS1      ---IGILGGTFDPIHYGHLAIAEEVRVALRLDRVLIIPAGEQPLKIGKHMAPPEHRLAMARLACADNPFF
NADD_LACPL      -RRVGILGGTFNPPHLGHLIMAQQVGDQLGLDEVRFMPDAQPPHVDEKKTIAVEDRANMVQEAIVDNPLF
NADD_GEOSF      --RIGILGGTFNPIHNAHLRIAEEVRDRLDLERVMFVPAASPPHKLLAGELSFEVRYEMVRLAIADNPFF
NADD_ACIC1      --RIGVMGGTFDPIHHGHLVAASEVASQFQLEEVIFVPTGQPWQKAERDIAPAEDRYLMTVIATASNPRF
NADD_HERA2      MQRVGILGGTFDPIHFAHLAIAEEARVVLGLSQVVFIPTAQQPLKQ-QHFSSAYQRLAMTKLAIADNPAF
NADD_DESAD      --KIGLFGGSFNPVHLTHLDVANGVLKRLGLDKVLFVPAGNPYHKEQGEMLSAELRYELVKKAVQGCSGL
NADD_ARTS2      -------GGTFDPIHHGHLVAASEVAAKFGLDEVVFVPTGQPWQKMSKKVSEPEHRYLMTVIATASNPRF
NADD_MYCSS      -------GGTFDPIHHGHLVAASEVADLFDLDEVVFVPTGQPWQKHDRRVTAPEDRYLMTVIATASNPRF
NADD_MYCSK      -------GGTFDPIHHGHLVAASEVADLFDLDEVVFVPTGQPWQKHDRRVTAPEDRYLMTVIATASNPRF
NADD_MYCSJ      -------GGTFDPIHHGHLVAASEVADLFDLDEVVFVPTGQPWQKHDRRVTAPEDRYLMTVIATASNPRF
NADD_FRAAA      -------GGTFDPVHNGHLVAASEVAALFDLDEVVFVPSGQPWQKVHRVVSDPEDRYLMTFLATAENPQF
NADD_COREF      -RKIGIMGGTFDPIHHGHLVAGSEVANRFGLDMVIYVPTGQPWQKADRVVSPAEDRYLMTVIATASNPRF
NADD_MYCLE      -------GGTFDPIHYGHLVAASEVAHMFELDEVMFVPSGQP-WQKGRHVSAAEDRYLMTVIATASNPRF
NADD_GEOLS      --KLGLLGGTFNPIHLAHLRIAEEAREAAGLDQVLFIPAADPPHKPLAGDVSFELRAAMVQRAIAANPAF
NADD_STRR6      -KQVGILGGNFNPVHNAHLIVADQVRQQLGLDQVLLMPEYQPPHVDKKETIPEHHRLKMLELAIEGIDGL
NADD_STRPN      -KQVGILGGNFNPVHNAHLIVADQVRQQLGLDQVLLMPEYQPPHVDKKETIPEHHRLKMLELAIEGIDGL
NADD_MYCTU      -------GGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQP-WQKGRQVSAAEHRYLMTVIATASNPRF
NADD_MYCTA      -------GGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQP-WQKGRQVSAAEHRYLMTVIATASNPRF
NADD_FRASC      -------GGTFDPVHNGHLVAASEVAALFDLDEVVFVPSGQPWQKIHRKVSAAEDRYLMTFLATAGNPQF
NADD_METI4      --RLAIFGGSFDPIHYGHLICAMDCLEQISLNKIIFMPCSRSPFKKQNPVASALQRLEMIQLAIKPFKNF
NADD_STRCO      -------GGTFDPIHHGHLVAASEVAAQFQLDEVVFVPTGQPWQKSHRAVSAAEDRYLMTVVATVENPQF
NADD_MYCMM      -------GGTFDPIHYGHLVAASEVADRYELDEVVFVPSGQP-WQKGRRVSPAEDRYLMTVIATASNPRF
NADD_MYCPA      -------GGTFDPIHYGHLVAASEVADLFGLDQVVFVPSGQPWQKD-RHVSAAEDRYLMTVIATASNPRF
NADD_THERP      MSRLGIFGGTFDPIHHGHLIVAEVLKEELQLSRVLFLPAGQPPHKIGRPITPIAHRLAMLQLALQGNPHF
NADD_MYCA1      -------GGTFDPIHYGHLVAASEVADLFGLDQVVFVPSGQPWQKD-RHVSAAEDRYLMTVIATASNPRF
NADD_MYCBP      -------GGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQP-WQKGRQVSAAEHRYLMTVIATASNPRF
NADD_MYCBO      -------GGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQP-WQKGRQVSAAEHRYLMTVIATASNPRF
NADD_LACLA      -KKVGLLGGNFNPIHHAHLMMADQVAQQMNLDKVLLMPENIPPHVDEKETISAKHRVKMLELAIKENPRL
NADD_DICTD      --KIGILGGTFDPIHYGHLWFAEYAREKFKLDKVFFIPNRVPSHREIPIATSK-QRYEMVLLATLNNPYF
NADD_CORJK      -------GGTFDPIHNGHLVAGSEVADLFDLDVVIYVPTGQPWQKKHKKVSAAEDRYLMTVVATASNPRF
NADD_THEMA      --RIGIFGGSFDPVHTGHVLVSVYTLEILDLDRLIVVPVFNPPHK--KTVAPFEKRFEWLKKVFEGMEKM
NADD_GEOUR      --KIGILGGTFNPIHNAHLRIAEEVRDRFDLGRVMFVPAASPPHKPLAGELSFDVRYRMVQLAIADNPAF
NADD_GEOSM      --RLGILGGTFNPIHNAHLRIAEEARDLYELDRVVFIPAATPPHKPLVGELSFASRLEMVRLAVADNSGF
NADD_STAAT      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFG
NADD_STAAE      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFG
NADD_STAAC      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFG
NADD_STAA8      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFG
NADD_STAA3      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFG
NADD_THEP1      --RIGIFGGSFDPIHTGHVLVSVYTLEILDLDRLIVVPVFNPPHK--KTVAPFEKRFEWLKKVFEGMEKV
NADD_SALAI      -------GGTFDPIHQGHLVAASEVADRFGLDEVIFVPTGQPWQKADEPVSPAEDRYLMTVIATASNPRF
NADD_OPITP      --KIGFLGGSFDPVHFGHLIAAQDAFEQFRLDRLILVPAAQAPLKPNDVQSSPEDRFAMLRAAVEWDQRF
NADD_ENTFA      -KQVGLLGGNFNPVHLAHLVMADQVQNQLGLDKVYLMPTYLPPHVDEKKTISSEHRLAMLELAVADNPCL
NADD_THESQ      --RIGIFGGSFDPVHTGHVLVSVYTLEILDLDRLIVVPVFNPPHK--KTVAPFEKRFEWLKKVFEGMEKV
NADD_GEOBB      --RLGILGGTFNPIHNAHLRIAEEARDLYQLDRVVFIPAATPPHKPLVGELSFASRLEMVRLAVADNPGF
NADD_ARTAT      -------GGTFDPIHHGHLVAASEVAAKFGLDEVVFVPTGQPWQKSHKLVSRPEHRYLMTVIATASNPRF
NADD_STAAB      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMIQMIIDELGFG
NADD_BORBZ      --RIAILGGTYNPVHIGHIFLAKEIEYLLNIDRVIFIPTCNPAHKLIDENVSVSNRIDMLKLALENEDKM
NADD_BORBU      --RIAILGGTYNPVHIGHIFLAKEIEYLLNIDRVIFIPTCNPAHKLIDENVSVSNRIDMLKLALENEDKM
NADD_STAES      -KKIVLFGGQFNPIHTAHLAVASEVYHAIKPDIFFFLPSYMAPLKHHNTQLYSEHRVKMIQLAIKEIGFG
NADD_STAEQ      -KKIVLFGGQFNPIHTAHLAVASEVYHAIKPDIFFFLPSYMAPLKHHNTQLYSEHRVKMIQLAIKEIGFG
NADD_STAAW      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMIQMIIDELGFG
NADD_STAAS      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMIQMIIDELGFG
NADD_STAAR      MKRIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMVIDELGFG
NADD_STAAN      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMIQMIIDELGFG
NADD_STAAM      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMIQMIIDELGFG
NADD_STAA9      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMIQMIIDELGFG
NADD_STAA2      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMIQMIIDELGFG
NADD_STAA1      MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHNNFIDVQHRLTMIQMIIDELGFG
NADD_SALTO      -------GGTFDPIHHGHLVAASEVADRFGLDEVIFVPTGQPWQKADEPVSPAEDRYLMTVIATASNPRF
NADD_GEOSL      --KTGILGGTFNPVHVAHLRIAEEVRDTFALDRVLFIPAASPPHKAMEGEVPFETRCAMVRLATADNHAF
NADD_DESPS      MKKIGLFGGTFNPLHNGHLQLAEFAAAQCQLDQVVFLPAASPPHKKGDEIVPFSHRAEMIRLACSRNKRF
NADD_BORGA      --RIAILGGTYNPIHIGHIFLAKEIEFLLNIDKVIFIPTCNPAHKLISEDVTVQNRIDMLKLALENENKI
NADD_SYNJB      -RRIAILGGTFNPVHHGHLIMAEQALWQFDLDQVLWMPAGDPPHKPLAPGASKADRLAMVKLAIADHERF
NADD_STAHJ      -KAIVLYGGQFNPIHTAHLLVANEVYHQLKPDKFYFLPSYMAPLKTHDDYLDAKYRIKMIQLAIEELGFG
NADD_RHOBA      ---IGILGGSFDPVHVGHLWMAESALEQLPIEHVRWIPAATSPLKPHGPVASNEHRLQMLRLALSGQSGL
NADD_PELPD      --KIGLMGGTFNPIHMAHLRIAEEARELCGLDRVLFIPVADPPHKPLAGEVPFHQRCQMVRLAIAGNRAF
NADD_LISMH      --KVGILGGTFDPPHLAHLRMAEEAKKQLGLEKILFLPNKIPPHKHISGMASSDERVEMLQLMIEGIDSF
NADD_LISMF      --KVGILGGTFDPPHLAHLRMAEEAKKQLGLEKILFLPNKIPPHKHISGMASNDERVEMLQLMIEGIDSF
NADD_LISMC      --KVGILGGTFDPPHLAHLRMAEEAKKQLGLEKILFLPNKIPPHKHISGMASSDERVEMLQLMIEGIDSF
NADD_SHEHH      --KVGILGGTFDPIHFGHIRPAQEVKQQLNLDEVWLMPNHIPPHKQSTHVSCE-DRLAMAQLVSDELPQF
NADD_LISIN      --KVGILGGTFDPPHLAHLHMAEEAKAQLGLEKILFLPNKVPPHKQISGMASNEERVEMLQLMIEDRDSF
NADD_HYDS0      ---IAFFGGSFDPIHIGHILVARDVCELCDVDKIYFMPAFISPFKP-KPIASPKQRFEMLKLALEDEPWA
NADD_CORK4      --RLGIMGGTFDPIHHGHLVAASEVADLFSLDRVLFVPTGQPWQKKNRTVTPAEDRYLMTTIATASNPRF
NADD_DECAR      ---LGLFGGTFDPVHFGHLRLAEESIAHLGLGGVRWIPAGQPPHRGVPQVTAQ-QRLEMVRLAMANNARF
NADD_SHEON      --RIGILGGTFDPIHYGHIRPAMEVKASLKLDKILLMPNHIPPHKNTTHSTTEQ-RLEMVAQVCTSLPGF
NADD_GEOMG      --RTGILGGTFNPIHHAHLRIAEEVRDAFALDQVIFIPAASPPHKPMEGEIPFEVRCEMVRLATADNPSF
NADD_BORAP      --RIAILGGTYNPVHIGHIFLAKEIEYLLNIDKIIFIPTCNPTHKLIGEGVSVKNRIDMLKLALKNENKM
NADD_SHESM      --RIGILGGTFDPIHYGHIRPAMEVKASLKLDNILLMPNHIPPHKNTTH-SSTAQRLEMVAQVCEALTGF
NADD_LISW6      --KVGILGGTFDPPHLAHLQMAEVAKQQLNLEKVLFLPNKIPPHKHISGMASNDARVEMLRLMIEGIDYF
NADD_SHEWM      --RIGILGGTFDPIHFGHIRPAQEVKQTLNLDKVWLMPNHIPPHKTSTSVSTE-QRLEMTQLVCDEYSEF
NADD_DESAA      --RLGIYGGTFDPIHIGHLRMAVEVQEKFSLDKVVLIPCNTPPHKENGAAASARDRLAMVRMAVEGRAGL
NADD_DICT6      --KIGILGGTFDPIHYGHLWFAEYARERFKLDKVFFIPNKIPPHRETPLATSK-QRYEMVLLATLSNPCF
NADD_STAS1      -KSIVLYGGQFNPIHIAHMVVASEVNAFIKPDVFYFIPSFISPLKEHTDYLEGRYRVDMIQSVIDDLGFG
NADD_SHESR      --RIGILGGTFDPIHYGHIRPAMEVKASLKLDKILLMPNHIPPHKNTTH-SSTAQRLEMVAQVCEALTGF
NADD_SHESA      --RIGILGGTFDPIHYGHIRPAMEVKASLKLDKILLMPNHIPPHKNTTH-SSTAQRLEMVAQVCEALTGF
NADD_BACTN      --KTGIFSGSFNPVHIGHLALANYLCEYEELDEVWFMVSPQNPLKAGTELWPDDLRLRLVELATEEYPRF
NADD_ACIF5      -----ILGGTFDPIHYGHLRAVEEVRQALAIAQAMLIPAGHPPHRKWADARH---RLAMTRIAVAHHPQF
NADD_ACIF2      -----ILGGTFDPIHYGHLRAVEEVRQALAIAQAMLIPAGHPPHRKWADARH---RLAMTRIAVAHHPQF
NADD_SHEPA      --KIGILGGTFDPIHFGHIRPAQEVKQQLKLDEVWLMPNHIPPHKQGTHVSSQ-ARLAMAELIADEFPCF
NADD_BORHD      --RIAILGGTYNPVHIGHMFLAKELEHFLNVDKILFIPTHKPVHKRVENISVK-DRIAMLKLAVQHEKNM
NADD_BACV8      --KTGIFGGSFNPIHMGHLALANYLCEYNGLDEIWFLVSPHNPLKQQTDLWDDNLRLELVKLAIADYPKF
NADD_GEMAT      --RLGLFGGSFDPPHVGHLLVAQDALEALRLDHLLIIPAAQQP-LKGAHQTSAHHRLAMVRACFEGVQGI
NADD_SHEPC      --RIGILGGTFDPIHYGHIRPAIEVKEALGLDKVLLMPNHIPPHKHQPNLS-TAQRLKMVADVCAELAGF
NADD_PSEPG      VRRIGILGGTFDPVHIGHLRSALEVAELMGLDELRLLPNARPPHRDTPQVAAQ-DRLAMVREAVQGVACL
NADD_AERS4      ---IGLLGGTFDPIHIGHLRPAIDARDALGLAEIRLIPNHIPPHKANPFCSSEQ-RLAMVRLAAAENPGF
NADD_UNCTG      MHKVAIFGGSFDPVHKSHIQIAKLAFKSLDLKKMIFVIAYTPPHKQYAYIED---RISMLKLATGNMQKT
NADD_SHESW      --RIGILGGTFDPIHYGHIRPAIEVKEALGLDKVLLMPNHIPPHKHQPNLS-TAQRLKMVADVCAELAGF
NADD_SHEFN      --RIGILGGTFDPIHLGHINPALDVKQQLHLDQIWLMPNHIPPHKN-TTVVSTHHRLEMVKLVCQQYPEF
NADD_PSEPK      VRRIGILGGTFDPVHIGHLRSALEVAEFMGLDELRLLPNARPPHRDTPQVAAQ-DRLAMVREAVQGVACL
NADD_BACFR      --KTGIFSGSFNPIHIGHLALANYLCEFEGLDEVWFMVTPHNPFKNQADLWPDELRLQLVQLAIEGYPRF
NADD_BACFN      --KTGIFSGSFNPIHIGHLALANYLCEFEGLDEVWFMVTPHNPFKNQADLWPDELRLQLVQLAIEGYPRF
NADD_SYMTH      MARVAVLGGTFDPIHLGHLAAAQGVLHLTGVERVIFLPNRQPPHKQGQPVTPAEHRAAMVRLAIADNPAF
NADD_LEGPA      MHSIAIFGGTFDPVHNGHIKTSLAIQANFGFDSYYFLPCKSPAIKPPSFASSEQ-RVEMLKLALKPYPDF
NADD_LEGPL      MHSIAIFGGTFDPVHNGHIKTSLAIQANFGFDSYYFLPCKSPAIKPPSFASSEQ-RVEMLKLALKPYPDF
NADD_LEGPH      MHSIAIFGGTFDPVHNGHIKTSLAIQANFGFDSYYFLPCKSPAIKPPSFASSEQ-RVEMLKLALKPYPDF
NADD_NEIMF      MKKIGLFGGTFDPIHNGHLHIARAFADEIGLDAVVFLPAGGPYH-KXXXXXXXXXRLAMVELATAEDARF
NADD_MYCS2      -------GGTFDPIHNGHLVAASEVADLFDLDEVVFVPTGEPWQKHHRRVSAAEDRYLMTVIATASNPRF
NADD_FLAPJ      --KIGLYFGTFNPIHIGHLIIANHMAENSDLDQVWMVVTPHNPLKKKDTLLDDYQRLHLVNLATEDYPKL
NADD_FLAJ1      --KIGLYFGTYNPIHVGHLIIANHMAEFADLDQIWMVVTPHNPLKKKSTLLDDQQRLQMVYLATEDYTKI
NADD_SHESH      --RIGILGGTFDPIHFGHIRPALEVRDKLNLDRVWLMPNHIPPHKASTCVSTE-QRLEMVQLVCDQYDEF
NADD_SALG2      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIDDKPLF
NADD_SALEP      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIDDKPLF
NADD_PSEPW      VRRIGILGGTFDPVHIGHLRSALEVTEFMGLEELRLLPNARPPHRDTPQVAAE-DRLAMVREAVQGVERL
NADD_SHEB5      --RIGILGGTFDPIHYGHIRPAIEVKHALALDKILLMPNHIPPHKQQPNLT-TAQRLKMVADVCSQLDGF
NADD_PSYIN      ---IGFLGGTFDPIHFGHLRPALEITEALSLQQLFIMPNHIAPHKSASHASARQ-RSEMVELAISHQARM
NADD_NEIM0      MKKIGLFGGTFDPIHNGHLHIARAFADEIGLDAVVFLPAGGPYH-KXXXXXXXXXRLAMVELATAEDARF
NADD_GRAFK      -RKVGLFFGTFNPIHTGHLIIANHMAEYSDLEEIWLVVTPHNPHKKKSSLLDNHHRLEMVYRACEGYGKL
NADD_ERWCT      ------FGGTFDPIHYGHLQPVTALAKLVGLTQVVLMPNNVPPHRQQPEASSR-QRFHMAELAVEGNPLF
NADD_CHRVO      --RVGVFGGTFDPVHHAHLRMARAFADELALDEVRLIPAGQPYHRLEGPHASAAQRLDMVKLAIAADARL
NADD_THICR      ---IGINGGTFDPIHFGHLRPALEVLHALHLDEMRFIPAYQPVHRASPSVSAQ-QRCEMVQLAIQNQPSF
NADD_NEIG2      MKKIGLFGGTFDPIHNGHFHIARAFADEIGLDAVVFLPAGGPYH-KXXXXXXXXXRLAMVELATAEDARF
NADD_NEIG1      MKKIGLFGGTFDPIHNGHFHIARAFADEIGLDAVVFLPAGGPYH-KXXXXXXXXXRLAMVELATAEDARF
NADD_LEGPC      MHSIAIFGGTFDPVHNGHIKTSLAIQANFGFDSYYFLPCKSPAIKPPSFASSEQ-RVEMLKLALKPYPDF
NADD_SHEB9      --RIGILGGTFDPIHYGHIRPAIEVKHALALDKILLMPNHIPPHKQQPNLT-TAQRLKMVADVCSQLDGF
NADD_SALTY      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIADKPLF
NADD_SALPK      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIADKPLF
NADD_SALPB      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIADKPLF
NADD_SALPA      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIADKPLF
NADD_SALCH      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIADKPLF
NADD_SALAR      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIADKPLF
NADD_SHEDO      --RIGILGGTFDPIHYGHIRPALEVKNALNLDSIWLMPNHIPPHKAGPK-TGTAHRLAMVQLVCSQHNEF
NADD_SHEB2      --RIGILGGTFDPIHYGHIRPAIEVKHALALDKILLMPNHIPPHKQQPNLT-TAQRLNMVADVCSQLDGF
NADD_SALTI      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIADKPLF
NADD_SHEB8      --RIGILGGTFDPIHYGHIRPAIEVKHALALDKILLMPNHIPPHKHQPNLT-TAQRLKMVADVCSQLDGF
NADD_PSEE4      VRRVGILGGTFDPVHIGHLRSALEVAEFMRLDELRLLPNARPPHRDTPQVSAQ-DRLAMVRDAVAGVGGL
NADD_NEIMB      MKKIGLFGGTFDPIHNGHLHIARAFADEIGLDAVVFLPTGGPYH-KXXXXXXXXXRLAMVELATAEDARF
NADD_NEIMA      MKKIGLFGGTFDPIHNGHLHIARAFADEIGLDAVVFLPTGGPYH-KXXXXXXXXXRLAMVELATAEDARF
NADD_ESCF3      -----LFGGTFDPVHYGHLIPVETLANLIALSRVIIMPNNVPPHRPQPEAT-SVQRKEMLALAISDKPLF
NADD_VESOH      -KIIGFFGGSFDPIHYGHLKNAAQLKDKLRLSKLFLMPCDKPVHKKQLNFSINQ-RIDMLHLAIKEFNTL
NADD_ROSCS      --RTGILGGSFDPIHYGHLAIAEEXXXXXXXXXXXIIPAREQPLKPGGSVASPAHRLAMARLACADNPFF
NADD_PSEF5      -KRIGLLGGTFDPVHIGHLRGALEVAESMQLDELRLVPSARPPHRDTPQVS-ALDRLAMVECAVAGVSPL
NADD_LISMO      --KVGILGGTFDPPHLAHLHMXXXXXXXXXXXXILFLPNKIPPHKHISGMASINERVEMLQLMIEGIDSF
NADD_AERHH      ---IGILGGTFDPIHIGHLRPAIEARDALGLAEVRLLPNHIPPHRASPFCSSE-QRLAMVALAAAENPGF
NADD_SALRD      ---VGLFGGSFNPPHVAHLVVAEVVRDQFGLDEVWWIPNATPPHKPNDELAAVQHRLAMTERTVEGNPAF
NADD_PSEAE      -KRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVS-AAQRLAMVERAVAGVERL
NADD_PSEAB      -KRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVS-AAQRLAMVERAVAGVERL
NADD_PSEA8      -KRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVS-AAQRLAMVERAVAGVERL
NADD_GLOVI      -ERLGIFGGTFNPVHRGHLAMARAARDRCGLDQILWVPAAQPPHKPLAGGASIGDRVEMVRLAIAGEAGM
NADD_SHEAM      -----LLGGTFDPPHFGHIRPLLDVLKHWPLQDCWLLPNHIPPHKPGTHASPKA-RLEMIDALCREFPAF
NADD_PELUB      --KIGILGGTFDPAHKGHLEISKQAKKILELKNIIWAITKQNPFKNTSK-TDLKNRIKFAKKIIGKNNFI
NADD_ANAVT      MQHLAIFGGTFDPIHWGHLLIAEAALQQISIEKVIWVPSLNPPHKKASAFRH---RLAMLQLATQDNPAF
NADD_IDILO      -----IFGGTFDPIHNGHLQTAAALVKELGISTLALMPSAVPPHRPQPDASPEQ-RLDMVKLASQYHKAF
NADD_COXBU      ---LGLFGGTFDPIHKGHLALANELIKLPSLTEIQFIPSRQPPHRP-SPLASPADRLEMIKRAIANQPNL
