[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81882.1

[Show Plain Result]


## Summary of Sequence Search
    1::378
    6::381     5e-73  40%  387 aa  NAGA_BACSH RecName: Full=N-acetylglucosamine-6-phosphate
    4::374     5e-63  39%  378 aa  NAGA_VIBCH RecName: Full=N-acetylglucosamine-6-phosphate
    5::386     2e-60  36%  396 aa  NAGA_BACSU RecName: Full=N-acetylglucosamine-6-phosphate
   21::379     1e-52  36%  382 aa  NAGA_ECOLI RecName: Full=N-acetylglucosamine-6-phosphate
   21::379     1e-52  36%  382 aa  NAGA_ECO57 RecName: Full=N-acetylglucosamine-6-phosphate
   25::416     3e-52  35%  418 aa  NAGA_CAEEL RecName: Full=Putative N-acetylglucosamine-6-phosphate
   17::404     5e-52  35%  409 aa  NAGA_RAT RecName: Full=Putative N-acetylglucosamine-6-phosphate
   17::404     6e-52  35%  409 aa  NAGA_MOUSE RecName: Full=Putative N-acetylglucosamine-6-phosphate
   17::404     6e-52  35%  409 aa  NAGA_HUMAN RecName: Full=Putative N-acetylglucosamine-6-phosphate
   17::401     1e-51  35%  404 aa  NAGA_DANRE RecName: Full=Putative N-acetylglucosamine-6-phosphate
   17::401     3e-51  36%  409 aa  NAGA_BOVIN RecName: Full=Putative N-acetylglucosamine-6-phosphate
    7::377     2e-50  35%  381 aa  NAGA_HAEIN RecName: Full=N-acetylglucosamine-6-phosphate
   31::388     3e-47  31%  399 aa  NAGA_VIBFU RecName: Full=N-acetylglucosamine-6-phosphate
   31::414     6e-47  35%  417 aa  NAGA_DROME RecName: Full=Putative N-acetylglucosamine-6-phosphate
    2::164     1e-26  38%  167 aa  AGAA_ECOLI RecName: Full=Putative N-acetylgalactosamine-6-phosphate
   23::357     3e-13  44%  588 aa  ADEC_DESRM RecName: Full=Adenine deaminase;         Short=Adenase; 
   38::370     2e-11  28%  599 aa  ADEC_CLOBM RecName: Full=Adenine deaminase;         Short=Adenase; 
   38::370     7e-11  29%  599 aa  ADEC_CLOB6 RecName: Full=Adenine deaminase;         Short=Adenase; 
   38::370     2e-10  28%  599 aa  ADEC_CLOB1 RecName: Full=Adenine deaminase;         Short=Adenase; 
   38::370     2e-10  28%  599 aa  ADEC_CLOBL RecName: Full=Adenine deaminase;         Short=Adenase; 
   18::124     3e-10  37%  574 aa  ADEC_THEAB RecName: Full=Adenine deaminase;         Short=Adenase; 
    5::112     4e-10  37%  568 aa  ADEC_CLOP1 RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::62      8e-10  54%  430 aa  PYRC_CARHZ RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::108     2e-09  36%  424 aa  PYRC_STAAW RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::108     2e-09  36%  424 aa  PYRC_STAAS RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::108     2e-09  36%  424 aa  PYRC_STAAR RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::108     2e-09  36%  424 aa  PYRC