NADD_COXBR      ---LGLFGGTFDPIHKGHLALANELIKLPSLTEIQFIPSRQPPHRP-SPLASPADRLEMIKRAIANQPNL
NADD_THEM4      -----IYGGSFNPPHNGHIIIAQLVREMFRFADFHVVTSSTPPHKKVDVSFKE--RFFLTKKAFEKVEGI
NADD_PSEA7      -KRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRDAPQVS-AAQRLAMVERAVAGVERL
NADD_ENTS8      ------YGGTFDPIHYGHLRAVEALAREVKLTQVTILPNNVPPHRP-QPGASSLQRKAMVELAIAGHPLF
NADD_CYTH3      --KIGLFFGSFNPIHVGHLIIGNTMAETTDLDEVWYVVSPQNPFKKNQSLLHEFDRFDMVTAAIANNPKF
NADD_COXBN      ---LGLFGGTFDPIHKGHLALANELIKLPSLTEIQFIPSRQPPHRP-SPLASPANRLEMIKRAIANQPNL
NADD_ARCB4      --KIAIFGGSFDPIHIAHKAIVKRALEELEIDKLIIVPTYLNPFKS-SFYLEPKVRXXXXXXXXXXXXXX
NADD_HAHCH      ---IVLLGGTFDPIHFGHLRTALELQQHFESAEVRLIPCGDPRHRSAPKASGEH-RLAMLRLALEGEPSL
NADD_BUCAT      MKKLAIFGGNFDPIHYGHINLAEKLAKDISIKKIILLPNNYPPHRK-KTQTSISDKIKMIKLAIHNNPLF
NADD_ANASP      MQHLAVFGGTFDPIHWGHLLIAEAALQQIPIEKVIWVPSLNPPHKKASAFRH---RLAMLQLATQDNPAF
NADD_PARD8      --KTGIYSGSFNPIHIGHLALANWLCEFEGLDEVWFVVTPHNPXXXXXXXXXXSLRLEMAQAAIDGYPKF
NADD_BUCAP      MKEIAIFGGNFDPIHYGHITSAEKLSREISIKKIILLPNYGPPHRS-KTKTSIIDRLKMIKFAIKDNKLF
NADD_BORA1      MKRIGLLGGSFDPIHVAHVTLAQSALAHLQLDEVQLVPAANPWQRAPLAATAQ-DRLAMINAAITGLPGL
NADD_MARMS      ---LAIMGGTFDPIHNGHLRTAVEILDRFHYSALKLIPCFQPVHKGRPSVLPQ-QRFEMAELAISSDDRL
NADD_ECOLU      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_CITK8      -----LFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKY-MLELAIADKPLF
NADD_SHIB3      -----LFGGTFDPVHYGHLNPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_CHRSD      --RVAMLGGTFDPVHMGHLRSAVELREALELDRVHMVPARVPPHRATPGVSAE-RRAALLALGIGDTPGL
NADD_CELJU      ---LGLFGGTFDPIHIGHLRLALELKQQLQLDGMRLMPCHLPAHRD-QPGASSTQRATMLQLALAACPEL
NADD_SHIBS      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIANKPLF
NADD_BUCAI      MKKLAIFGGNFDPIHYGHINLAEKLAKDISIKKIILLPNNYPPHKTQTSISDKI---KMIKLAIHNNPLF
NADD_BUCA5      MKKLAIFGGNFDPIHYGHINLAEKLAKDISIKKIILLPNNYPPHKTQTSISDKI---KMIKLAIHNNPLF
NADD_SHISS      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_SHIFL      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_SHIF8      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECOSM      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECOSE      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECOLI      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECOLC      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECOHS      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECO8A      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECO7I      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECO24      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_HERAR      ---IALLGGSFDPVHNGHVALADYFVALLKPDELRVIPAGNPWQKHGLQASGQ-DRMAMVRSAFSTQKVV
NADD_SHIDS      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_FUSNN      --KIAIYGGSFNPMHIGHEKIVDYVLKNLDMDKIIIIPVGIPSHRE-NNLEQSDTRLKICKEIFKNNKKV
NADD_ECOL6      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSMQRKHMLELAIADKPLF
NADD_ECOL5      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSMQRKHMLELAIADKPLF
NADD_ECOK1      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSMQRKHMLELAIADKPLF
NADD_ECO5E      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECO57      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
NADD_ECO45      -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSMQRKHMLELAIADKPLF
NADD_BORT9      --RIAILGGTYNPVHVGHMFLAKEIEHFLNVDKILFIPTHKPVHKCVENISVK-DRIAMLKLAVQHENNM
NADD_SERP5      -----LFGGTFDPIHYGHLRPVEALAAEAGLNRVTLLPNHVPPHRPQPEANAQ-QRLKMVELAIAGNPLF
NADD_SOLUE      --KLAIFGGTFDPIHAGHLAAAREASTRFALDRVLFIPAAHPPHKAGVTHAPYDDRVRMAELACRDDARF
NADD_PETMO      -----LFGGSFNPPHIGHRIIAEIAYDEFNPDRFLIVPSKNPPHKSIDFIANFDKRYSWCERVFFEH-YF
NADD_KLEP7      -----IYGGTFDPVHYGHLKPVEILANQIGLSKVIIMPNNVPPHRPQPEAT-SAQRVHMLKLAIADKPLF
NADD_PSESM      -RRIGMLGGTFDPVHIGHXXXXXXXXXXXXXXXXXXTPSARPPHRDMPSVTAQ-DRLAMVRSAVAGVSPL
NADD_PSEU2      -RRIGMLGGTFDPVHIGHXXXXXXXXXXXXXXXXXXTPSARPPHRDMPSVTAE-DRLAMVQSAVAGVSPL
NADD_PELPB      ---LALFGATFDPPHNGHLALCLFARELLGIDKLIVSVSNNPPESGRADVHRMRMAELLTQEINLTGAFS
NADD_SODGM      ------YGGTFDPIHYGHLRPVIALARLVNLQRVILLPNNVPPHRP-QPVASAQQRLAMARLAIAPDPIF
NADD_KLEP3      -----IYGGTFDPVHYGHLKPVEILANQIGLSKVIIMPNNVPPHRPQPEAT-SAQRVHMLKLAIADKPLF
NADD_AQUAE      -----VFGGSFDPVHVGHIILARDVCEHFNAKEVIFVPTYQAPLKE-KHKASAQDRLNMLKLALEREEKF
NADD_HELPJ      -KELALYGGSFDPLHKAHLAIIEQTLELLPFVQLIVLPAYQNPFKK-PCFLDAKTRFKELERALKGMPRV
NADD_HELP2      -KELALYGGSFDPLHKAHLAIIDQTLELLPFAKLIVLPAYQNPFKK-PCFLDAKTRFKELERALKGMPRV
NADD_LARHH      ---IGLFGGSFDPVHEGHLRLARALRDELQLAEVRLLPAGTPPHXXXXXXXXXXXXXXXXXXXXEP--GL
NADD_THELT      --KIGIFGGSFNPPHIGHLIISQYAIEMLQLDLLYIVPTYIPPHKS-NDLAPFELRFKWCKITFSG-PHI
NADD_YERPY      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_YERPS      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_YERPP      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_YERPN      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_YERPG      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_YERPE      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_YERPB      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_YERPA      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_YERP3      -----LFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_HELPY      -KELALYGGSFDPLHKAHLAIIEQTLELLPSAKLIVLPAYQNPFKK-PCFLDAQTRFKELERALKGIDRV
NADD_HELPH      -KELALYGGSFDPLHKAHLAIIDQTLELLPFVKLIVLPAYQNPFKK-PCFLDVQTRFKELERALRGIDRV
NADD_METPP      -RRIGLYGGSFDPPHMGHLVLAMTAVQHLKLDELRWIPAG-VAWQKERTLLSATHRAGMVKAAITGHRGF
NADD_COPPD      --RTGLLAGVFDPVHIGHLFMAHLAMEAANLDRVWFVPTHIPPHKDSAKV-PYFHRVNMLEMALKEEPKF
NADD_YERE8      -----LFGGTFDPIHYGHLKPVETLAQQVGLQHIILLPNHVPPHRPQPEANAQ-QRLKMVELAVAGNPLF
NADD_NITSB      --KIAIFGGSFDPPHKGHIAIVKRALEELDIDYVIIVPTYLNPFKTSFQASPSL-RLRWLRKIFLPYNRV
NADD_MARAV      -----IYGGTFDPIHHGHLRLALEVSEALEVSRVHLVPSHIPPH-RGSTGASSAQRLEMIRQAIAGEPAL
NADD_CHLPD      ---VAVFGGTFDPPHNGHLAMCLLARELLHIDKVILSISNNPFKLLRSDHDDHLLASELKKTELPA----
NADD_SACD2      -----LFGGTFNPVHNGHLVSAMAAREALGVDSVTLLPCYVPPHKTAPTIAAE-HRLAMLQHVVQENNHL
NADD_PSEMY      ---------TFNPVHNGHLRAALEVAEFMALDELRLIPSARPPHRDAPQASAE-QRLAMVRLAVADEPRL
NADD_CHLP8      --RTGIFGGSFDPPHNGHLAMCLFARELLRLDRLIVSVSRNP-FKTGAHASDDD-RVSMARLLTDEVNFA
Y336_MYCPN      -----IFGGAFDPLHQAHIYIAKRAVQAIKAQKLYFVPTAKAFFKSPIKASNQA-RLAMLRVALKALPQM
NADD_BORBR      MTRIGLLGGSFDPVHVAHIALADTARQFLGLDQVQLIPAANPWQRQPLKASAP-HRLRMLELAIAGHPAL
NADD_CHLL2      ---VALYGGSFDPPHNGHLALCLFAVELLRIDRLIISVSINPFKGRYGAADEQ--RKQMASLFAGELSRV
NADD_BORPE      --RIGLLGGSFDPVHVAHIALADTARQFLGLDQVQLIPAANPWQRQPLKASAP-HRLRMLELAIAGHPAL
NADD_TREPS      --KLALFGGSYDPVHLGHLLLADAVHRHAGYDRVLFVPTFVSPFKEKEGSASAHDRVRMLHLAIGTTPYF
NADD_TREPA      --KLALFGGSYDPVHLGHLLLADAVHRHAGYDRVLFVPTFVSPFKEKEGSASAHDRVRMLHLAIGTTPYF
NADD_PROVI      ---VGVLGGTFDPPHNGHLALALFARELLCVDRLILSVSDNPLKQRQRKAMTELLCHEINRTG----TFC
NADD_BORPA      --RIGLLGGSFDPVHVAHIALADTARQFLGLDQVQLIPAANPWQRQPLKASAP-HRLRMLELAIAGHPAL
NADD_PSEA6      ---LGIFGGTFDPVHYGHTESXXXXXXXXXXXXXXMLPCHIPVHKNHAP-SDSHHRLAMLKLAIEQYPQL
NADD_CHLPB      --RLAVFGGSFDPPHNGHLALCLYARELLQVDRLVISASNNP----LKDARDRVKMAELLAETIRTGAFA
NADD_UREPA      --KIILFCGAFDMVHNAHIAMAKQAMKLVNADKLIFLPSNNLEYEKTK-LTPGHHRIAMLKIATKNLVNI
NADD_PORG3      ----GLFFGSFNPMHIGHLALANYLTEYTPIRQLWFVPSPLNPLKNTQELLPYDLRCELIEQAIRKDIRF
NADD_CAMJJ      --KIALFGGSFDPPHNGHNSVVLEALEKLDIDKLIIMPTYINPFKK-SFSADEKQRFLWVKKLWGHLPKV
NADD_HALHL      LRTIGLLGGTFDPIHYGHLRPAEEVREAVQLSEXXXXXXXXXXXXXXXXVGPEQ-RAELVRRAVADNPSA
NADD_CHLT3      MKKIALFGGSFDPPHYGHFALCTLTRELFSPEKIILSISKNP--LKGSANAPEAHQLAMAKLMAEELGVF
NADD_BURS3      -----MLGGTFDPIHDGHLALARRFAEXXXXXXXXXXPAGQPYQKR--DVSAAEHRLAMTRAAAGSLSMV
NADD_BAUCH      ------YGGTFDPIHHGHLQPVIALAQLVNLKQVILLPNHIPLHRPLPKATPQ-QRLRMTRLAITPGKLF
NADD_AZOPC      --RIGILAGSFNPVHIGHLAIANYLAEYEGYDKIWFLITPQNPLKNEGELMXXXXXXXXXXKSIKDYNRF
NADD_PORGI      ----GLFFGSFNPMHIGHLALANYLTEYTPIGQLWFVPSPLNPLKNTQELLPYDLRCELIEQAIRKDIRF
NADD_PELLD      ---LAVFGGTFDPPHNGHLAMALFARELLPADRILISVSDNPSDRQRLDMA-ELLSLEINRTGMNA----
NADD_CAMJR      --KIALFGGSFDPPHNGHNSVVLEALEKLDIDKLIIMPTYINPFKQ-SFSADEKQRFLWVKKLWGHLPKV
NADD_CAMJE      --KIALFGGSFDPPHNGHNSVVLEALEKLDIDKLIIMPTYINPFKQ-SFSADEKQRFLWVKKLWGHLPKV
NADD_CHLCH      -----LMGGSFDPPHNGHXXXXXXXXXXXNVECLFLSPSRNP--FKGESLLDDVHRIQLVKEVNRTGSGC
NADD_CAMJ8      --KIALFGGSFDPPHNGHNSVVLEALEKLDIDKLIIMPTYINPFKQ-SFSADEKQRFLWVKKLWGHLPKV
NADD_STRMK      ------YGGTFDPVHLGHLAIARAARDELQV-AVRMLPAADPPHRAVPGATAD-QRFTMLSLAIGDEPGL
NADD_WIGBR      ------YGGTFDPIHNGHIKSAIALAKLIHLNRIILIPNGSPVHKPIPVASAE-DRINMINLAXXXXXXX
NADD_BURCJ      -----MLGGTFDPIHDGHLALARRFAEXXXXXXXXXXPAGQPYQKR--DVSAAEHRLAMTRAAAGTLSVV
NADD_PROA2      --RLALFGGSFDPPHNAHLALCLCARELLDIDKLIISVSNNPKENRSASNAHRLAMAELLVSEINATGRI
NADD_FERNB      -----IFGGSFNPPHIGHTVILSYALDYFNADFYI-IPTKTPPHKVVDIDFDK--RFEWVMKSFKCFDTY
NADD_METCA      ---IGIYGGTFDPVHYGHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTRLRMLEIXXXXXXXXX
NADD_ERYLH      --RTGLLGGSFNPAHGGHRRISLFALQALRLDEVWWLVSPGNPLKSADGMASHEARY---RSALEQARRA
NADD_CHLTE      --RTAVFGGSFDPPHNGHLALSLFARELAGLDRLIVSVSKNPXXXXXXXXXXXXXXXLLVAEINVAGVFA
NADD_CAUSK      --RVGLFGGSFNPAHEGHAHVAETAMHRLKLDKVIWLVSPQNPLKSSHETRPLAERMAGVRRWARGGGMI
NADD_ACHLI      -----VYGGSFNPPTIAHEAIIHKLHEEFKPKKILIVPTGN--YFSWKDLIDFEHRFKMVELMTQHLDYV
NADD_RHOFD      MKRIGVFGGAFDXXXXXXXXXXXXXXXELQLDELRVVPTGEAWHKT-RTLSPAPHRLAMAQLAFAELPHV
NADD_PARL1      --KVGLLGGSFNPAHEGHLHVTRMCLRALGLDRVWWLVSPQNPLKSDAGMASFDRRLASAEKARDPRICV
NADD_SULDN      MDTIALFGGSFDPPHIGHEAIIEALXXXXXXXXXXXMPTFLNPFKS-NFYAPSSLRVKWLREIFKEEKRV
NADD_SILST      ---VGLLGGSFDPPHEGHVQISRAALKRFDLDQLWWLVTPGNPLKE----NPPASMTRRIKAAREIMDHP
NADD_RHILW      ---VGLFGGSFNPPHQGHALVAEIAIKRLGLDQLWWMVTPGNPLKSRNQLAPLAERIESERVAADPR--V
NADD_SILPO      ---IGLFGGSFDPPHAGHVHVTREALKMFGLDRVWWLVTPGNPLKAHGPAPLDXXXXXXXXXXXHP----
NADD_RHIE6      ---VGLFGGSFNPPHQGHALVAEIAIKRLGLDQLWWMVTPGNPLKSRNQLAPLAERIESERVAADPR--I
NADD_RHIME      ---VGLFGGSFNPPHDGHALVAETALRRLGLDQLWWMVTPGNPLKDRNHLAPLGERIAMSEK-IARNPRI
NADD_RHIL3      ---VGLFGGSFNPPHQGHALVAEIAIKRLRLDQLWWMVTPGNPLKSRNQLAPLAERLESERVAADPR--I
NADD_ROSDO      ---IGLFGGSFDPAHQGHAHITREALKRFGLDRVWWLVSGNPLKPQGPAPLDTRMAR---AKAIMQHPRV
NADD_RHIEC      ---VGLFGGSFNPPHEGHALVAEIAIKRLGLDQLWWMTPGNPLKSRLAPLAERIAESERV--AADPR--I
NADD_MYXXD      --QVALLGGSFNPPHVGHLMAATYVHATQDVDEVWLMPSWQHPFGKQMEPFEH--RVAMCDALCAETSGW
NADD_AGRT5      ---VGLFGGSFNPPHAGHALVAEIALRRLGLDQLWWMVTPGNPLKSRSELASLEDRIAACERLVSD-PRI
NADD_SULNB      --EVAIFGGSFDPPHKGHQQIVRKAVQILDIDKLIVLPAYLNPFKN-VSLANPEKRLEWCYQLFDGIPKV
NADD_LEPIN      ----GIFGGSFDPPHEGHSEILKSFFEVSDCKEVFVIPNRQNPLKEEKISLPENI-LEMLNLFVSEFSSI
NADD_LEPIC      ----GIFGGSFDPPHEGHSEILKSFFEVPDCKEVFVIPNRQNPLKEEKISLSENI-LEMLNLFVSEFSSI
NADD_HELHP      ---IALYGGSFDPLHYAHMEIIRLLRENLLYKRIILMPNYRNPLKSSSFFTPKILADEMAKSCNQKIPYI
NADD_GLUOX      --RIGLLGGSFNPAHAGHLMXXXXXXXXXXXDQVWLMVSPGNPLKPSKGMAPFRVRLASAERIADGRRIV
NADD_XYLFT      ------YGGTFDPVHVGHXXXXXXXXXXXXXXXXXXXXX-DPPHRPTPG-SSSMDRLRMLQLAVSKEPGL
NADD_XYLF2      ------YGGTFDPVHVGHXXXXXXXXXXXXXXXXXXXXX-DPPHRPTPG-SSSMDRLRMLQLAVSKEPGL
NADD_RHILO      ---VGLFGGSFNPPHAGHALVAEIALRRLALDQLWWMVTPGNPLKSTRELAPLAERLQL-SEQIARNPKI
NADD_XYLFM      ------YGGTFDPVHVGHXXXXXXXXXXXXXXXXXXXXX-DPPHRPTPG-SSSMDRLRMLQLAVSKEPGL
NADD_LEPBL      ----GIFGGSFDPPHEGHSGILKSFFRVPDCREIFLIPNRQNPLKGEKFSSSENI-LEMLNLFVSEFSTI
NADD_LEPBJ      ----GIFGGSFDPPHEGHSGILKSFFRVPDCREIFLIPNRQNPLKGEKFSSSENI-LEMLNLFVSEFSTI
NADD_XYLFA      ------YGGTFDPVHVGHXXXXXXXXXXXXXXXXXXXXX-DPPHRPTPG-SSSMDRLRMLQLAVSKEPGL
NADD_BRUME      ---VGLFGGSFNPPHGGHALVAEIAIRRLKLDQLWWMVTPGNPLKDSRELAPLSERLRLSEEVAEDP---
NADD_BRUAB      ---VGLFGGSFNPPHGGHALVAEIAIRRLKLDQLWWMVTPGNPLKDSRELAPLSERLRLSEEVAEDP---
NADD_BRUA2      ---VGLFGGSFNPPHGGHALVAEIAIRRLKLDQLWWMVTPGNPLKDSRELAPLSERLRLSEEVAEDP---
NADD_RHOSK      ---VGLLGGSFDPPHPGHVHITREALKRFGLDRVWWLV--SPGNXXXXXXXXXXXXXXXXXXXXMRHPRV
NADD_RHOS4      ---VGLLGGSFDPPHPGHVHITREALKRFGLDRVWWLV--SPGNXXXXXXXXXXXXXXXXXXXXMRHPRV
NADD_RHOS1      ---VGLLGGSFDPPHPGHVHITREALKRFGLDRVWWLV--SPGNXXXXXXXXXXXXXXXXXXXXMRHPRV
NADD_METEP      --RIGLYGGSFNPAHAGHLHVSRTAXXXXXXXXXXXXXTGNPDHGVLAPLDERVAQ----ARALATDPRI
NADD_METC4      --RIGLYGGSFNPAHAGHLHVSRTAXXXXXXXXXXXXXTGNPDHGVLAPLDERVAQ----ARALATDPRI
NADD_RHOS5      ---VGLLGGSFDPPHAGHVHISLEALKRFRLDRVWWLV--SPGNXXXXXXXXXXXXXXXXXXXXMRHPRV
NADD_BORPD      MKRIGLLGGSFDPVXXXXXXXXXXXXXXXXXDSVQLIPAANP----WQRAASAGHRLRMIELAIDGEPQL
NADD_ANADE      -REIALLGGSFNPPHVAHLMAAWWALATQGVSEVWLLPAFR--HPFGKELAPFEDRLEMCRLAARALRGV
Y240_MYCGE      ----------------------------------------------------------MLKLAIKSVNNA
NADD_BRUSU      ---VGLFGGSFNPPHGGHALVAEIAIRRLKLDQLWWMTPGNPLKDXXXXXXXXXXXXXXXXVAEDP----
NADD_ANAD2      -REIALLGGSFNPPHVAHLMAAWWALATQGVSEVWLLPTFR--HPFGKDLAPFEDRLEMCRLAARALRGV
NADD_ANASK      -REIALLGGSFNPPHVAHLMAAWWALATQGVSEVWLLPTFR--HPFGKDLAPFEDRLEMCRLAARALRGV
NADD_GLUDA      --RIGVLGGSFNPVHDGXXXXXXXXXXXXXXDQVWLMISPGYPLKPVQGMAPFDVRLASVAARFDGRRLV
NADD_BRAJA      --RVGLLGGSFNPPHQAHRAISQFALKRLQLDRVWWLVTPGNPLKENGTLHELGARMQAARDANDPRIEV
NMNA3_MOUSE     --------GSFNPITNMHLRLFEVARDHLQVIEGIISPVNDSYGKK--DLVASHHRVAMARLALQTSDWI
NMNA3_HUMAN     --------GSFNPITNMHLRMFEVARDHLQVIQGIISPVNDTYGKK--DLAASHHRVAMARLALQTSDWI
COAD_VESOH      MKKIAIYPGSFDPITNGHVDLIKRASKL--FDEIIIGISQNSKKKAFLSINDRIDTINTALKDINNVDFA
NMNA1_MOUSE     --------------------------------------------KEWVE-TVKVLRYHQEKLATGSCSYP
COAD_PELUB      MKKVAVYPGTFDPITFGHIDVINKALKL--FDKVI-IAASDGANKNY--LFNSLERVQLIKKAL------
COAD_CLOAB      --KVAVYPGSFDPITNGHLDIISRASKV--FDKVIVGVLIN-PEKKGMFSVDE--RVDLIKRVIKPFNNV
NMNA1_HUMAN     ----------------------------------------------------------------------
COAD_SYNAS      MKKIAVYPGSFDPITNGHLDIIKRGLSM--FDELIVLIAYNAAKSSLFTVQE---RIEMIQEALHDRKGV
NMNA1_BOVIN     ----------------------------------------------------------------------
NMA2_YEAST      ----------------------------------------------------------------------
NMAH_SCHPO      --------GSFSPITYLHLRMTIQEQTNMELVAGYFSPVND--HYKKEGLAPAYHRVRMCELACETSSWL
NADD_CAMFF      ---IAIFGGSFDPPHNAHDAIVXXXXXXXXXXXXXXXPTYLNPFKTGADPKKRLVWCEALWQNLDKVE--
COAD_PYRFU      -------GGTFDRLHLGHKALLRKAF---EVGEIVYIGLTSDEMIKEKQYSERILPYE--KRLLDLIKFL
COAD_CLOPH      --KIGIYPGSFDPVTLGHLDVIRRSAKI--MDELVIGVLANSSKTPLFTVEERVKLLECVVKDIPNVKVV
COAD_FUSNN      --KIGVYAGSFDPITKGHQDIIERALKI--VDKLIVVVMNNPTKNYWFNLDE---RKNLISKIFE-----
NADD_SYNY3      --KIALFGTSADPPTLAHIWLAFDQVAVWAADNP-FKQGPNPETGHWASLGD---RQAMLKLLVEDYATV
COAD_METI4      MKRV-LYPGTFDPITLGHVDVISKAARL--FDEVVVGVAAQTPKETLFELEE---RMELVERTLKHFSFS
COAD_ALKMQ      --KVGIYPGSFDPITNGHIDIIKRASEI--YDRVIVSVMQNPNKNPMFTLGE---RVALIEQIIQPYSNI
COAD_PYRHO      -KKV-VVGGTFDRLHLGHKALLRKAF---EVGKIVYIGLTSDEMVKEKPYAEKILPYERLKDLIE---FL
COAD_KOSOT      -----IYPGSFDPITYGHMDILKRASKI--FDEVVVLVMKNINKRYFFTFSE---RLSMVEKAVEGIQNA
COAD_CALS8      --KIGVYPGSFDPVTNGHLDIIERASKI--FDKLIVAVLVNPNKTPVFDIDE---RVELLKETTE-----
COAD_BUCAP      MKKIAIYPGTFDPITYGHLDVITRATKIF---DNIIIAISNNVHKK------------------------
COAD_BORGA      --KVAVFPGSFDPITWGHIDLIKRSLAI--FDKVVVLVAKN---KSKKYLLSDVERFSLAKDVISSLNFL
COAD_BORAP      --KVAVFPGSFDPITWGHIDLIKRSLAI--FDKVVVLVAKN---KSKKYLLSDIERFTLTKDVISSLNFL
COAD_ANATD      --KIGVYPGSFDPVTNGHLDIIERASKI--FDKLIVAVLVNPNKTPVFDIEE---RVELLKETTE-----
NMA1_YEAST      ----------------------------------------------------------------------
NADR_HAEIN      -KKVGVIFGKFYPVHTGHINMIYEAFKVDELHVIV-----------------------------------
COAD_PYRAB      -KKV-VVGGTFDRLHLGHKALLRKAF---EVGKIVYIGLTSDDMVKNKPYAEKILPYERLKDLIE---FL
COAD_HELPS      MQKIGIYPGTFDPVTNGHIDIIHRSSELFEIVAVAYSCAKNP----------------------------
COAD_BLOPB      -----MYPGTFDPLTYGHLDIIIRAHKI--FDKIFLAVAENSQKHPLFSLEERVIFAKQATAMLDYVTVF
COAD_THEGJ      -----VVGGTFDRLHLGHKALLRKAF---EVGRYVYVGLTSDEMIRNKPYAEKILPYEL--RLMDLLKFF
COAD_SYNP2      ---IAIYPGSFDPITLGHLDIIERGDRLFEIVAVLCNPSKSPIFSLEKRVA-QIRRCTQHLPNVEVASFT
COAD_MYCPE      -KKACIFPGTFEVFHDGHLNILKRALKL--FDFVYIVVAIN----NTKTSSDLEKRYQKVEEKIDSLSIK
COAD_CARHZ      --RIAVYPGSFDPITNGHLDIIERAAEL--FDRLIVAIAKNPMKKPLFTLEE---RLDMLRETLKYYPNI
COAD_BORBZ      --RVAVFPGSFDPITWGHIDLIKRSLAI--FDKVIVLVAKN---KSKKYFLSDIERFSLTKDVISSLNFS
COAD_BORBU      --RVAVFPGSFDPITWGHIDLIKRSLAI--FDKVIVLVAKN---KSKKYFLSDIERFSLTKDVISSLNFS
COAD_HELPY      MQKIGIYPGTFDPVTNGHIDIIHRSSELFE----------------------------------------
COAD_HELPJ      MQKIGIYPGTFDPVTNGHIDIIHRSSELFE----------------------------------------
COAD_HELPH      MQKIGIYPGTFDPVTNGHIDIIHRSSELFE----------------------------------------
COAD_HELPG      MQKIGIYPGTFDPVTNGHIDIIHRSSELFE----------------------------------------
COAD_HELP2      MQKIGIYPGTFDPVTNGHIDIIHRSSELFE----------------------------------------
COAD_HELAH      MQKIGIYPGTFDPVTNGHIDIIHRSSELFE----------------------------------------
COAD_BORT9      --RVALFPGSFDPITWGHIDLVKRASLI--FDKVIVLVANNSAKSY---LLSDIERYELTFEVIASWSRI
COAD_RHOP2      MSRIALYPGSFDPVTNGHLDVVRHA---VELCDRLVVAIGIHPGKKPLFTTEE--RLVMVRRVFEP----
COAD_LEPBP      MKSIAVYPGSFDPFTNGHLDIIRRAHPLFE--EIIIAVAIN---SKKTSLFSPEERVEMIGKVFHGWDKI
COAD_LEPBA      MKSIAVYPGSFDPFTNGHLDIIRRAHPLFE--EIIIAVAIN---SKKTSLFSPEERVEMIGKVFHGWDKI
COAD_CLONN      --RVAIYPGSFDPITEGHLDIIKRASKV--FDEVIVSVLVNPDKKGLFSIEERVKLIEKVTEDID-----
COAD_MICAN      ---IAIYPGSFDPVTLGHLDIIERSVPLFEIVAVLCNPHKNPLFTVEKRI-EQISYCTKHLKNVEIDSFS
COAD_DESRM      --RIGVYPGSFDPVTNGHMDIVERSVGL--FDRLIVAVAKNAQKKPLFSVEE---RVEILKNVLKKYPNI
COAD_CLOBJ      --KTAVYPGSFDPITKGHLNIIKRASKV--CDKLIVAVLVN-PEKKGLFSVDE--RVEMIKRVTKKHS--
COAD_CLOBH      --KTAVYPGSFDPITKGHLNIIKRASKV--CDKLIVAVLVN-PEKKGLFSVDE--RVEMIKRVTKKHS--
COAD_CLOB1      --KTAVYPGSFDPITKGHLNIIKRASKV--CDKLIVAVLVN-PEKKGLFSVDE--RVEMIKRVTKKHS--
COAD_WOLWR      --KIGIYPGTFDPITFGHLDIIKRACKLVD----------------------------------------
COAD_WOLPP      --KIGIYPGTFDPITFGHLDIIKRACKLVD----------------------------------------
COAD_WOLPM      --KIGIYPGTFDPITFGHLDIIKRACKLVD----------------------------------------
COAD_MYCPU      -KKIAIFPGSFDPFHNGHKHILNKALALFDL---------------------------------------
COAD_LISW6      --KIAVIPGTFDPITNGHLDIIERAAKIF---DVLYVAVLNNSSKKPLFTVEE--RMEMIKQ--------
COAD_LISIN      --KIAVIPGTFDPITNGHLDIIERAAKIF---DVLYVSVLNNSSKKPLFTVEE--RMEMIKQ--------
COAD_COPPD      -----VYPGTFDPITKGHLDILVRAAQV--FDQVTLLVLSNLQKKSLFSLEE---RVRLAKSAIEESSNI
COAD_CLOBM      --KTAVYPGSFDPITKGHLNIIKRASKV--CDKLIVAVLVN-PEKKGLFSVDE--RVEMIKRVTKNHS--
COAD_CLOBL      --KTAVYPGSFDPITKGHLNIIKRASKV--CDKLIVAVLVN-PEKKGLFSVDE--RVEMIKRVTKNHS--
COAD_CLOBK      --KTAVYPGSFDPITKGHLNIIKRASKV--CDKLIVAVLVN-PEKKGLFSVDE--RVEMIKRVTKNHS--
COAD_CLOB6      --KTAVYPGSFDPITKGHLNIIKRASKV--CDKLIVAVLVN-PEKKGLFSVDE--RVEMIKRVTKNHS--
COAD_CHLL2      MTQKAIYPGTFDPFTNGHLDVLERALNIFQ--EVVVVIADNSQKQTLFSVEE---RLSMIREIIEDYPAV
COAD_BORHD      --RVALFPGSFDPVTWGHIDLVKRASLI--FDKVIVLVANNSAKNY---LLSDVERYELTFEVIASWSKI


                         .         .         *         .         .         .         .:140
query           SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKND
NADD_CLOPE      SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKND
NADD_CLOPS      SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKNN
NADD_CLOP1      SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLINLNSWKNINEIFKFSNLVVFNRPGFDKND
NADD_CLOBB      SISDYEIDKKGFSYTYETLE--HFKNNDVELFFITGADCLMDIETWERADTILSLCNLVVFSRGGFSNKN
NADD_CLOBA      SISKYEIEKKGFSYTYETLE--HFKNNDVELFFITGADCLMDIEKWESSDKILSLSNLVVFSRGGFSNKE
NADD_CLONN      EVSDYELKNQGLSYTYKTLKHFNEKHKDTEWYFITGADCLMQLDSWKNINEVLSLCNFVVFRRSGYSMED
NADD_CLOB8      SVSDYEIEKGGLSFTHETLEYISDRDKDNELFFITGADCLFSMEKWKEVKKIFSLATLVVFSRGGINKSD
NADD_CLOK5      TVSNYEVNKTTLSYTYSTLEHFNKLESKTEWYFLTGADCLMDIEKWSRVDSIFRLCKFIVFNRPGFTSES
NADD_CLOK1      TVSNYEVNKTTLSYTYSTLEHFNKLESKTEWYFLTGADCLMDIEKWSRVDSIFRLCKFIVFNRPGFTSES
NADD_CLOTE      EISDYEVKKKGKSYTYETIEHFRKYHPNIDLYFIAGADCLMDIHKWKNIDSMMEKAKLVVFSRPGFSMDT
NADD_CLOAB      RIDDYEIKKKGISYTYETLEHFSRSQKDVDWFFIAGLDSLMDLDKWRNVNTILSLCKFIVFNRSGYNKSQ
NADD_CLOBJ      SISDFEIKSKGLSYTYRTLKHFKEKEPETNWYFITGEDCLSYLEHWKYIDEIFNICNFVIFSREGFXXXX
NADD_CLOBH      SISDFEIKSKGLSYTYRTLKHFKEKEPETNWYFITGEDCLSYLEHWKYIDEIFNICNFVIFSREGFXXXX
NADD_CLOB6      SISDFEIKSKGLSYTYRTLKHFKEKEPETNWYFITGEDCLSYLEHWKYIDEIFNICNFVIFSREGFXXXX
NADD_CLOB1      SISDFEIKSKGLSYTYRTLKHFKEKEPETNWYFITGEDCLSYLEHWKYIDEIFNICNFVIFSREGFXXXX
NADD_CLOBL      SISDFEIKSKGLSYTYRTLKHFKEKEPETNWYFITGEDCLSYLEHWKYIDEIFNICNFVIFSREGFXXXX
NADD_CLOBK      SISDFEIKSKSLSYTYRTLKHFKEKEPETNWYFITGEDCLSYLEHWKYIDEIFNICNFVIFSREGFXXXX
NADD_DESHY      EVSDLEIQRKGYSYTVDTLKELHELYPQHELYFITGADAFREIFTWREVQSVLSLSHFIGASRPGFDPLE
NADD_CLOBM      SISDFEIKSKDLSYTYRTLKHFKEKEPETNWYFITGEDCLSYLEHWKYIDEIFNICNFVIFSREGFXXXX
NADD_DESHD      EVSDLEIQRKGYSYTVDTLKDMHKLYPQHELYFITGADAFREIFTWREVQSVLSLSHFIGASRPGFDPHE
NADD_CLOTH      EKSRIEVDREGYTYTIDTLGILNEQYRGIDLYYIIGADVLYDLLTWKDYEKVFGICKFIAALRPGTGKEG
NADD_THEPX      EVSTIEIDREGYTYTIDTIKEFKKIYGETQLYFITGADAVLEILTWKSADELLKMCNFVAATRPGVEGNR
NADD_THEP3      EVSTIEIDREGYTYTIDTIKEFKKIYGETQLYFITGADAVLEILTWKSADELLKMCNFVAATRPGVEGNR
NADD_THETN      EVSSIEIDREGYTYTIDTIKEFKKMYGEKTLYFITGADAVLEILTWKNADELLRLCYFVAATRPGIEGNK
NADD_CARHZ      SVSNIEFLRDKPSYTFDTVEELKLLYPHDELYFITGADGLLEITGWYRGEELLKKIPIIAVSRAGVSKEV
NADD_BACSK      RVCDIELIRKGKSYTIDTVRELKQTYPDDEFFFLIGGDMVNMLPEWRGIDELKQLVTFVAFNRPG-----
NADD_MOOTA      EVSRSEIDREGFSYTVDTVEFRREYGPEVQLYFITGADAILEILTWKDVDTLLRECHFIAATRPGFQLNR
NADD_TROW8      SVSKIDIERTGPTFTVDTLRELREQLQSSDLFFITGTDALARIFSWKDADTLWSLAHFVAVSRPGHEVVD
NADD_CLOPH      SVSDMEFHREGNTYTADTLLELTKKFPDTEFYFIIGGDSLFELEKWSRPEIVMEKAHIVAAGRDDKDDDQ
NADD_TROWT      SVSKIDIERTGPTFTVDTLRELREQLPSSDLFFITGTDALARIFSWKDADTLWSLAHFVAVSRPGHEVVD
NADD_BACA2      KLELAEMDRKGPSYTYDTVRLLKERHPNDKLFFIIGADMIEYLPKWYKLDELLTLIQFIGVRRPGY----
NADD_BACHD      NICTIELEREGKSYTIDTVRTLTKKHPDVRFFFIIGGDMVKSLPTWKGIDELLATVTFIGFKRPGV----
NADD_BACCN      SLCLEELEREGPSYTYDTMLQLTKKHPDTTFYFIIGGDMVEYLPKWYNIEKLLELVTFVGVARPGYTLQT
NADD_LEIXX      TVSRVDVDRIGPTYTIDTLRDLHEERPEAELFFITGADAIAQILSWRDVEELWKLAHFVAVSRPGHDLSI
NADD_BACLD      KLETIELEREGPSYTFDTVRLLKDRYPDHEFYFIIGADMVEYLPKWSNIDKLVNMIQFVGVKRPGF----
NADD_BACSU      KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHV--
NADD_BACWK      SICLEELDREGPSYTYDTMVQLTEKYPDVQFHFIIGGDMVEYLPKWYNIEKLLKLVTFVGVARPGYTLHT
NADD_CALS8      EISDFEIKNKEPSWTINTLNYFATSYEKV--YFILGSDNLFEIIKWYRAEEILKKFPIIVLPR---ERNT
NADD_BACAA      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
NADD_GEOKA      HIETIELEREGPSYTYDTIRQLVAMHPNDEFYFIIGADMVEYLPHWHRIDELIELVTFVGVKRPG-----
NADD_BACCR      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLNLVTFVGVARPGYTLHT
NADD_BACC4      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLNLVTFVGVARPGYTLHT
NADD_ANATD      DISDFEIKKSNPSWTIDTLEYFSSIYERV--YFIIGSDNLSEIVKWYKAEEILKRYPLIVLPR---ERNA
NADD_OCEIH      KLNDMELKREGKSYTYDTIQELTDLYPSHTFYFIIGGDMVEFLPKWHRIDELLEMITFIGVSRPGYS---
NADD_GEOTN      HIETIELEREGPSYTYDTIRQLTAMHPDDEFYFIIGADMVEYLPNWHRIDELIELVTFVGVKRPG-----
NADD_GEOSW      HIETIELEREGPSYTYDTIRQLLSMHPDHEFYFIIGADMVEYLPHWYKIAELIQLVTFVGVKRPG-----
NADD_STRP1      AIETCELERQGISYTYDTMLYLTEQHPDVDFYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRP------
NADD_BACHK      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
NADD_BACAC      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
NADD_CLAMS      TVSRVDIDRAGTTYTIDTLRDIRRTHPDAELFFITGADAIQQILGWKDVAELWDLAHFVAVTRPGHDLTE
NADD_CLAM3      TVSRVDIDRAGTTYTIDTLRDIRRTHPDAELFFITGADAIQQILGWKDVAELWDLAHFVAVTRPGHDLTE
NADD_BACC2      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLNLVTFVGVARPGYTLHT
NADD_BACAH      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYTLHT
NADD_STRP3      AIETCELERQGISYTYDTMLYLTEQHPDVDFYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRP------
NADD_MYCVP      TVSRVDIDRGGATYTKDTLRDLRAQNPDADLFFITGADALASILSWQNWEEMFSIARFIGVSRPGYELDG
NADD_BACCZ      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYTLHT
NADD_BACC3      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYTLHT
NADD_BACC0      SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYTLHT
NADD_RUBXD      SADRIEIDAGRPMHTVETVPLLKERLPGEEWFFITGADEVSNLLSWKDPDRLLEEVVMVAATRPGYDLSH
NADD_EXIS2      SVSEIEFERETKSYTFDTIRELKRRYPEHAFFFLIGADSLVSLGTWHRSEKLYKEIEFGAVARPG-----
NADD_BACCQ      SICLEELSRKGPSYTYDTMLQLTKKHPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYTLHT
NADD_BACC1      SICLEELSRKGPSYTYDTMLQLTKKHPDVQFHFIIGGDMVEYLPKWYNIEMLLNLVTFVGVARPGYTLHT
NADD_STRP6      AIETCELERQGISYTYDTMLYLTEQHPDVDYYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRP------
NADD_STRP8      AIETCELERQGISYTYDTMIYLTEQHPDVDYYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRP------
NADD_BACC7      SICLEELSRKGPSYTYDTMLQLTKKHPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYTLHT
NADD_NOCSJ      TVSRVDIDRSGPTYTIDTLRDLRAQLPDAELYFITGVDALAEIFTWRDAEELFTLARFVGCTRPGYLMDD
NADD_SACEN      QVSRVDIDRAGPTYTADTLADLRALYPEAELYFITGADALEQILSWHRVDELFELAHFIGVTRPGY----
NADD_DEHSB      RVMDIEIKRSGPTYTADTLNDLKTILPETELYFMLGWDNLEALPRWHKASEIIRLCRLVAAPRIGQVKPD
NADD_STRMU      AIETIELKRKGVSYTYDTMKDLIEQNPDVDYYFIIGADMVDYLPKWHKIDELIQMVQFVGVQRP------
NADD_BACP2      RLELIEMEREGPSYTVDTVELLKKRHPEDEFFFMIGADMVEYLPKWHRIDDLLQMITFIGMKRPGYTGST
NADD_SYNAS      SFSDVENLRAGKSYSIETVEYLNKYLKSIEIYFILGQDAFQAIQTWKDWQKLLLLCNFSVLTRPGYESMG
NADD_KINRD      TVSRIDIDRGGFTYTIDTLRELRDLRPEADLFFITGADALAQILQWKDVAELWSLAHFVGVSRPGHALTD
NADD_DEHE1      RVMDIEIKRSGPTYTADTLNDLKLILPETELYFILGWDNLEALPRWHKASEIIRLCQLVAVPRIGQAKPD
NADD_PELCD      AVTDLENRRAGKSYSVHTLELLRQEYPRDEFYFIIGMDSYRSLGIWKDFPRLFELTNLVVAARPGSPCDD
NADD_DEHSC      RVMDIEIKRSGPTYTADTLNDLKTILPETELYFMLGWDNLEALPRWHKASEIIRLCRLVAAPRIGQVKPD
NADD_MYCGI      SVSRVDIDRGGATYTKDTLRDLRAQNPDADLYFITGADALASILSWQNWEEMFAIARFIGVSRPGYELDG
NADD_CORGL      MVSRVDIDRGGDTYTIDTLQDLSKQYPDAQLYFITGADALAQIVTWRDWEKTFELAHFVGVTRPGYELDG
NADD_THET8      TVSRLELDRPGPSYTVDTLREARRLFPQDELFFITGADAYRDVLTWKEGERLPEYATLVAVARPGY----
NADD_THET2      TVSRLELDRPGPSYTVDTLRKARRLFPQDELFFITGADAYRDVLTWKEGERLPEYATLVAVARPGY----
NADD_SYNJA      ACSDLEIRRPGPSYTIETLRSLMQEQPDTQWYWIIGVDALRDLPQWYQAEELARLCHWIV--APRIDAGD
NADD_ROSS1      EVSSIEIDRPGPSYTHVTLQLLHDQGLE-NLYLILGADALADLPRWRETPRILTLARIVVVSRPG-AAID
NADD_LACPL      RLETAEIERGGKSYTYETMKFLKAKHPDTQYYFIIGGDMVDYLHTWYHIDELVKLVTFVGIKRTGYPTTS
NADD_GEOSF      TISDIEGKRGGTSYSIHTLQELHLAYPADEFFFIIGSDSFLDIGSWKEYAAIFNLCNIVVVSRPGAVADP
NADD_ACIC1      TVSRVDIDRPGPTYTIDTLRDLRRGLTDPDLFFITGADALAKIMSWNRAEELLTMAHFVGVTRPGHRLDT
NADD_HERA2      SVSTIEVERSGVSYTIDTIQTLHQDQPHIEWWLIVGSDSLATLSRWHAAHDLVQLAHFAILERPGFEL-D
NADD_DESAD      GVSDIDISADGPTYTVDTLREASRRYPDAELYFIMGQDSLETFTTWKGWQSIPELANVVAVSRAEADHGA
NADD_ARTS2      TVSRVDVDRPGPTYTIDTLRDLRTQRPDADLFFITGADAMAQILSWKNIDELWSLAHFVGVTRPGHVLDG
NADD_MYCSS      SVSRVDIDRGGPTYTKDTLRDLHELNPDADLYFITGADALGSILSWQNWEEMFSIARFVGVSRPGYELDG
NADD_MYCSK      SVSRVDIDRGGPTYTKDTLRDLHELNPDADLYFITGADALGSILSWQNWEEMFSIARFVGVSRPGYELDG
NADD_MYCSJ      SVSRVDIDRGGPTYTKDTLRDLHELNPDADLYFITGADALGSILSWQNWEEMFSIARFVGVSRPGYELDG
NADD_FRAAA      TVSRVEIDRGGATYTIDTLRDLRGARPDDELFFITGADALAQIFTWRDHRELFELAHFVGVSRPGY----
NADD_COREF      HVSRVDIDRGGGTYTVDTLRDMRSQYPDADLFFITGADALAQIVTWRDWESMFGLAHFVGVTRPGYELDD
NADD_MYCLE      SVSRVDIDRTGPTYTRDTVHDLHALNPDSELYFITGADALASILSWQGWDELFDLARFVGVSRPGY----
NADD_GEOLS      RFSDIEAHRAGKSYTVDTLTALRTARPGDELHFIIGSDSFLELGLWHRYADIFPLASLIVLERPEKAITE
NADD_STRR6      VIETIELERKGISYTYDTMKILTEKNPDTDYYFIIGADMVDYLPKWYRIDELVDMVQFVGVQRPRY----
NADD_STRPN      VIETIELERKGISYTYDTMKILTEKNPDTDYYFIIGADMVDYLPKWYRIDELVDMVQFVGVQRPRY----
NADD_MYCTU      SVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGY----
NADD_MYCTA      SVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGY----
NADD_FRASC      TVSRIEIDRGGATYTIDTLRDLRAARPDDELFFITGADALAQIFTWRDHRELFELAHFVGVNRPGYHL--
NADD_METI4      EVSSFEVQSPAPSYSIRTVQEFHKLYPHAELFWIIGSDQVPGLPRWKDYAELIQIVKFIVVSRSNYEKRD
NADD_STRCO      SVSRIDIDRGGPTYTVDTLRDLRALNPDADLFFITGADALAQILTWRDSEELFSLAHFIGVTRPGHTLTD
NADD_MYCMM      SVSRVDIDRGGPTYTKDTLRDLHALNPAAELYFITGADALASIMSWQGWEQMFESARFVGVSRPGYERHD
NADD_MYCPA      SVSRVDIDRAGPTYTRDTLRDLHALNPDSELFFITGADALASILSWQGWETLFELAHFVGVSRPGY----
NADD_THERP      AISYVDVRRPGPCYTVDSLTLLRREYSDAELVFLMGEDSLHDLPTWHEPNRIAELALLGVALRPGIEVDQ
NADD_MYCA1      SVSRVDIDRAGPTYTRDTLRDLHALNPDSELFFITGADALASILSWQGWETLFELAHFVGVSRPGY----
NADD_MYCBP      SVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGY----
NADD_MYCBO      SVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGY----
NADD_LACLA      GLELIEIERGGKSYSYDTLKLLTEANPDTDYYFIIGSDMVEYLPKWYKIDELLKLVTFIA----------
NADD_DICTD      EVLPIELEREGVSYMVDTIRDLSTYFSNAELYLLLGNDAFRDFLKWKDPYKIVEKVSIIVGSREEYYTND
NADD_CORJK      LVSRVDIDRGGDTYTVDTLADIRAEYPEAELFFITGADALQKIVTWRDWEKIFDLAHFVGVTRPGYEPKD
NADD_THEMA      EVSDYEKRRGGVSYSIFTIEYFSEIYK-TKPFFIVGEDALSYFEKWYRYRDILKKSTLVVYPRYCGKPYH
NADD_GEOUR      TISDVEGRRGGKSYSIDTLKGLHSAFPHDEFFFIVGSDSFLDIGSWREYAAIFNLCNIVVVERPGXXXXX
NADD_GEOSM      MVSDMEGVRGGRSYSIDTLRELKAEHPDDELFFIVGADSFNDISTWKEYAAIFGLCNVISVQRPGSTITS
NADD_STAAT      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAAE      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAAC      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAA8      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAA3      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_THEP1      EVSDYEKGRGGVSYSIFTIEYFSEIYK-TKPFFIVGEDALSYFEKWYRYRDILEKSTLVVYPRYCGKPYH
NADD_SALAI      QVSRVDIDRGGPTYTIHTLRDLRAEYAKVQLFFITGADALAKILSWKDLDEVFELAHFIGVTRPGFRLSD
NADD_OPITP      EVSDVELRRGGTSYTIDSARYFRKQFPRDELYWIIGGDQLPQLHLWRDVSELGQLVDFIFLERPGFP---
NADD_ENTFA      DIEPIELIRKGKSYTYDTMKALKEANPDTDYYFIIGGDMVEYLPKWHRIDDLLHLVQFVGIRRP------
NADD_THESQ      EVSDYEKGRGGVSYSIFTIEYFSEIYK-TKPFFIVGEDALSYFEKWYRYRDILEKSTLVVYPRYCGKPYH
NADD_GEOBB      MVSDMEGVRGGRSYSIDTLRELKARYPDDDLFFIVGADSFNDISTWREYEAIFELCNVISVQRPGSTITS
NADD_ARTAT      TVSRVDVDRPGPTFTIDTLRDLRAERPDADLFFITGADALAQILSWKDVDELWSLAHFVGVTRPGHELHD
NADD_STAAB      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_BORBZ      FIDDCDIINGGITYTVDTISCVKKKYKNDKLFLIIGDDLFQNFDSWKDPQSIVSSIELVVAHR-------
NADD_BORBU      FIDDCDIINGGITYTVDTISCVKKKYKNDKLFLIIGDDLFQNFDSWKDPQSIVSSVELVVAHR-------
NADD_STAES      EICTTDLDRKGPSYTYETILHLKEIYHNAQLYFIIGTDQYNQLDKWYKINELKKLVTFIVVNR-------
NADD_STAEQ      EICTTDLDRKGPSYTYETILHLKEIYHNAQLYFIIGTDQYNQLDKWYKINELKKLVTFIVVNR-------
NADD_STAAW      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAAS      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAAR      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAAN      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAAM      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAA9      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAA2      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_STAA1      DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
NADD_SALTO      QVSRVDIDRSGPTYTIDTLRDLRACGAKVQLFFITGADALEKILSWKDLDEAFELAHFIGVTRPGFRLSD
NADD_GEOSL      AVSDMEGGRPGKSYSVDTIRALKEEYPGDEFFFIIGSDSFLDIGSWYDYEAIFASCNLVVAARPGAEAAD
NADD_DESPS      SCNTIEQDLARPSYTVDTLQALKTSKSEAQFFFLIGVDAFIELKTWKAYRDLLSEINFILCPRKLFSRTQ
NADD_BORGA      LIDDCDIINGGITYTVDTISCVKKKYKNDKLFLVIGDDLFQNFDSWKDPQSIVSSVDLVVAHR-------
NADD_SYNJB      ACSELEIRRSGRSYTIETLRTLIQEQPNTQWYWIIGVDALRDLPQWYQAEELARLCHWIVAPRXXXXXXX
NADD_STAHJ      EICQIELERKGQSYTYETLKDIVNNEKDADIYFIIGTDQYKQLDKWYKIEKLKQLITFVIVNR---DVN-
NADD_RHOBA      VIDDWELRQDSVSYTLLTLEYLQEQFPDRPLYLIIGADSLASFDRWREPEQILKRCHLAVIARGGDPPPD
NADD_PELPD      ELSEIEGQRPGKSYSIDTIGTFREQHPQAELYFIIGSDSFLELGLWRRYADILRSCNLIVVERPGRQVND
NADD_LISMH      EIDTRELMRTGKSYTYDTMRDMISEQPDTDFYFIIGGDMVEYLPKWYHIDDLVKMVTFVGVNRP------
NADD_LISMF      EIDTRELMRAGKSYTYDTMRDMISEQPDTDFYFIIGGDMVEYLPKWYHIDDLVKMVTFVGVNRP------
NADD_LISMC      EIDTRELMRAGKSYTYDTMRDMISEQPDTDFYFIIGGDMVEYLPKWYHIDDLVKMVTFVGVNRP------
NADD_SHEHH      KVCDIEAKRDSPSYSAMTLAQLREIHPQHEFYFIMGMDSFLNISKWYEWQKLFSLCHIVVCKRPGWDSND
NADD_LISIN      EIDTRELMRTGKSYTYDTMRDMISEQPNTDFYFIIGGDMVEYLPKWYHIDDLVKMVTFVGVNRPLYQK--
NADD_HYDS0      FIEDIELKKEEISYTYKSALILKEKYQQPPT-FIIGYDAYLTLDKWYRYEDLVKIANFIVVKR-------
NADD_CORK4      SVSRVDIDRGGPTYTVDTLHDLHERYPHAELFFITGADAVARMATWRDCTEMMSLATFVAVTRPGY----
NADD_DECAR      SLDPSEVEAEAPSYTVHTLERLRRELGPLQLVLLVGADAFAGLATWHRWRDIFALAHVAVSHRPGFPV-E
NADD_SHEON      ELCDIEAKRDSPSYTVVTLKQLSRLYPDDELFFIMGMDSFIQLQSWHKWQQLFEFANLVVCQRPGWHLAA
NADD_GEOMG      AVSDLEGRRTGKSYSIDTLRELRRERPGDEFFFIIGSDSFLDFGSWHEYEAIFSSCNIVAVERPGAVIRD
NADD_BORAP      FIDDCDIINGGITYTIDTISCVKKKYKNDKLFLVIGDDLFQNFDSWKDPQSIASSVDLVVAHR-------
NADD_SHESM      ELCDIEAKRNSPSYTVVTLKQLSRLYPDDELFFIMGMDSFIHLQSWHKWQQLFELANIVVCQRPGWHLAE
NADD_LISW6      EVDLRELKRAGKSYTYDTMRDMISEQPNTDFYFIIGGDMVEYLPKWYHIEDLVKMVTFVGVHRP------
NADD_SHEWM      ELCAIEAKREAPSYLVTTLKQITNSHPNDEFFFIMGMDSLLSLDTWFEWQSLFGLCHIVVCQRPGWSLSS
NADD_DESAA      EASDMEISQGGPSYTVATLEALQSPDK--ELFFILGLDAFLEIHTWKEYERLFSLAHFIVLARPWQGDRA
NADD_DICT6      EVLPIELEREGISYMVDTIRDLSSCFSFDELYLLLGNDAFRDFLKWKEPYKIIEKASIIVGSR-GIE--D
NADD_STAS1      RICLNEIERRGQSYTYDTVMYILDKHPDAKLYLVIGTDQYNQLHKWFKINELKSYITFVIVNRD------
NADD_SHESR      ELCDIEAKRDSPSYTVVTLKQLSRLYPDDELFFIMGMDSFIHLQSWHKWQQLFELANIVVCQRPGWHLAE
NADD_SHESA      ELCDIEAKRDSPSYTVVTLQQLSRLYPDDELFFIMGMDSFIHLQSWHKWLQLFELANIVVCQRPGWHLAE
NADD_BACTN      RSSDFEFHLPRPSYSVHTLEKLHETYPERDFYLIIGSDNWARFDRWYQSERIIKENRILIYPRPGFPVN-
NADD_ACIF5      TVSSWEVEREGPSYTVDTLTALRQQRPDAVLAMVIGMDAFLRFDTWHHWQHILDLTHLVVTGRPGWPAAE
NADD_ACIF2      TVSSWEVEREGPSYTVDTLTALRQQRPDAVLAMVIGMDAFLRFDTWHHWQHILDLTHLVVTGRPGWPAAE
NADD_SHEPA      KVCDIEAKRDTPSYSAMTLTQLTKIYPQHEFYFIMGMDSFLSFTRWHEWQQLFGLCHLVVCKRPGWDKDP
NADD_BORHD      FIDECDIVNGGITYTVDTIACIKNKYVHDDIYLVIGDDLFESFDSWKNPEKIVESVNLVVVHRIYSER--
NADD_BACV8      RASDFEFHLSRPSYTIHTLDALHKAYPNREFTLIIGADNWLLFPRWYKAEEILKNHHVMIYPRPNFTID-
NADD_GEMAT      EVDPVEIERGGLSFMVDTVEAVRRRWPDAHLHLLVGRDVVPTLPRWHDVDRLLSMVRLVVLTRDAAPQEG
NADD_SHEPC      ELCDIEANRDTPSYTVVTLEQLSTQYPNAELFFIMGMDSFIHLQSWHKWQQIFGFANLVLCQRPGWHLSD
NADD_PSEPG      SVDARELERDKPSYTIDTLESIRELAGNDQLFLVLGWDAFCGLPAWHRWEELLQHCHILVLQRPDADLRN
NADD_AERS4      VVDERELKRDKPSYTIDTLMALREELPDTPLCFLMGMDSLLTLPSWHRWQALLDYAHLVVSVRPGWQPDE
NADD_UNCTG      EISLYEAQKLETVYSYQTLDYFNSLYPEDEIYMVIGSDSLLDLPIWNNIDYMAGRYKFIVAKRHGFD--E
NADD_SHESW      ELCDIEANRDTPSYTVVTLEQLSTQYPNAELFFIMGMDSFIHLQSWHKWQQIFGFANLVLCQRPGWHLSD
NADD_SHEFN      KLCDIEINRDTPSYSVTTLTLLTQQYPDDEFFFIMGMDSFVQLPLWYQWQSLFNLCHIALCQRPGWDTNE
NADD_PSEPK      SVDARELERDKPSYTIDTLESIRELSGHDQLFLVLGWDAFCGLPAWHRWEELLQHCHILVLQRPDADLRN
NADD_BACFR      RVSDFEFHLPRPSYTIHTLNRLKQEYPEREFQLIIGSDNWMVFDRWFESERIVSENKILVYPRPGFDKSQ
NADD_BACFN      RVSDFEFHLPRPSYTIHTLNRLKQEYPEREFQLIIGSDNWMVFDRWFESERIVSENKILVYPRPGFDKSQ
NADD_SYMTH      GFSDLELRRPGPSYTIETVRALAAEHPDWEPAFIIGLDSLLAIRTWREWETLMQSVDFFAVTRPGHDXXX
NADD_LEGPA      KIDTRELDRDTPSYMVYTLQSFRQEYTDSSLTLIIGYDGLLNLPQWYQWEKIISLANLLVINREEFFQQP
NADD_LEGPL      KIDTRELDRDTPSYMVYTLQSFRQEYTDSSLTLIIGYDGLLNLPQWYQWEKIISLANLLVINREEFFQKP
NADD_LEGPH      KIDTRELDRDTPSYMVYTLQSFRQEYTDSSLTLIIGYDGLLNLPQWYQWEKIISLANLLVINREEFFQQP
NADD_NEIMF      AVSDCDIVREGATYTFDTVQIFRQQFPSAQLWWLMGSDSLMKLHTWKKWQMLVRETNIAVAMRQGDSLHQ
NADD_MYCS2      SVSRVDIDRGGPXXXXXXXXXXXXXXXXXXXYFITGADALGSILSWQNWEDMFSMAKFVGVSRPGYDGKH
NADD_FLAPJ      KPSDIEFKLPQPNYTVNTLAHLQDKFPSYEFSLIMGEDNLNSLHKWKNYEAILQNHQIYVYPRLNTDTID
NADD_FLAJ1      KPSDIEFKLPQPSYTVITLEHLKEKYPNHEFSLIMGEDNLKTLHKWRNYEVILENHDIYVYPR-------
NADD_SHESH      DLCDIEAKRDTPSYLVTTLKQLRDEHPNDEFYFIMGMDSLVSLPTWYEWRSIFTLCHIVVSERHGWCLNP
NADD_SALG2      TLDERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_SALEP      TLDERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_PSEPW      SVDARELERDKPSYTIDTLESVRELGADDQLFLVLGWDAFCGLPGWHRWEELLQHCHILVLQRPDADLRN
NADD_SHEB5      ELCDIEAKRDTPSYTVVTLEQLKSLHPEDELFFIMGMDSFIQLKSWYEWQRLFDFAHLVVCQRPGWQMQQ
NADD_PSYIN      TIDKRELKRHKPSYTIDTLKELKIEYPNTPICFIMGMDSLISFDKWFDWKSILSYCHLIISHRPGWQNGA
NADD_NEIM0      AVSDCDIVREGATYTFDTVQIFRQQFPSAQLWWLMGSDSLMKLHTWKKWQMLVRETNIAVAMRQG-----
NADD_GRAFK      KPSNIEFDLPQPNYTVNTLAHIQEKFPTNDFCLIMGEDNLKSFHKWKNSEVIIENHEIYVYPRPG-----
NADD_ERWCT      TVDDRELQRQTPSYTIDTLEALREKGHDAPLGFIIGQDSLLTLHHWHRWQDLLGVCHLLVCARPGYRSDH
NADD_CHRVO      AVDEREIRRARPAYTVDTLRELRAELGDAELWFLIGGDSLAALSSWKDWRKLFRLANLAVAMRPGFD---
NADD_THICR      KLDTIELDLGGPSYTVNTLEALKKAEPDASFVLMMGTDAFAKFNQWHDWQGVLNLANIVVTHRPG----E
NADD_NEIG2      AVSDCDIVRESATYTFDTVQIFRRQFPSAQLWWLMGSDSLLKLHTWKKWQLLVRETNIAVAMRQG----D
NADD_NEIG1      AVSDCDIVRESATYTFDTVQIFRRQFPSAQLWWLMGSDSLLKLHTWKKWQLLVRETNIAVAMRQG----D
NADD_LEGPC      KIDTRELDRDTPSYMVYTLQSFRQEYTDSSLTLIIGYDGLLTLPQWYQWEKIISLANLLVINREEFFQQP
NADD_SHEB9      ELCDIEAKRDTPSYTVVTLEQLKSLHPEHELFFIMGMDSFLQLKSWYEWQRLFDFAHLVVCQRPGWQMQQ
NADD_SALTY      TLDERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_SALPK      TLDERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_SALPB      TLDERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_SALPA      TLDERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_SALCH      TLDERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_SALAR      TLDERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_SHEDO      ELCDIEINRDTPSFTVTSLQQLTQAYPEHEFYFIMGMDSFIQLDRWYQWQTLFELCHIVVCQRPGWQLET
NADD_SHEB2      ELCDIEAKRDTPSYTVVTLEQLKALHPEDELFFIMGMDSFLQLKSWYEWQRLFNFAHLVVCQRPGWQMQQ
NADD_SALTI      TLGERELQRNAPSYTAQTLKWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEM
NADD_SHEB8      ELCDIEAKRDTPSYTVVTLEQLKSLHPEHELFFIMGMDSFLQLKSWYEWQRLFDFAHLVVCQRPGWQMQQ
NADD_PSEE4      SVDDRELARDKPSYTIDTLESIRELNTHDQLFLVLGWDAFCGLPSWHRWEELLQHCHILVLQRPDADLRN
NADD_NEIMB      AVSDCDIVREGATYTFDTVQIFRQQFPSAQLWWLMGSDSLMKLHTWKKWQMLVRETNIAVAMRQG-----
NADD_NEIMA      AVSDCDIVREGATYTFDTVQIFRQQFPSAQLWWLMGSDSLMKLHTWKKWQMLVRETNIAVAMRQG-----
NADD_ESCF3      TLDERELLRNTPSYTAETLKWREEQGADAPLAFIIGQDSLLTLPTWHDYESILDNAHLIVCRRPGYSMEM
NADD_VESOH      SIDTREIKQNKNSYTINSLKYIQSKYQNNSICLIMGMDSFNTLSSWEECQNFYQYCHLVIMSRPGYQKND
NADD_ROSCS      EVSRIEIDRPDPSYTSVTLQLLHEQGLN-DLYLILGIDSVADLPRWREVRRILELAHIVGVARPGAAVD-
NADD_PSEF5      VVDDRELKRDKPSYTIDTLEQMRELAADDQLFLLLGWDAFCGLPTWHRWEELLQHCHILVLQRPDADSRN
NADD_LISMO      EIDTRELMRTGKSYTYDTMRDMIIEQPDTDFYFIIGGDMVEYLPKWYHIDDLVKMVTFVGVNRP------
NADD_AERHH      VVDERELKRDTPSWTIDTLIELRHELPDTPLCFLMGMDSLLGLPSWHRWQELLDYAHLVVSTRPGWQPDE
NADD_SALRD      RVCGVEVERDGVSYTVETLRVLQDQHPDTDFALILGSDSLDHFADWHRPDEIAERVPFIVYKRPG-----
NADD_PSEAE      TVDPRELQRDKPSYTIDTLESVRELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSRD
NADD_PSEAB      TVDPRELQRDKPSYTIDTLESVRELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSRD
NADD_PSEA8      TVDPRELQRDKPSYTIDTLESVRELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSRD
NADD_GLOVI      ALSLVDARRPGPSYAIDTLRLLEEQYPQAQWHWLLGQDGLADLPGWYRAAELIPRCRWIVVPRPG-SGAD
NADD_SHEAM      SLCDVELRRDEPSYTVNTLRQLRELYPDRVFYFVMGMDSFLSLDKWFEWQQLFELCHLVVCARPGYQMAE
NADD_PELUB      KVKFYE-EKVLSNKTIDLINYLNKD-KKFEIYFIMGADNLINFHKWYKWKSIIKKCNLLVFDRQGYKAKS
NADD_ANAVT      TVSSVEKNRSGVSYAINTLTDLSVCFPNTHWYWIVGLDTFQTLPRWYRGQELAPMCDWLIAPRENIAQSE
NADD_IDILO      TVEDWELRQDRPSFTANTLSEFKTQFPDDTLLFVMGMDSLMSLHRWHHWCQLIECAHLVVMPRAGVPKND
NADD_COXBU      ILNDVEIKGNDISYTINTLKILRPLFLTHALCFILSTDAFADFKHWHQSSVILEYCHLIVVNRPNYRLSD
NADD_COXBR      ILNDVEIKGNDISYTINTLKILRPLFLTHALCFILSTDAFADFKHWHQSSVILEYCHLIVVNRPNYRLSD
NADD_THEM4      TVSDIEHRLGGVSYAINTIEYYEKKYSHI--FFLVGEDALYSIEKWYRYEDILKKAHMLVYPR---FKDE
NADD_PSEA7      TVDARELLRDKPSYTIDTLESVRELAADDQLFMLIGWDAFCGLPTWHRWEALLEHCHIIVLQRPDADSRD
NADD_ENTS8      RLDTRELQRATPSWTSETMVQLREAGPDAPLAFIIGQDSLLTLRTWHNYEALLACCHLLVCRRPGYPKTD
NADD_CYTH3      RASDIEFSLPKPSYTVDTLTYISDKYPQHSFVLIIGEDNLDQFTNWKNHEQILHHYSLYVYPRPDSSNSF
NADD_COXBN      ILNDVEIKGNDISYTINTLKILRPLFLTHALCFILSTDAFADFKHWHQSSVILEYCHLIVVNRPNYRLSD
NADD_ARCB4      XISDYEINQEKLSYSFNTVNYLKDLYKASKIYFILGQDNVENLDKWYKIEELKKMVEFVIATRSGY-KSD
NADD_HAHCH      RIDEVEVRRTGASYTVDTLLELRQEVGNLRLIFVMGTDAFESLPKWRRWLEIIQLAHIMVVNRPGWELGD
NADD_BUCAT      EISYLETKKNNIFYTIDTLKKIRKKISHLELCFIIGEDNLQTFYLWKNWREILLYSHLLIYPRKKKQKNN
NADD_ANASP      TVSSVEKNRSGVSYAINTLTDLSVCFPNTHWYWIVGLDTFQTLPRWYRGQELAPMCDWLIAPRENIAQSE
NADD_PARD8      RVCDIEFYLPKPSYSIDTLRTLSRNYPNRDFYFIMGADNWQLFPRWKEHEKILQDYKLLIYPRLGFDIS-
NADD_BUCAP      TISYLETKKNTTFYTIETLKKIRKKIGYLQLCFIIGEDNLNNLNIWKDWKKILSLSHLLICPRIHIKKSN
NADD_BORA1      AVNTSEIQRGGATYTVDTILALPQ---DARYTWILGADQLANFCTWRDWETIVRHVDLAVATRPG-STXX
NADD_MARMS      CVDSREMDREGPSYSIDTLRDLREVGPDESLIMVLGMDSFLSLPTWYKWQEIMDYAHLLVVSRPGWEP-D
NADD_ECOLU      TLDERELKRNAPSYTAQTLKWRQEQWPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_CITK8      ILDERELKRDTASYTAQTLKWREEQGPDAPLAFIIGQDSLLTFPTWHDYETILDNTHLIVCRRPGYPLEM
NADD_SHIB3      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_CHRSD      AVDDREIARDGPSYSADTLASLREELPQARLVMALGHDAYLNLAEWHEPQRLFDLAHIVVIDRPDHDRQE
NADD_CELJU      SIDLREVARARASYTVDSLSELRELGAETSLVFCLGTDSFAGLDRWHRWQELLQLAHLVVVERPGWDVRT
NADD_SHIBS      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_BUCAI      EISYLETKKNNIFYTIDTLKKIRKKISHLELCFIIGEDNLQTFYLWKNWREILLYSHLLIYPRKKKQKND
NADD_BUCA5      EISYLETKKNNIFYTIDTLKKIRKKISHLELCFIIGEDNLQTFYLWKNWREILLYSHLLIYPRKKKQKND
NADD_SHISS      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_SHIFL      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_SHIF8      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECOSM      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECOSE      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECOLI      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECOLC      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECOHS      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECO8A      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECO7I      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECO24      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_HERAR      NIDQQEILRPSATYTIDTLRAIRQELPHASIVFLMGADQLQHLNTWQEWQHMFDYAHICAASRPGFAMDA
NADD_SHIDS      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_FUSNN      EVSDIEIKAEGKSYTYDTLLKLIEIYKDNEFFEIIGEDSLKNLKTWRNYKELLNLCKFIVFRRKD-DKN-
NADD_ECOL6      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECOL5      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECOK1      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECO5E      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECO57      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_ECO45      TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
NADD_BORT9      FIDECDIINGGITYTVDTIACIRNKYVHDDIYLVIGDDLFESFDSWKNPEKIIDSVNLVVVHRIYSER--
NADD_SERP5      AVDDRELHRTTPSYTIETLEAIRERGAALPLAFIIGQDSLLTLHKWHRWQSLLDTCHLLVLARPGYDRMD
NADD_SOLUE      EVSRLE-EGTARSYSIDTIEKVRAMLAPGDLYFLIGADAFAEIRTWRRWTDVARAVRFLVVSRPGHTYE-
NADD_PETMO      EVSDIENKLPSPSYTIRTIEYLSNFDKNINL--LIGEDSLKNFHKWYKWEEILKKVKLVVYPRYFEEKNS
NADD_KLEP7      TLDERELRRDTPSWTAQTLQWRQEQGPRKPLAFIIGQDSLLTFPTWHNYETILDNVHLIVCRRPGYP---
NADD_PSESM      TVDDRELKRDKPSYTLDTLESMRELAPRDQLFLLLGWDAFCGLPTWHRWEELLEHCHIVVLQRPDADSRN
NADD_PSEU2      TVDDRELKRDKPSYTLDTLESMRELAPRDQLFLLLGWDAFCGLPTWHRWEELLEHCHIVVLQRPDADSRN
NADD_PELPB      EVSGWELEKKQPSYTVDLLRYLRTLYPADKLTLLVGEDSFREFSKWKESETFCSLSDVVVFRRVS-TQSE
NADD_SODGM      TLDERELQRPTPSYTVDTFEALRREYPDSPLAFIIGQDSLLTLTQWHRGLELPALCHLLVCARPGYDDNR
NADD_KLEP3      TLDERELQRDTPSWTADTLQWRQEQGAEKPLAFIIGQDSLLTFPTWHRYETILDNVHLIVCRRPGYPDQQ
NADD_AQUAE      TIEDYEIRRKGISYTVYTXXXXXXXXXXXXXXXXXXSDSFLKFHKWKEPREILKLAKIIVVEREG-----
NADD_HELPJ      LLSDFEIKQERAVPTIESVLHFQKLYRPKTLYLVIGADCLRHLSSWTNAKELLKRVELVVFERIGYEE--
NADD_HELP2      LLSDFEIKQERAVPTIESVIFFQKLYRPKTLYLVIGADCLRHLSSWTNATELLKRVELVVFERIGYEE--
NADD_LARHH      TVDERELSGRLSGYTVDTLAMIRETGPEAALWWLVGGDQLASLDRWHRWRDLFGLAHLAVAVRPGFDAGS
NADD_THELT      SISDYEKNRQGISYSLYTVLYFSQ-LHRTKPYFITGEDSLSYIQNWHKYRDLLENCHFVVYNKP-YEEHT
NADD_YERPY      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_YERPS      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_YERPP      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_YERPN      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_YERPG      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_YERPE      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_YERPB      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_YERPA      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_YERP3      SVDSRELLRDSPSFTIETLEALRERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSQ
NADD_HELPY      LLSDFEIKQERAVPTIESVLHFQKLYHPQTLYLVIGADCLRHLSSWTNAKELLKRVELVVFERIGYEE--
NADD_HELPH      LLSDFEIKQERAVPTIESVIYFQKLYCPKTLYLVIGADCLRHLSSWTNAKELLKRVELVVFERIGYEE--
NADD_METPP      KLDRREIERNGPSYTIDTVRESQLAEPNAKWFLVIGQDQYERLPTWHEWRELITRVTLAVAGRDGKSPSP
NADD_COPPD      VLMELEREARP-TYSYETILSVKHVLGE-KPYFILGSDEWEELHNWRRYDLLVKNAIFIVVPR----KPI
NADD_YERE8      SVDSRELLRDTPSFTIDTLESLRERGAERPLAFIIGQDSLLSLHKWHRWQSLLDVCHLLVCARPGYELQQ
NADD_NITSB      KICDYEVRKGRPTYAIETVEFLRRKYAPKKLYYIIGSDNLPTLHKWHKYQKLSHLVQFVVATRKGYKVPK
NADD_MARAV      ALDEQEVHRGGASYTADTLRQLRELGPDCPLVMVVGTDAFSSFDRWREWQEIPGLAHIVVVRRPG-----
NADD_CHLPD      EVSGWELQKKTPSYTVELLRFLRTEYPDVQLTLLVGEDSYREFPLWKSYEELVLLCRIAVFRR--VPPEQ
NADD_SACD2      CIDTCELDAGESIFTVDTLAAKRELWASASIIWLIGWDSLHNLSRWHRWQSLLTFANLAVVERPFAQSDD
NADD_PSEMY      TVDDRELQRDKPSYTVDTLESVRELAADDQLFLLLGWDAFCGLPSWHRWQELLDHCHLLVLQRPDADSRD
NADD_CHLP8      ESSSWELETDGPSYTVDLLRHIADLYPDDELLLLVGEDSYRQMGQWKAASEIPRLCQIVYFGREGYENC-
Y336_MYCPN      AVSNFDIKAQN-GFSFNTVQHFKQRFPNAELYFLIGSDKLSELAKWHNIEQLQKLCRFVCYERFGYPIDE
NADD_BORBR      AINPVEIERGGATYTADTVRALPGG---PQYFWLLGTDQLQNFCTWRDWQDIAARIELAVATRPGASPAE
NADD_CHLL2      GISGWELEKKQPSYTVDLIRYVRSVYPLDRLTLLIGEDSFREIRSWKSWEILPSLCDLAVFRRTSPEDH-
NADD_BORPE      AINPVEIERGGATYTADTVRALPGG---PQYFWLLGTDQLQNFCTWRDWQDIAARIELAVATRPG-ASIX
NADD_TREPS      SVEECEIRRGGISYTAETVQHVREKYLEGKLALVLGEDAARSVPHWHAFDSWSTHVDFVVGARPGDGGN-
NADD_TREPA      SVEECEIRRGGISYTAETVQHVREKYLEGKLALVLGEDAARSVPHWHAFDSWSTHVDFVVGARPGDGGN-
NADD_PROVI      DACGWELEQKRPSYTVNLLRFVRSLYPSARLSLLVGEDSWRNFGSWKSPEEIEELADVVVFARGA-----
NADD_BORPA      AINPVEIERGGATYTADTVRALPGG---PQYFWLLGTDQLQNFCTWRDWQDIAARIELAVATRPGASPAE
NADD_PSEA6      YIDEREIHSDTPSYTIHTLRALRKEYPKHPLCFFIGMDSLHSLLSWNEWQALFDYCHFVVCCRPG-----
NADD_CHLPB      EVSSWEANRGHPVYTIDLMEYLEEIYSTSDLTLLIGEDNFLNFRQWKSWEELIRRYSIIVFGRKXXXXXX
NADD_UREPA      EVSDYELKQINKSYTINTIEHFKQIYSEHEYYFIMGSDNLERFKQWKDWERILKEVKIICFKRGDVCVKK
NADD_PORG3      QVLRIEELLPSPHYTIRTLRALSMLYPHHRFALLIGADNWQSFDRWKDHHRLMAKYELIIYPRFGYEVN-
NADD_CAMJJ      EICDFEIRQKRPVPSIESVKYLYKLYNPSKFYLLIGADHLEKLHLWHDFEKLNSLVEFVIANRNGIPKN-
NADD_HALHL      CVDERELHRDGPSYTVDTLAELRAELGGVSLCLILGYDTFLGLPGWSRWRQLFERAHVVVTERPGVRATE
NADD_CHLT3      EVSDWELRRAGFSYTIETLRHFHAIEPNAELLLCIGEDNYQIFEKWKAYQEILQLAHLVVFARSG-----
NADD_BURS3      TVATDEIEHVGPTYTVETLRWRERIGPDASLSLLIGADQLVRLDTWRDWRKLFDYAHICVSTRPGFDAQE
NADD_BAUCH      VIDERELRRNTPSWTVETFKVLRSEYGPMPLGLIIGQDSLLTLPQWHRSQELFELCHILVCARPGYQKNN
NADD_AZOPC      EICTIEWGMPRPSYTIDVLWKLHLDFPQNIFELIIGSDNWIIFHHWKDYRTILENFKILVYPRSNY-KSI
NADD_PORGI      QVLRIEELLPSPHYTIRTLRALSMLYPHHRFALLIGADNWQSFDRWKDHHRLMAKYELIIYPRFGYEVD-
NADD_PELLD      EVTGWELQQPRPSYTVDLLRFVRSSHPDANLTLIVGEDSYQDFPRWRDPEGIFALADVAVFRRRGEDESD
NADD_CAMJR      EICDFEIRQKRPVPSIESVKYLYKLYNPSKFYLLIGADHLEKLHLWHDFEKLNSLVEFVIANRNGIPKN-
NADD_CAMJE      EICDFEIRQKRPVPSIESVKYLYKLYNPSKFYLLIGADHLEKLHLWHDFEKLNSLVEFVIANRNGIPKN-
NADD_CHLCH      EVCRWEIEQAAPSYTVELISYLTQSYPTWRFTLILGEDNFHSFHLWKEYQEILRLCHVAVFRRPSLDEAM
NADD_CAMJ8      EICDFETKQKRPVPSIESVKYLYKLYNPSKFYLLIGADHLEKLHLWHDFEKLNSLVEFVIANR-------
NADD_STRMK      LLDHRELDRARPSYTVDTLRELRELGPSRPLAWLVGADSLLGLTRWHEWEALFGLAHFVVAERPGASVDG
NADD_WIGBR      XXXXXEINNKIPSYTINTFENLRKEYPKAPLGFILGQDSFMKLHTWYRGYDILKFCHLLICARSNNMINL
NADD_BURCJ      TVATDEIEHTGPTYTVETLRWRERIGPDASLSLLIGADQLVRLDTWRDWRTLFDYAHIGVSTRPGFEARE
NADD_PROA2      AVSRWELERSGPSYTIDLLTRIGQLYPEEPVTLLIGEDNFRGFRQWKSWQEILERCYVVVFRRP------
NADD_FERNB      KKNQWDLEKHGVNYAIKNVEYFRKYYSNT--IILVGEDALGNIEKWYKYEELLNITTFAIY--PRTRDGS
NADD_METCA      XXXTRELDRGGPSYMVDTLSSIRKETGDEPLCLIVGLDAFLALPAWHRWRRLFSLAHIVVLQRPDYDIEY
NADD_ERYLH      PIRVTAIEAQGTRYTVDTLRTLRGRYPRREFVWLMGADNLATFHRWKAWRDIARTMPIAVVARPGYDKD-
NADD_CHLTE      EISGWELQQSGPSYTIDLLRHVEERCPGDELVLLVGEDSYLQMPQWKFASEILKHCTIAVFGRXXXXXXX
NADD_CAUSK      -VSDAE-TRLGSQYTIDTLRVLRARYPGVKFVWIMGADSLATFHRWRGWTQIMREVPVAVISRP------
NADD_ACHLI      EISRLENTKAFLG-SYHTLNELSKRYDD--LYFVVGADHIKTLDQWKDYKKLIENYKFILLTRNNYTFDD
NADD_RHOFD      VVDPRELERVGPSYTVDTLREFKALWPTAEFFLILGEDQAQALPSWHDWQEILQLAIICVATRA---CST
NADD_PARL1      S----DIEARGTRYTVDTLAALTSRFPQIRFVWLMGADNLIQLPHWARWRDIVQTVPIAVYPRPGF----
NADD_SULDN      EVSDYEVLQNRQVPTIETAKHLLESYKKI--YLVIGADNLAKLRDWNSYDELKELVTFVVATR------D
NADD_SILST      RVRISDIEARNTRYTAQTLRELRKLYPQVRFVWLMGADNLAHFHRWKNWRGIMESVPVGVLARPG-----
NADD_RHILW      KVTAFE-QSLGVSYTANTLAWVKARNPHVHFIWIMGADGLQTFHKWQKWQEIVRTFPIAVIDRPG-----
NADD_SILPO      RVDVTDIEAHGTRVTADTIAALRRIYPRVRFVWLMGADNLAQLHRWKDWRQIIETVPVGVLARPG-----
NADD_RHIE6      KVTAFE-QALGVSYTANTLARIKARNSHVHFIWIMGADSLQTFHKWQKWQEIARTFPIAVVDRPG-----
NADD_RHIME      KVTAFE-QALGQSYTARTLEVIRARNRDVRFVWVMGADNLKNFHRWQDWRKIVATFPIAVVDRPG-----
NADD_RHIL3      KVTAFE-QTLGTSYTANTLARVKARNPHVHFIWIMGADSLQTFHKWQKWQEIARTFPIAVIDRPG-----
NADD_ROSDO      IITDVE-TRLGTRYTAATLDQLSALYPGVHFVWLMGADNLAQFHKWQRWRDIASTTPLGVLARPG-----
NADD_RHIEC      KVTAFE-QALGVSYTANTLARVKARNPHVHFIWIMGADSLQTFHKWQKWQEIARTFPIAVIDRPG-----
NADD_MYXXD      LKTSRIEQEPGLSRTVDTLTLLVARHPDIRWSIIIGSDILRDLPHWKDFHRIEELSRVMVLNRAGYPAPN
NADD_AGRT5      KVTAFE-KSLGISYTANTLAKVKAKNPHVRFIWIMGADNLKSFHRWQKWREIAETFPIAVIDRPG-----
NADD_SULNB      VVDDYEIRQNKSVRTSQSVKHFNNTYS--VKYLIIGSDNLSTLTKWHEFKWLNDHITWVIVTRKG-----
NADD_LEPIN      RILDLELKRSGPSYTIQTIQELKTIYPNRKFVLLIGEDNYSNFHKWKDWEKILEVETIFVFRR--FSKNS
NADD_LEPIC      RILDLELKRSGPSYTIQTIQELKTIYPNRKFVLLIGEDNYSNFHKWKDWEKILEVETIFVFRR--FSKNS
NADD_HELHP      SVSDYEVCQNRSVFSVQSVAFIKEQITKAQLVFVLGEDSFNNLKQWKDVEKLCKMVDFVLIKR-------
NADD_GLUOX      AT---DIESRGQRFTVKTVGLLKQRFPHVRFVWLMGADGLAQLSHWKRWRRLAAMVPIAVLPRPG-----
NADD_XYLFT      SADPRELQRAARSYTVDTLTEVRSELPKTSIIWLLGADAFVNLSNWKDWQMLPELTHLVIANRPG-----
NADD_XYLF2      SADPRELQRAARSYTVDTLTEVRSELPKTSIIWLLGADAFVNLSNWKDWQMLPELTHLVIANRPG-----
NADD_RHILO      KVTAFEAAHH-VRYTADTLALVKARNPGVDFVWIMGADSLRDFHRWQRWREIVLTFPIAVIDRPG-----
NADD_XYLFM      SADPRELRRAARSYTVDTLTEVRSELPKTSIIWLLGADAFVNLSNWKDWQMLPELTHLVVANRPG-----
NADD_LEPBL      RILDLELNHPGPSYTIETIQKLKTLHPNREFVLLIGEDNYSNFHKWRNYEKILEVRKVFVFRR----FSE
NADD_LEPBJ      RILDLELNHPGPSYTIETIQKLKTLHPNREFVLLIGEDNYSNFHKWRNYEKILEVRKVFVFRR----FSE
NADD_XYLFA      SADPRELQRAARSYTVDTLTEVRSELPKTSIIWLLGADAFVNLSNWKDWQMLPALTHLVIANRPG-----
NADD_BRUME      RIKVTALEAAHVRYTADTLALIRNANPDVYFVWVMGADNLASFHRWQRWREIAQNFPIAIIDRPG-----
NADD_BRUAB      RIKVTALEAAHVRYTADTLALIRNANPDVYFVWVMGADNLASFHRWQRWREIAQNFPIAIIDRPG-----
NADD_BRUA2      RIKVTALEAAHVRYTADTLALIRNANPDVYFVWVMGADNLASFHRWQRWREIAQNFPIAIIDRPG-----
NADD_RHOSK      AVTGLEAE-IGTRFTAETLAVLQRRYPGVRFVWLMGADNLAQFHRWERWRAIMESVPVGVLARPG-----
NADD_RHOS4      AVTGLEAE-IGTRFTAETLAVLQRRYPGVRFVWLMGADNLAQFHRWERWRAIMESVPVGVLARPG-----
NADD_RHOS1      AVTGLEAE-IGTRFTAETLAVLQRRYPGVRFVWLMGADNLAQFHRWERWRAIMESVPVGVLARPG-----
NADD_METEP      AVTGFE-GGIGSRYTADTLRWLVRRQPALHFVWIMGADSLGTFHRWRRFDEILSLMPVAVIDRPGY----
NADD_METC4      AVTGFE-GGIGSRYTADTLRWLVRRQPALHFVWIMGADSLGTFHRWRRFDEILSLMPVAVIDRPGY----
NADD_RHOS5      VVTDIE-ARLGTRFTAETLAALRARYPGVRFVWLMGADNLAQFHRWDRWQGIMRTVPVGVLARPG-----
NADD_BORPD      AVNPVELERGGPTYTIDTVRALP---ADAHYVWLLGTDQLANFCTWRQWQAIAGHVD-XXXXXXXXXXXX
NADD_ANADE      HVCGAEAELAGVGKTARTLEHLAAKHPTYRFALVVGADILAETAKWYRWDRVQELARIIVVGRQGHGAPD
Y240_MYCGE      LVSNFDIKTKN-AFSINTVNHFKSCYPTSEIYFLIGSDKLNELEKWDHIQQLKDLCTFVCYERKPYPFNK
NADD_BRUSU      RIKVTALEAAHVRYTADTLALIRNANPDVYFVWVMGADNLASFHRWQRWREIAQNFPIAIIDRPG-----
NADD_ANAD2      HVCGAEAELAAVGKTARTLEHLAAKHPDQRFALIVGADILAETAKWYRWDRVQALARIIVVGRQGHGAPD
NADD_ANASK      HVCGAEAELAAVGKTARTLEHLAAKHPDHRFALIVGADILAETAKWYRWDRVQALARVIVVGRQGHGAPD
NADD_GLUDA      AT---DIERRGTRYTVDTLGLLRLRFPHAAFVWLMGADGLADLARWRDWRRIVSLVPFAVLPRPTYNPGA
NADD_BRAJA      SCLESVIRTR---YTIDTINTLRRRLRGLRFVWIMGADNLAQFHRWQDWRRIAGQVPIAVIDRP------
NMNA3_MOUSE     RVDPWESEQAQWMETVKVLRHHHRELLRSELKLLCGADVLKTFNLWKDIQEIVEKFGLVCVSRSGHDPER
NMNA3_HUMAN     RVDPWESEQAQWMETVKVLRHHHSKLLRSELKLLCGADVLKTFNLWKDIQEIVEKFGLVCVGRVGHDPKG
COAD_VESOH      SLKNAQVILRGLDFEYEQLSGINKHLNNIETLFMTPTEQYANISS-------------------------
NMNA1_MOUSE     Q-SSPALEKPGRKRKWADQKQDSSPQKPQEVKLLCGADLLESFNLWKDITQIVANFGLICITRAGSDAQK
COAD_PELUB      ----------------------------------------------------------------------
COAD_CLOAB      SVQSF-----------------------------------------------------------------
NMNA1_HUMAN     ---------------------------------LCGADLLESFNLWKSITQIVANYGLICVTRAGNDAQK
COAD_SYNAS      RVDSYDVRKEGGNVILRGLRAMSEFEYEFQL-------ALMNRRLNRNIETVF-----------------
NMNA1_BOVIN     ---------------------------------LCGADFLESFNLWKSITKILGDYGLICITRAGNDAQK
NMA2_YEAST      ----------------------------VKIMLLAGGDLIESMGEWSDLHHILGNYGCLIVERTGSDVRS
NMAH_SCHPO      MVDAWESLQPSYTCTARVLDHFDEEINQCKIMLLAGGDLIASMGEWKDLHHILGKFGCCIVERTGSDVWA
NADD_CAMFF      -ISKFEIEQNRAVPSLESVLHFKKIYNPDIVYLIIGADQLINLEKWYXXXXXXXXXXXXXASRD------
COAD_PYRFU      EVNKY-----------------------------------------------------------------
COAD_CLOPH      AFDGLTVDKLGAKFLIRGLRAITDFEYELQ---------IAQTNH-------------------------
COAD_FUSNN      ----------------------------------------------------------------------
NADD_SYNY3      QIWEDLSDRRSL---ISLQRAQQRWGLEPDYALVVGADLIRQISQWYAVKELLPAVQLVIFPRPGYGIND
COAD_METI4      N-------AIALPYTGLTVDFAKE------------LNCCAIIRGLRAVSDFETEFQLALMNR-------
COAD_ALKMQ      EVDCFSAREKGAKVIIKGLRAVSDFEYELQM-------ALMNRKLCPEVETVFLMTN-------------
COAD_PYRHO      EVNNFK----------------------------------------------------------------
COAD_KOSOT      RADSYEARKAGIKIVVRGLRAISDFEMEIQVAHINKA---------------------------------
COAD_CALS8      HLPNVEVKAKGLLIDFENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIETIFMMTN-------------
COAD_BUCAP      ----------------------------------------------------------------------
COAD_BORGA      NV--------------------------------------------------------------------
COAD_BORAP      NV--------------------------------------------------------------------
COAD_ANATD      HLPNVEVKAKGLLIDFENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIETIFMMTN-------------
NMA1_YEAST      ----------------------------VKIMLLAGGDLIESMNVWADLHHILGNYGCLIVERTGSDVRS
NADR_HAEIN      ----------------------------------------------------------------------
COAD_PYRAB      EVNNF-----------------------------------------------------------------
COAD_HELPS      ----------------------------------------------------------------------
COAD_BLOPB      GFNDLTIKKKQVNFEYEQLAKINNYFNEVETVFMISTDIWACLSS-KLVKEIAQYGGRIDHFIPNFIVEK
COAD_THEGJ      EVNGY-----------------------------------------------------------------
COAD_SYNP2      GLTTDYARQRNAGVLLRGLRVLSDFEKELQM-------AHTNKTLWDNIETVF----LATSNEYSFLSSS
COAD_MYCPE      NVEVIKWDSKISDFAIKTIYFIIRGIRDVNDFKFEKYIADIYKQEWDKLEVVYFFSEKKLENISSRKIIN
COAD_CARHZ      EIDSFE----GLTVNY------------------------------------------------------
COAD_BORBZ      NV--------------------------------------------------------------------
COAD_BORBU      NV--------------------------------------------------------------------
COAD_HELPY      ----------------------------------------------------------------------
COAD_HELPJ      ----------------------------------------------------------------------
COAD_HELPH      ----------------------------------------------------------------------
COAD_HELPG      ----------------------------------------------------------------------
COAD_HELP2      ----------------------------------------------------------------------
COAD_HELAH      ----------------------------------------------------------------------
COAD_BORT9      FVDRYDALKNNIGFIVRGVRAFHDFEFEFERYVV------------------------------------
COAD_RHOP2      ----------------------------------------------------------------------
COAD_LEPBP      KIDTFE----GLTVDY------------------------------------------------------
COAD_LEPBA      KIDTFE----GLTVDY------------------------------------------------------
COAD_CLONN      ----------------------------------------------------------------------
COAD_MICAN      GLTVEYARLKGAKVLLRGLRVLSDFEKELQM-------AHTNKTLWEGIETVF-----------------
COAD_DESRM      VVDTFD----GLTVTY------------------------------------------------------
COAD_CLOBJ      ----------------------------------------------------------------------
COAD_CLOBH      ----------------------------------------------------------------------
COAD_CLOB1      ----------------------------------------------------------------------
COAD_WOLWR      ----------------------------------------------------------------------
COAD_WOLPP      ----------------------------------------------------------------------
COAD_WOLPM      ----------------------------------------------------------------------
COAD_MYCPU      ----------------------------------------------------------------------
COAD_LISW6      ----------------------------------------------------------------------
COAD_LISIN      ----------------------------------------------------------------------
COAD_COPPD      IVDSYELEEHGIRLIIRGLRAVSDYEYEIQLF--------------------------------------
COAD_CLOBM      ----------------------------------------------------------------------
COAD_CLOBL      ----------------------------------------------------------------------
COAD_CLOBK      ----------------------------------------------------------------------
COAD_CLOB6      ----------------------------------------------------------------------
COAD_CHLL2      SV---EVLHDGLLADYKGARAIVRGVRQVKDFEYEFQISLLNRHLYPEVTTVFLMPNV------------
COAD_BORHD      FVDRYDALKNDIGFIVRGVRAFHDFEFEFERYVV------------------------------------


                         +         .         .         .         .         *         .:210
query           LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLEVKFFLPPGVVDIIDKYNLYRRE
NADD_CLOPE      LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLEVKFFLPPGVVDIIDKYNLYRRE
NADD_CLOPS      LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRQSLEVKFFLPPGVVDIIDKYNLYRRE
NADD_CLOP1      LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVHDSLEVKFFLPPGVVDIIDKYNLYRRE
NADD_CLOBB      LIKQKEYIEKKYSVNIIVLPLKRLEISSTDIRKRINNKERVDFFVPRSIIKLIEENSLYKEE
NADD_CLOBA      LIKQKEYIEKKYHVSIILLTLKRLEISSTDIRERIKNKERVDFFVPQPIIKLIEENNLYKEE
NADD_CLONN      MLKQKERIEKKFNKKIIFLDIPVIDISSTTIRNKIKNRENISYLVPEKARCMVNKMNLYK--
NADD_CLOB8      MINRKHMIEEKYNGKIIVLDLKELEISSTDIRNRVHENKRIDFFVPERVSDIIYKNRLYR--
NADD_CLOK5      IEDQKKKIEDKYSTNIIYLDAPLFDISSTVIRNSVKEGKNVNYFLPESVCNIIKQLNLYK--
NADD_CLOK1      IEDQKKKIEDKYSTNIIYLDAPLFDISSTVIRNSVKEGKNVNYFLPESVCNIIKQLNLYK--
NADD_CLOTE      ILXXXXXXXXXXXXDIIFLDIPLLDVSSTEIREKIKKGEDIKDLIPEKTYNIIKKYGLYR--
NADD_CLOAB      VLEQKEYLEKKYINNIVFLDIKPIDISSTIIRQKIRENEYIGDLVPEKIYDIIKKNKLY---
NADD_CLOBJ      XXXXXXXXXXXYGKEILFMDASILDISSTKIRNRIKEGKEVSFYMPDKVYKFILQNNLYK--
NADD_CLOBH      XXXXXXXXXXXYRKEILFMDASILDISSTKIRNRIKEGKEVSFYMPDKVYKFILQNNLYK--
NADD_CLOB6      XXXXXXXXXXXYRKEILFMDASILDISSTKIRNRIKEGKEVSFYMPDKVYKFILQNNLYK--
NADD_CLOB1      XXXXXXXXXXXYRKEILFMDASILDISSTKIRNRIKEGKEVSFYMPDKVYKFILQNNLYK--
NADD_CLOBL      XXXXXXXXXXXYRKEILFMDASILDISSTKIRNRIKEGKEVSFYMPDKVYKFILQNNLYK--
NADD_CLOBK      XXXXXXXXXXXYRKEILFMDASILDISSTKIRNRIKEGKEVSFYMPDKVYKFILQNNLYK--
NADD_DESHY      FLEELKRDYPEFLPNMHLFDVPALAISSTDIRSRVKEGKPIRYLLPESVRLYIEKTGLYR--
NADD_CLOBM      XXXXXXXXXXXXXXEILFMDASILDISSTKIRNRIKEGKEVSFYMPDKVYKFILQNNLYK--
NADD_DESHD      FLEELKRDYPEFLPHMHLFDVPALAISSTDIRSRVKEGKPIRYLLPESVRLYIEETGLYR--
NADD_CLOTH      FRERIKYLEDRFSASILEAEIPLIEISSTMIRNRVKEGKSIKYLVPETVENYIKKEGLY---
NADD_THEPX      IDEELNKIRKLYGNVIYKVTVPSLAISSTDIRERVAGGRPIKYLLPESVERYIQKYDLYKKD
NADD_THEP3      IDEELNKIRKLYGNVIYKVTVPSLAISSTDIRERVAGGRPIKYLLPESVERYIQKYDLYKKD
NADD_THETN      IDQELDKIRKLYGDVIYKVTVPSLAISSTDIRERVAKGRPIKYLLPEPVERYIQKYKLYKED
NADD_CARHZ      FLNQVQYLKNRYRAQIIVVEMPEIGISSSLIRQRIREKLPYSHLIPVEVYDYIVANNLYR--
NADD_BACSK      -ASAKSQPD------VHFVPFVEVNISSSLIRERLAKGKPIRYFVTPAVEQLIEERNLY---
NADD_MOOTA      LEESRPQLPVEGRHRIHLIEVPALAISSTDIRWRVKNNKPIKYLLPEAVEEYIRSRGLYR--
NADD_TROW8      IPNDR----------ISFLEVPAMAISSSNCRERVRSGLPIWYLVPEGVVQYIAKHGLYR--
NADD_CLOPH      MLQKIMELNEKYKAKIELLRVPMMEVSSRMLRERVKEGQSIRYFLPEAVRSYIIKHGFY---
NADD_TROWT      IPNDR----------ISFLEVPAMAISSSNCRERVRSGLPIWYLVPEGVVQYIAKHGLYR--
NADD_BACA2      ------HIETPY--PLLFADVPEFDVSSTMLRERLKAKEPTQYLMPDKVRQYIEENDLY---
NADD_BACHD      ------LLDSPYQDQLMLVEGPEVNVSSTMIRERMTEGKPISYLLPLDVERYIYEKGLYK--
NADD_BACCN      PYK------------ILTIEIPEFAVSSSLLRERYKNKKTCKYLLPEQVQSYIERNGLY---
NADD_LEIXX      SGLPQQD--------VSLLEVPALAISSTDCRDRVNRGMPVWYLVPDGVVQYISKHHLYR--
NADD_BACLD      ------QIETPY--PLVFVDVPIFEVSSSLLRDRIKNRQPTDYLIPDEVKVYVKENRLY---
NADD_BACSU      ----------ETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLY---
NADD_BACWK      PY------------DIVKVEIPEFAVSSSLLRERYMTKKTCKYLLPEKVQVYIERNGLY---
NADD_CALS8      TLIRREELGIQFSAKMVLIDMPIIDISSTEIRRLIRENKSIRYMVHPKVEEYIIRKGLYK--
NADD_BACAA      --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_GEOKA      -------FSMETPYPVIEVEAPQFAVSSSLIRERVRNGQTIRYLVPEGVRLYIEEKGLY---
NADD_BACCR      PYK------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_BACC4      PYK------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_ANATD      IKKEIEKLSSKYAQDITLIQMPVIDISSTEIRKLISQDKSIRYMVHPKVEEYIKRKGLFKR-
NADD_OCEIH      -LQTSYPVD--------FVDIPTIQLSSTILRERLQNREWIRYLLPDSVMQYVREHQLY---
NADD_GEOTN      -------FSMETPYPVIEVEVPQFAISSSLIRERVQNGQTIRYLVPEGVRLYIEEKGLY---
NADD_GEOSW      -------FSTETSYPIMEVEVPQFAVSSSMIRDRVRKGQTIRYLVPECVRLYIEERKLY---
NADD_STRP1      ----KYKAGTSY--PVIWVDLPLIDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ--
NADD_BACHK      --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_BACAC      --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_CLAMS      --------SGLPHADVRLLEVPALAISSTDCRARVGRGFPVWYLVPDGVVQYISKHHLYR--
NADD_CLAM3      --------SGLPHADVRLLEVPALAISSTDCRARVGRGFPVWYLVPDGVVQYISKHHLYR--
NADD_BACC2      PYQ------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_BACAH      SYP------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_STRP3      ----KYKAGTSY--PVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ--
NADD_MYCVP      --KHISAAMAELPDDALHLEVPALAISSTDCRIRAEQSRPIWYLVPDGVVQYVAKRNLYRSE
NADD_BACCZ      PYP------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_BACC3      PYP------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_BACC0      PYP------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_RUBXD      LEARLKNFDR-----IFPVECTRVDVSATGIRRRILQGKSIRYLVPEGVREIILSRGLYRAD
NADD_EXIS2      -----SRYLIPEGARVTAVDMPLLEVSSTDIRQRVARGRSIRYLVPEPVRQLIEEWNLY---
NADD_BACCQ      PYP------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_BACC1      PYP------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_STRP6      ----KYKAGTSY--PVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ--
NADD_STRP8      ----KYKAGTSY--PVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKQVLDYITQEGLYQ--
NADD_BACC7      PYP------------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
NADD_NOCSJ      AALATIPTDR-----VTIVEIPALAISSTDCRRRSQRGEPVWYLVPDGVVQYLAKYDLYPR-
NADD_SACEN      ------QLAGEHLPKVSLVEIPAMAISSTGCRQRVRAGLPVWYLVPDGIVQYIAKRGLYRGE
NADD_DEHSB      V----DELDDKLQQSLILLSKPEVDISSSLVRERVENGQGVEHLVPAAVASYIKKHNLYCRK
NADD_STRMU      ----KYKAGTSY--PVIWVDVPLMDISSSMIRDFIRKNRKPNFLLPKLVLDYIEKEGLYQ--
NADD_BACP2      TY------------SLLFADVPAFDVSSTLIRQRIMQEKPVDYLLPKAVERYIKEHHLY---
NADD_SYNAS      LSGLPEEFARQFIYDIYFRQVTFLDISSSDIRARVKNGKSITYLTPDSVRHYIKKNKLYSTE
NADD_KINRD      --------DGLPLDGVSLMEVPALSISSTDCRQRVAEGLPVWYLVPDGVVQHISKHRLY---
NADD_DEHE1      V----DELDDKLQQSLIMLSKPEVDVSSSLVRERLENGQGVEHLVPEAVAAYIKEHGLYHRQ
NADD_PELCD      PLRLPVVIQEQFCYDVIFLEETFLDISSTHIRQLVAAGRSIRYLLPSGVEHYIYRHGLYRSQ
NADD_DEHSC      V----DELDDKLQQSLILLSKPEVDISSSLVRERVENGQGVEHLVPAAVASYIKEHNLYCRK
NADD_MYCGI      --KHISAAMAELPADALHLEVPALAISSTDCRLRAEQSRPIWYLVPDGVVQYVAKRDLYRNQ
NADD_CORGL      NIIPEMHQDR-----VSLVDIPAMAISSTDCRERSSEERPVWYLVPDGVVQYIAKRQLYRPE
NADD_THET8      -------XXXXXXXXXXXXXXXXXGISSTEIRRRLKEGRSVRYWVPRAVEVYIEKHGLYR--
NADD_THET2      -------XXXXXXXXXXXXXXXXXGISSTEIRRRLKEGRSVRYWVPRAVEVYIEKHGLYR--
NADD_SYNJA      AAQVLRSVAAKLPIRAAILDAPTLTLSSTYLRQQIQKGGSIRYLVPPAVEHYIRQHRLY---
NADD_ROSS1      LPALAEMFP-ALPERLILIEGPRLDISSTDLRQRVAQGRPIRYQTPDAVVAYIEAHGLYR--
NADD_LACPL      ----------QY--PVIWVDAPLIDISSTQIRQKISHGHSVRYLVPEAVAAYIKEHHLYEQ-
NADD_GEOSF      LDKAPVAIADRFCYHAAEKRLTHLDISSSEIRTLTRQGRSIRYLLPATVEQYIKEQRIY---
NADD_ACIC1      PTGLPPD-------RVSLLEIPALAISSTECRERIRQNRPIWYLVPDGIVQYISKRGLYRR-
NADD_HERA2      WPALLDQFP-ELAKRSVRIQGPRMDLSATELRSRLQAGLPVRYLVPDAVASYIAQQQLY---
NADD_DESAD      MLKRQDVWQMKGGKSIYIIGDFDFVISSTLVREEWKKGRDVSKLVPKAVAECMNE-------
NADD_ARTS2      MGRK----------DVSLLEVPAMAISSTDCRTRVAAGNPVWYLVPDGVVQYIAKYGLY---
NADD_MYCSS      --KHISAALRELPADALSLEVPALAISSSDCRKRAVEARPIWYLVPDGVVQYVTK-------
NADD_MYCSK      --KHISAALRELPADALSLEVPALAISSSDCRKRAVEARPIWYLVPDGVVQYVTK-------
NADD_MYCSJ      --KHISAALRELPADALSLEVPALAISSSDCRKRAVEARPIWYLVPDGVVQYVTK-------
NADD_FRAAA      ----QLALDAALPANSVLLEVPALAISSSDIRQRVGRGAPIWYLTPDGVVRYIAKRHLYQ--
NADD_COREF      DIIPEVHKDR-----ISLVDIPAMAISSTDCRQRAAEGRPVWYLVPDGVVQYIAKRGMYQ--
NADD_MYCLE      ------ELGQEHITGVMLVEIPALAISSTDCRQRVEQRQPLWYLMPDGVVQYVFKRRLYR--
NADD_GEOLS      PLQQLPELVRDQFTSIRFVIGTRLDISSSQLRERVARQQSIRYLVPPEIESFITQKGLYQ--
NADD_STRR6      ------KVGTSY--PVIWVDVPLMDISSSMVRDFLAQGRKPNFLLPQPVLDYIEKEGLY---
NADD_STRPN      ------KVGTSY--PVIWVDVPLMDISSSMVRDFLAQGRKPNFLLPQPVLDYIEKEGLY---
NADD_MYCTU      ------ELRNEHITSLLLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKCRLY---
NADD_MYCTA      ------ELRNEHITSLLLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKCRLY---
NADD_FRASC      ------ALDAGLPTGAVLLEVPALAISSSDIRERVGRRAPIWYLTPDGVVRYIAKRRLYQ--
NADD_METI4      YL-------------VPLPKIRYVDISSTEIRERVKKELPIFHLLPQAVFQYIKENSIY---
NADD_STRCO      AGLPK--------GGVSLVEVPALAISSTDCRARVAKGDPVWYLVPDGVVRYIDKRHLYRGE
NADD_MYCMM      HVTAALDGLAEDALSLVEIPAL--AISSTDCRRRAAHGRPLWYLMPDGVVQYVSKRRLYR--
NADD_MYCPA      ------ELCREHITGVLLVEIPALAISSTDCRQRAAQRRPLWYLMPDGVVQYVSKRRLYRAE
NADD_THERP      TIFARVPAARD---RVILVPVPLIQIAASDIRRRVAEGRTIRYQVPLVVEEYIARHGLYR--
NADD_MYCA1      ------ELRREHITGVLLVEIPALAISSTDCRQRAAHRRPLWYLMPDGVVQYVSKRRLYRAE
NADD_MYCBP      ------ELRNEHITSLLLVEIPALAISSTDCRQRAEQSRPLWYLMPDSVVQYVSKCRLY---
NADD_MYCBO      ------ELRNEHITSLLLVEIPALAISSTDCRQRAEQSRPLWYLMPDSVVQYVSKCRLY---
NADD_LACLA      -LRRKDTISKSPYP-VTWLDAPLLPISSTMLREMFAKNIEPTYFLPQNVIDYIKTEKLYKK-
NADD_DICTD      L----KDFIKTFENKIFFLDFPYYPISAKEIRDRVKKGLSIKYLVPENVEEYIIKNSVYCEE
NADD_CORJK      DEGSDDPLSKEVAARLSLVEIPAMAISSTDVRERATSGRPVWYLVPDGVVQYIAKHGMY---
NADD_THEMA      EHARRVLGD---LSEIVFLDMPIVQISSTEIRERARLGKTLKGFVP----------------
NADD_GEOUR      XXXXXXXXXHEFCYSVYSIAGTLLDISSSDIRELARLGRSIRYLVPQSVEHYIKEQRIY---
NADD_GEOSM      LAELPVAIAGEFCYDVYALDGVLLDISSSHIRLLVQGGRSIRYLIPDAVEQYIKEQRLY---
NADD_STAAT      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAAE      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAAC      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAA8      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAA3      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_THEP1      EHARRVLGD---LSEIVFLDMPIVQISSTEIRERARIGKTLKGFVPEEIREEVEVF------
NADD_SALAI      AHLPAD--------TVSLVQVPAMAISSTDCRARVSRGEPLWYLVPDGVVQYIAKRRLYQK-
NADD_OPITP      -IKARVDIPG---LRLHRCDGHLLAISSTELRDRVKRNLSLDYFVPHKAIVYIREKHLYR--
NADD_ENTFA      ------NYPTESTYPIIWVDVPQMAISSTLIRQKVKSGCSTRYLLPENVINYIQEKGLYQDE
NADD_THESQ      EHARRVLGD---LSEIVFLDMPIVQISSTEIRERARIGKTLKGFVPEEIREEVEVF------
NADD_GEOBB      LAEAPVAIAGEFCYDVYALDGVLLDISSSHIRLSVQGGRSIRYLLPDAVEHYIKEQRLY---
NADD_ARTAT      MGR----------DDVSLLEVPAMAISSTDCRTRVGAGNPVWYLVPDGVVQYI---------
NADD_STAAB      --------SQNVDNAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_BORBZ      IYKERLKSSFKH----IYIDNKIIPISSSEIRNRIVNGLPVSYLLPFGVLKYIKDNNLY---
NADD_BORBU      IYKERLKSSFKH----IYIDNKIIPISSSEIRNRIVNGLPVSYLLPFGVLKYIKDNNLY---
NADD_STAES      -----ETDNQNVSKEMISIKIPRIDISSTMIRNRVRMNQSIKVLVPKRVENYIKEEGFY---
NADD_STAEQ      -----ETDNQNVSKEMISIKIPRIDISSTMIRNRVRMNQSIKVLVPKRVENYIKEEGFY---
NADD_STAAW      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAAS      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAAR      --------SQNVENGMIAIQIPRVDISSTMIRQRVSKGKSIQVLVPKSVENYIKGEGLY---
NADD_STAAN      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAAM      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAA9      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAA2      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_STAA1      --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
NADD_SALTO      AHLPAD--------TVSLVQVPAMAISSTDCRARVSRSAPLWYLVPDGVVQYIAKRRLYQQ-
NADD_GEOSL      LLAAPVAITAQFCYSVYWLAGVPLDISSRSIRGLARLGRSIRYLVPEAVERYINEQRIYAHD
NADD_DESPS      TVLFLTELGFVQTEHSSYLTLYELEVSSTEVRRTFEKSGDLYQKLPPTVADYIMKHGLY---
NADD_BORGA      IYKERLKSSFKH----IYIDNKIIPISSSEIRNRIANGLPVSYLLPCSVLKYIKDNNLY---
NADD_SYNJB      XXXXXXXXKLPIQAQI--LEAPTLTLSSTYLRQQIQKGGSIRYLVPPAVEHYIRQHRLY---
NADD_STAHJ      ----YQEVDE----SMISVNIPRMDISSSLIRNRVKNKQPINILVPRSIHDYIREEGFY---
NADD_RHOBA      YSILDGMTDETQIQRISQIQMPQIEISSSDLRNRIATGRSIRFRVPHPVATLIDNEKMYR--
NADD_PELPD      PLSASRSLEHVGGTRVHFFAGCLLDISSSEIRRLAATGRSITYLVPPQVEAYIKEQRIY---
NADD_LISMH      ------SYQTEVPYDIVKINMPETTISSTEIRNNIENA---STFLPEKVWSYIKEHQLYGKK
NADD_LISMF      ------SYQTEVPYDIVKINMPETTISSTEIRNNIENA---STFLPEKVWSYIKEHQLYGKK
NADD_LISMC      ------SYQTEVPYDIVKINMPETTISSTEIRNNIENA---STFLPEKVWSYIKEHQLYGKK
NADD_SHEHH      PIQTTLKPRRKLATNIFILNVAEQDISSTQVRQQLMQGHIPSAALPASIQDYIQHNRLYR--
NADD_LISIN      ----------EVPYDIVKINMPETAISSTEIRNDIEHA---EAFLPEKVWSYIKEHQLYGKK
NADD_HYDS0      ---GKEXXXXXXXXXXXXCNTRTIDISSTEIRERIKHGKSVKYMIPDKVLEFILKEGIYAK-
NADD_CORK4      --------------------------------------------------------------
NADD_DECAR      ISSLPHELASEFAGGIVTFAMTQLAISATQIRKLLANELSARYLLPDSVLDYIQTHSLYR--
NADD_SHEON      ESRMQHELSARHASHIFTVDISPQNISSTQIRSQLAMGEIPRDTLLPVTLNYIQKQRLY---
NADD_GEOMG      LAAAEKRLAHRSGYSVYYLAGIPLDISSSAIRRLARLGRSIRYLVPEPVAHYITEQRIYTHD
NADD_BORAP      IYKERLKSSFKH----IYIDNKIIPISSSEIRNRIANGFPVSYLLPFGVLKYIKDNNLY---
NADD_SHESM      GHPMQHELSARHATRIFTVDISPQDISSTQIRSQLAMGEIPQDALLPVTLNYIQKQRLY---
NADD_LISW6      ------HYQAEVPYDVVNIDMPETTISSTEIRNNIEHA---EAFLPEKVWLYIKEHQLYGKK
NADD_SHEWM      RVRSPNKITGKQSGLIIPIPVTPQAISSTHIREQLSEGITPTNALPDKIIQYIEDKNLYR--
NADD_DESAA      EMFHVEQYIRENLKRIYFAQTTALDISATHIRKTVNQGKSIAFLAPESVEKYIKRQGLY---
NADD_DICT6      YSSDLXXXXXXXXXXXXXLDFPYYPISAKEIRERVKRGLSIKYLVPESVEDYIIKNGIY---
NADD_STAS1      --KTTQEVESE----MLSITIPRIDISSTLIRKRVKNKENIQALVSPSVEQYIREEGLY---
NADD_SHESR      GHPMQHELNVRHATRIFTVDISPQDISSTQIRSLLAMGEIPQDALLPVTLNYIQKQRLY---
NADD_SHESA      GHPMQHELSARHATRIFTVDISPQDISSTQIRSQLAMGEIPQDALLPVTLNYIQKQRLY---
NADD_BACTN      --------ENGLPETVRLVHSPTFEISSTFIRQALDEKKDVRYFLHPKVWEYIREY------
NADD_ACIF5      LQRRCEDVDALRQTPILFHTVTALEISASNIRSLLAGHQSPRFLLPDEVLDYIDAEGLYQ--
NADD_ACIF2      LQRRCEDVDALRQTPILFHTVTALEISASNIRSLLAGHQSPRFLLPDEVLDYIDAEGLYQ--
NADD_SHEPA      MQKRLHDVARPLSGKIFMVDITQQDISSTQVRQQLMQGIMPSAVLPTSIQEYIRHNRLYR--
NADD_BORHD      LISR---FKHTYIDNRIF------PISSSEIRHRIEQGLPVDYLLPFDVLRYIKNNNLY---
NADD_BACV8      --------PTTLPPSVQLADTPLLEVSSTFIRQALAEGRDIRYFLHPAVYERLKK-------
NADD_GEMAT      PLLIDAESDSGVVAEV--LSTRQVDMSSTEIRSRVRDGRSIRGFVPDAVATYIASTGLYR--
NADD_SHEPC      TLKNPPQKHHPIHGRIFTVDITPQDISSTQIRSALAIGKIPTDALMPVTLNYIQKQQLY---
NADD_PSEPG      LLAARSESDPTAMSNISFVWQTPLAVSATQIRQLLASGKSVRFLVPDAVLAYIEAHELYR--
NADD_AERS4      LLARHHTTDRRLAGHIWLADNLPIALSATRLRELLAAGQDPRYLLPASVADYIRQQGLYQAD
NADD_UNCTG      VNKNVKYLDR-----CVFIDKETEDISSTEIRRLVKE-------------------------
NADD_SHESW      TLKNPPQKHYPIHGRIFTVDITPQDISSTQIRSALAIGKIPTDALMPVTLNYIQKQQLY---
NADD_SHEFN      LLFRQATADPSHAKNIFTINSQLVDISSTEIRQQLAQNIDISTVLSQTTTEYIRQHQLYR--
NADD_PSEPK      LLAARSESDPTAMSNISFVWQTPLAVSATQIRQLLASGKSVRFLVPDAVLAYIEAHELYR--
NADD_BACFR      L-----------PPNVHVADSPIFEISSTFIREALATGKDIRYFLHPAV-------------
NADD_BACFN      L-----------PPNVHVADSPIFEISSTFIREALATGKDIRYFLHPAV-------------
NADD_SYMTH      XXXXXXXXGPRLSGRVRLLEIPGVAVASADLRRLAAAGYPLRYLVPDPVARYIAEHRLYLR-
NADD_LEGPA      VPKSVQTLLNQYAGSICLYNAGHYDISSTKIREQLKQHKDVKSNLPDLVYDYIKKQELYQ--
NADD_LEGPL      VPKSVQTLLNQYAGSICLYNAGHYDISSTKIREQLKQHKDVKNNLPDLVYDYIKKQELYQ--
NADD_LEGPH      VPKSVQTLLNQYAGSICLYNAGHYDISSTKIREQLKQHKDVKNNLPDLVYDYIKKQELYQ--
NADD_NEIMF      TPRELHAWLGKSLQSVRILSAPMHNVSSTEIRRNL-ASQGVSDGIPPAAARYIREHGLYEK-
NADD_MYCS2      ILDAMRELPPD---ALSLVEVPALAISSSDCRKRAEEQRPIWYLVPDGVVQYVAKRGLYTRK
NADD_FLAPJ      -----NQFINHQKIHIIKAPI--VEISSTFIRENIKNKKNIQPLLPPKVWKYIDHSNFYKK-
NADD_FLAJ1      ISDEPENVELKSHPKIHVIDAPIVEISSTFIRNSIKEGKNIQPLLPPKVWEYIDHNNFYKK-
NADD_SHESH      DSAIYEEYEHRLTSTIIPIEIAPQPYSSTEIRHQLFNGIIPENALPSKIIKFIQHNSLYQ--
NADD_SALG2      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_SALEP      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_PSEPW      LLAARSESDPTAMSSISFVWQTPLAVSATQIRQLLASGRSVRFLVPDAVLAYIEAHELYR--
NADD_SHEB5      ILTARSHAHQEHAKNIFPVTITPQDISSTQIREQLAKGEIPVDLLMPVTLDYIQNQQLY---
NADD_PSYIN      LVAKHQTTDKHDLHNIIYFQATSLAISSTEIRTLLNQDISIDFLTPDSVINYIKEQHLYK--
NADD_NEIM0      --------------------------------------------------------------
NADD_GRAFK      --KVADEFKTH--AKITRVAAPIIEISSTFIRKSIKESKNIGPLLDEKVWKYIDEMNFYK--
NADD_ERWCT      LTHAPEDLHQQPHGRIFLADTPLVTISATDIRQRRQQGLDCHDLLPPVVLRYINEHGLYQ--
NADD_CHRVO      --------------------------------------------------------------
NADD_THICR      PVPRDGEVGQEASGQIVDLPVTQLDLSATALRSYLKNGDPVDYLMPENVARYIYEHQLYQ--
NADD_NEIG2      SLHQTPRELHAWLGNALQDGSVRINVSSTEIRRNL-SAAGVSDGIPPAAARYIRKHGLYEK-
NADD_NEIG1      SLHQTPRELHAWLGNALQDGSVRINVSSTEIRRNL-SAAGVSDGIPPAAARYIRKHGLYEK-
NADD_LEGPC      VPKSVQTLLNQYAGSICLYNAGHYDISSTKIREQLKQHKDVKNNLPDLVYDYIKKQGLYQ--
NADD_SHEB9      ILTARSHAHQEHAKNIFPVTITPQDISSTQIREQLAKGEIPVDLLMPVTLDYIQNQQLY---
NADD_SALTY      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_SALPK      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_SALPB      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_SALPA      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_SALCH      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_SALAR      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_SHEDO      LMQIKNSIKETKVGSIFPVNITAQDISSTEIRAQIMNNQALSPLLPANIIDYIKQHQLYR--
NADD_SHEB2      ILTARSHAHQEHAKNIFPVTITPQDISSTQIREQLAKGEIPADLLMPITLDYIQNQRLY---
NADD_SALTI      TQAQHQQWLEQHLTHTIYLETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR--
NADD_SHEB8      ILTARSHAHQEHAKNIFPVTITPQDISSTQIREQLAKGEIPADLLMPITLDYIQNQRLY---
NADD_PSEE4      LLAARSESDPTAMSHISFVWQTPLAVSATQIRQLLASGKSARFLVPDAVLAYIEAHDLYR--
NADD_NEIMB      --------------------------------------------------------------
NADD_NEIMA      --------------------------------------------------------------
NADD_ESCF3      ASPKYQQWLERHMTKIYLAETPWLNISASLIRERLMKGESCEDLVPESVLEYINQHGLYR--
NADD_VESOH      LTKQKTGF-------IFFANNQMLNISSSTIQGKIKSQKNLSGLLPDSIINYIN--------
NADD_ROSCS      -LSHLSQVLPQLPARLIEIDGPRLDISSTDLRQRVAQGRPIRYQTPDAVVAYIEANGLYR--
NADD_PSEF5      LLAARSVSDQGPGGHIAFVWQTPLAVSATQIRQLLASGKSVRFLVPDAVLAYIDAHGLYR--
NADD_LISMO      ------LYQPEVPYDVVKIDMPKTTISSTEIRNDIEHA---EAFLPEKVWSYIKEHQLYGKK
NADD_AERHH      LLARHQDLHRLRHGRIWLADNLPVELSXXXXXXXXXXGADPRYLLPPSVAQYIRQQGLYR--
NADD_SALRD      --AIESVADPRFVNDVRYAAAPVMEISGTEVXXXXXXXXXXXYLVPEAVRAYIDTHDLYR--
NADD_PSEAE      LLAARSVADPQALKQITFVWQTPLAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYR--
NADD_PSEAB      LLAARSVADPQALKQITFVWQTPLAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYR--
NADD_PSEA8      LLAARSVADPQALKQITFVWQTPLAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYR--
NADD_GLOVI      PKQAMADLTERFGAVFVPLSDFECDISSTRVREQLRAGWEA--LLPEQVVSYIHKRGLY---
NADD_SHEAM      VLANRQDLPAEDSGKVLIADIREQDISSTDIRTALAERRDIRQLVPESVARVIETQGLYR--
NADD_PELUB      L--KSVTYNGVNKNRLSFINFKKVNISSSQLRK-----------------------------
NADD_ANAVT      LICKQVKQQLRKQSNTIHWHLLHIPVSSSLIRKLYRVGKSIRYLVPEDVRSYIADHKLYSED
NADD_IDILO      ELKRDKNALNTQSQGLLYIETPMVDVSATELRKQLQQR-EKNLPLPSNVYNYIRQHQLY---
NADD_COXBU      LLENAEDLGRFQFGKIFFQTLSPRPISATQIRHYLAKGEIVAPLLPKTVLTYIKAHKLYQQ-
NADD_COXBR      LLENAEDLGRFQFGKIFFQTLSPRPISATQIRHYLAKGEIVAPLLPKTVLTYIKAHKLYQQ-
NADD_THEM4      LVYKKVERVLESLSNSIYLKLPLIQISSTVVRERAIKGLSLYGFVPQHIISYVEE-------
NADD_PSEA7      LLAARSVADPRALKQITFVWQTPLAVSATQIRALLGNGRSVRFLVPDAVLNYIEAHHLYR--
NADD_ENTS8      LARHVDELHREPAGKIYLADTPLYPISATDIRARLASHQSCDDLLPPAVLAYIQRHALYR--
NADD_CYTH3      LREHK---------NVRLVAAPLLEISATYIRNLVKQEKSIRYLVSKEVEELI---------
NADD_COXBN      LLENAEDLGRFQFGKIFFQTLSPRPISATQIRHYLAKGEIVAPLLPKTVLAYIKAHKLYQQ-
NADD_ARCB4      KLKDFRTLN------------IDIDVSSTLLRTQI---------------------------
NADD_HAHCH      FLRQNNDLIRQPAGKVGFITLTQMGISSSKVRELIGLRLSPRFLLPDSVWRYIRQHRLY---
NADD_BUCAT      ELEKWIHSNTVYCGLIFFSDAPCINISSSRIRKNYFYGKNSHSLLP----SIVNNYILLKK-
NADD_ANASP      LICKQVKQQLRKQSDTIHWHLLHIPVSSSLIRKLYRIGKSIRYLVPEDVRSYIAAHKLYSED
NADD_PARD8      --------IPAIYPNVKKVDAPLMEISSTFIRNAYQADKDIRFFLPEGV-------------
NADD_BUCAP      PKLKKWISDHTTKNSIFFSKMSMLNISSTAIRKSYYEGKSACGLLPSKIDKYILSKNLYK--
NADD_BORA1      XXXXXXXXXXXXGRSLRELPFTPMPVSASEIRQRLAQGQNTEGLLPEGVARHIAEHGLYR--
NADD_MARMS      LISELSGFCENYCARVWFETLTPLGISSSMIRELARKKESIAYLLPEPVQKYIEQHQLYR--
NADD_ECOLU      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_CITK8      VKEQHQQWLERHLTHTIYLETPWFNISATLIRERLEKGEPCDDLMPESVLNYINQQGLYR--
NADD_SHIB3      LTHNQEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_CHRSD      LVAGREVSDVETLMQAPAGSLLRMAISATSIRERLRRGDSIRYLVPEAV-------------
NADD_CELJU      LLAQHQQLRLAACGSIVRLAPRLLPISATEIRQLIGAGQSPQFLVPDSVWQYIGQERLYR--
NADD_SHIBS      LTHNQEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_BUCAI      ELEKWIHSNTVYDCNLLHKQPCGINISSSRIRKNYFYGKNSHSLLP----SIVNNYILLKK-
NADD_BUCA5      ELEKWIHSNTVYDCNLLHKQPCGINISSSRIRKNYFYGKNSHSLLP----SIVNNYILLKK-
NADD_SHISS      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_SHIFL      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_SHIF8      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECOSM      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECOSE      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECOLI      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECOLC      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECOHS      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECO8A      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECO7I      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECO24      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_HERAR      ATEVAQEFTRRTGTGLAYLPNLAVDISATAIRAALQRGERPTSQLPLGVLDYIEQHHLYK--
NADD_SHIDS      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCDDLLPEPVLTYINQQGLYR--
NADD_FUSNN      --------------------------------------------------------------
NADD_ECOL6      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECOL5      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECOK1      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_ECO5E      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCDDLLPEPVLTYINQQGLYR--
NADD_ECO57      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCDDLLPEPVLTYINQQGLYR--
NADD_ECO45      LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
NADD_BORT9      LVSRFKH---------TYIDNXXXXXXXXXXXXXXXQGLPVDYLLPFDVLQYIKSNNLY---
NADD_SERP5      TPELQQWLEQHQVTDAALLDTPQLEISATEIRQRRHQGLNCDDLLPRSVQRYIELQGLYR--
NADD_SOLUE      -IPAEVTVDR--------IDSLEIPISSSEIR-RTLAAGGIPEGLPPAVLAYARDHHLY---
NADD_PETMO      Y---SVDFD------YVKLESPIVEISSTYIRQRIKKGKTVK--------------------
NADD_KLEP7      -LTMAQEADQRWLSGVIYLETPWFDISATIIRQRLERGESCAEMLPAAVLDYIREQGLY---
NADD_PSESM      LLAARAVSDPKALKQITFVWQTPLSVSATQIRQLLASGKSVRFLVPDAVLAYIDVHGLYR--
NADD_PSEU2      LLAARAVSDPKALKQITFVWQTPLSVSATQIRQLLASGKSVRFLVPDAVLAYIDARGLYR--
NADD_PELPB      STPRPEIIPCEACISFVN---FACDISSTLVRSVVASGRSISTLVPPSVHRYIMEYGLYAGE
NADD_SODGM      WLARRLTRDHQQPAGLIYCAATQLAISASDIRARYREGRACDGLLPPSVQGYIDAQGLYR--
NADD_KLEP3      WLDRHLTHDVERLHNAIYLETPWFDISATIIRQRLERGESCAEMLPATVLDYIREQGLY---
NADD_AQUAE      MLEKVKEYIKEYFEDIFFYKGRRIDISST---------------------------------
NADD_HELPJ      --------------------------------------------------------------
NADD_HELP2      --------------------------------------------------------------
NADD_LARHH      LPPAAAEWQARQATDIRALSLSPVDISATAIRADLARGGDGLGHLAPAVRDYIHLHRLYRSE
NADD_THELT      RSVLKELYD-----SIIFLQAPLIQISAS---------------------------------
NADD_YERPY      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_YERPS      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_YERPP      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_YERPN      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_YERPG      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_YERPE      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_YERPB      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_YERPA      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_YERP3      WLESHKVMDPQALSGAIYLDTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR--
NADD_HELPY      --------------------------------------------------------------
NADD_HELPH      --------------------------------------------------------------
NADD_METPP      PSELLAVWHR-----IEALPMPPMNVSSTAIRAHLAQSL-VPDMVPTVVARYIDRYHLY---
NADD_COPPD      TVARPE-------AEAIFTDMTPINVSSTYIRQRVAKGKPITYLVPKTVETYIHENHLY---
NADD_YERE8      WLDAHRVFDPQALSGAIYLDTPLLDISATDIRHRRHNGESCDDLLPRAVQRYIELQGLYR--
NADD_NITSB      KYKMIE---------------VHEDISSTELRIHPK-----KRYLPPIVAEEIIRF------
NADD_MARAV      --------------------------------------------------------------
NADD_CHLPD      IAHREQRL--EMIGNVRFID-FDCPISSTTIRADIASGRPVTAKIPSAINRYIIDHRLYR--
NADD_SACD2      INSSAKQLTQQANGGVALLHTPRIELSSSDVRQRLGAQKSIQYMVPACVETYIRAHKLY---
NADD_PSEMY      LLAARSVSDPLSLAQISFIWQTPLAISATQIRHLLATGRSARFLLPDAVLAYIQAHDLYR--
NADD_CHLP8      ------QHDAEALHLPVRRIDFDMPVSATEIRRLVAAGQPVSQLVPPSINHYIAEHGLYR--
Y336_MYCPN      QL------------------------------------------------------------
NADD_BORBR      LATWLAAHRRQ----LHELPFAPMAVSASDIRQRLAAGAATDGLLPEPVAAYIATHHLYR--
NADD_CHLL2      ----RENSSFPFSSGTVRLIDFDFPLSSTVIRERVAADMPVGDLLPSAIRHYIVKHGLYRK-
NADD_BORPE      XXXXXXXXXXXHRRQLHELPFAPMAVSASDIRQRLAAGAATDGLLPEPVAAYIATHHLYR--
NADD_TREPS      -VERATRTLQSFPFPWVSAENVALPISSTYIRTAIQRGRSWGYLVPSPVREYIIARGLYR--
NADD_TREPA      -VERATRTLQSFPFPWVSAENVALPISSTYIRTAIQRGRSWGYLVPSPVREYIIARGLYR--
NADD_PROVI      ----EHMTERPDAVSGIRFVEFSCPLSSTMLRGRIAEGQSVSSLLPSSIDRYIRREGLY---
NADD_BORPA      LATWLAAHRRQ----LHELPFAPMAVSASDIRQRLAADAATDGLLPEPVAAYIATHHLYR--
NADD_PSEA6      --------------------------------------------------------------
NADD_CHLPB      XXXXXXE--RLHDQSFRHID-LNLPLSSTEIRKRLASGDDCSAEIPSPIWQYIVENQLYQ--
NADD_UREPA      SCPQKSESFNFFEHEILLVNDFNYNISSTEIKKR----HNLTSGIDPAVLDYINEHGLY---
NADD_PORG3      --------DTTLPTGCRYIDAPRIEISSTQIRTSILEGKDLRYWLPPESQDVI---------
NADD_CAMJJ      --------------------------------------------------------------
NADD_HALHL      VARRPAELRHRPAGCILFQAVTPVDISATGIRRSLALGRSVRYLLPEAV-------------
NADD_CHLT3      --------------------------------------------------------------
NADD_BURS3      ITARQAGADVLKATSAGHLTTLSFDIAATDIRAHLRECI-----------------------
NADD_BAUCH      NWMEYRFTDDPSALNLVYAETPELAISASDIRGRVHAILPYYDLLTHSVHAYINKQGLYR--
NADD_AZOPC      YFNHPNIY---FCK-----DAPQIEISSAFIRKSIVEGKDIRFYMPEGVCEVVN--NLFR--
NADD_PORGI      --------DTTLPTGCRYIDAPRIEISSTQIRTSILEGKDLRYWLPPESQDVI---------
NADD_PELLD      EIAGDSR---------VRCIAFDAPVSSTMVREFSATGKSLRGLVPETVMQYILSEGLYR--
NADD_CAMJR      --------------------------------------------------------------
NADD_CAMJE      --------------------------------------------------------------
NADD_CHLCH      LVQEGVSFYN-----------FDAPLSSTDIRKQLRAGLPVNGLLPASILRYIEQEGLYR--
NADD_CAMJ8      --------------------------------------------------------------
NADD_STRMK      ELGRALEADNEQALRILRLHHPLREESASAVRAQIAAGGPWRALLPPAVADYVAAHGLYR--
NADD_WIGBR      XXXXXXXXDPKILHYIYYAFTPIIKISSRNIRLRYKFGISCNGLISSSVQKYINKKNIYKR-
NADD_BURCJ      IAARQARADVLKATRLLIDTTLSFDIAATDIRAHLRECI-----------------------
NADD_PROA2      --LEHAAFDDAYAHQVRFID-FDFQLSSTAIRYAIATGEPYAHLVPPSIADYIASRHLY---
NADD_FERNB      LYKRGQQILGNLYSNVIELDFPLIEISSSDIRKRIVEGKSIIGFVDGEILDVTNTYLMHHK-
NADD_METCA      AEDLKHCVEERQVTDIYFLEVTQLAIASTSIRRMLREGRSAKYLLPDAVLELIHRESLYAK-
NADD_ERYLH      --------------------------------------------------------------
NADD_CHLTE      XXXXXXXXXXXHYD-------FDMPVSATKIRRLAAAGQPIGQFVPSSIAQYIAEHKLY---
NADD_CAUSK      --------------------------------------------------------------
NADD_ACHLI      DLLSK---------------------------------------------------------
NADD_RHOFD      GAGAKFDLETTHKSRFRRLLMPALNVSATDIRARFAAHLSVADMVFEPVARYIAHHHLYQ--
NADD_PARL1      --------------------------------------------------------------
NADD_SULDN      DIEIPDEF---------IMLSVDEKISSTQLRENIQLS------------------------
NADD_SILST      --------------------------------------------------------------
NADD_RHILW      --------------------------------------------------------------
NADD_SILPO      --------------------------------------------------------------
NADD_RHIE6      --------------------------------------------------------------
NADD_RHIME      --------------------------------------------------------------
NADD_RHIL3      --------------------------------------------------------------
NADD_ROSDO      --------------------------------------------------------------
NADD_RHIEC      --------------------------------------------------------------
NADD_MYXXD      TLGPP-----------------LAEVSSTLIRDLLARGEAPSDLVPARAIAYAREHGLY---
NADD_AGRT5      --------------------------------------------------------------
NADD_SULNB      --------------------------------------------------------------
NADD_LEPIN      HLNSLFEFK--------FLENPLIPVTSTDLRKSFFQS-KVPNLISKKVLDYILKNKLYSK-
NADD_LEPIC      HLNSLFEFK--------FLENPLIPVTSTDLRKSFFQS-KVPNLISKKVLDYILKNKLYSK-
NADD_HELHP      --------------------------------------------------------------
NADD_GLUOX      --------------------------------------------------------------
NADD_XYLFT      --------------------------------------------------------------
NADD_XYLF2      --------------------------------------------------------------
NADD_RHILO      --------------------------------------------------------------
NADD_XYLFM      --------------------------------------------------------------
NADD_LEPBL      VVPRNSKLFSQF----QFLKNPLIPASSTDLRQSFFQS-TIPDRIPKKVLDYILRNRLYSK-
NADD_LEPBJ      VVPRNSKLFSQF----QFLKNPLIPASSTDLRQSFFQS-TIPDRIPKKVLDYILRNRLYSK-
NADD_XYLFA      --------------------------------------------------------------
NADD_BRUME      --------------------------------------------------------------
NADD_BRUAB      --------------------------------------------------------------
NADD_BRUA2      --------------------------------------------------------------
NADD_RHOSK      --------------------------------------------------------------
NADD_RHOS4      --------------------------------------------------------------
NADD_RHOS1      --------------------------------------------------------------
NADD_METEP      --------------------------------------------------------------
NADD_METC4      --------------------------------------------------------------
NADD_RHOS5      --------------------------------------------------------------
NADD_BORPD      XXXXXXXXXXXHRRRLIRLPFSPMAISASDIRGRLARGASTAGLLPATVARYIARHGLYR--
NADD_ANADE      L----------------------PAISSTEIRARLARGEDVRGLVPDRVLRYVEAQRLYR--
Y240_MYCGE      KIANQ--------FNVKYLAKCPLEIASSKLLNQPRKKL-----IPLAVLNYINTNHLY---
NADD_BRUSU      --------------------------------------------------------------
NADD_ANAD2      L----------------------PAISSTEIRARLARGEDVRGLVPEKVLRYVEEKGLYR--
NADD_ANASK      L----------------------PAISSTEIRARLARGEDVRGLVPEKVLRYVEEKGLYR--
NADD_GLUDA      L-------------------------------------------------------------
NADD_BRAJA      --------------------------------------------------------------
NMNA3_MOUSE     YISDSPILQQQHNIHLAREPVLN-EISATYVRKALGQGQSVKYLLPEAVITYIRDQGLY---
NMNA3_HUMAN     YIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK-
COAD_VESOH      --------------------------------------------------------------
NMNA1_MOUSE     FIYESDVLWRHQSNIHLVNEWITNDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHELYNTE
COAD_PELUB      --------------------------------------------------------------
COAD_CLOAB      --------------------------------------------------------------
NMNA1_HUMAN     FIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE
COAD_SYNAS      --------------------------------------------------------------
NMNA1_BOVIN     FIYESDVLWKHQNNIHLVNEWITNDISSTKIRRALRRGQSIRYLVPDLVEEYIEKHNLYSSE
NMA2_YEAST      FLLSHDIMYEHRRNILIIKQLIYNDISSTKVRLFIRRGMSVQYLLPNSVIRYIQEYNLY---
NMAH_SCHPO      FLLAHDIMFAYRGNILVIKQLIYNDISSTKVRLFIRRGMSIRYLLPNSVIQYIERYALYR--
NADD_CAMFF      --------DIEIPSNLQKLN-INVKISSTKVRNEL---------------------------
COAD_PYRFU      --------------------------------------------------------------
COAD_CLOPH      --KLDEEIDTVFFTTSVEYSYL----SSSIVKEIASYGGDISKFVPNSIIQVIDKYNGKRSE
COAD_FUSNN      --------------------------------------------------------------
NADD_SYNY3      LDKLAQLGGHYQLVNQGDDQAITPPISSSIYRQIRDDDL-----IPDPVQSYIQQRQLYRQ-
COAD_METI4      --RLKPEIE----TLFLMPEDNHIYLSSSLVKEISRLGGEISAFVPTVVMEAL---------
COAD_ALKMQ      --------------------------------------------------------------
COAD_PYRHO      --------------------------------------------------------------
COAD_KOSOT      --------------------------------------------------------------
COAD_CALS8      --------------------------------------------------------------
COAD_BUCAP      --------------------------------------------------------------
COAD_BORGA      --------------------------------------------------------------
COAD_BORAP      --------------------------------------------------------------
COAD_ANATD      --------------------------------------------------------------
NMA1_YEAST      FLLSHDIMYEHRRNILIIKQLIYNDISSTKVRLFIRRAMSVQYLLPNSVIRYIQEHRLY---
NADR_HAEIN      --------------------------------------------------------------
COAD_PYRAB      --------------------------------------------------------------
COAD_HELPS      --------------------------------------------------------------
COAD_BLOPB      VIEKLRNTEKK---------------------------------------------------
COAD_THEGJ      --------------------------------------------------------------
COAD_SYNP2      VVKEIAKF------------------------------------------------------
COAD_MYCPE      LNKGKNDYE-----------------------------------------------------
COAD_CARHZ      --------------------------------------------------------------
COAD_BORBZ      --------------------------------------------------------------
COAD_BORBU      --------------------------------------------------------------
COAD_HELPY      --------------------------------------------------------------
COAD_HELPJ      --------------------------------------------------------------
COAD_HELPH      --------------------------------------------------------------
COAD_HELPG      --------------------------------------------------------------
COAD_HELP2      --------------------------------------------------------------
COAD_HELAH      --------------------------------------------------------------
COAD_BORT9      --------------------------------------------------------------
COAD_RHOP2      --------------------------------------------------------------
COAD_LEPBP      --------------------------------------------------------------
COAD_LEPBA      --------------------------------------------------------------
COAD_CLONN      --------------------------------------------------------------
COAD_MICAN      --------------------------------------------------------------
COAD_DESRM      --------------------------------------------------------------
COAD_CLOBJ      --------------------------------------------------------------
COAD_CLOBH      --------------------------------------------------------------
COAD_CLOB1      --------------------------------------------------------------
COAD_WOLWR      --------------------------------------------------------------
COAD_WOLPP      --------------------------------------------------------------
COAD_WOLPM      --------------------------------------------------------------
COAD_MYCPU      --------------------------------------------------------------
COAD_LISW6      --------------------------------------------------------------
COAD_LISIN      --------------------------------------------------------------
COAD_COPPD      --------------------------------------------------------------
COAD_CLOBM      --------------------------------------------------------------
COAD_CLOBL      --------------------------------------------------------------
COAD_CLOBK      --------------------------------------------------------------
COAD_CLOB6      --------------------------------------------------------------
COAD_CHLL2      --------------------------------------------------------------
COAD_BORHD      --------------------------------------------------------------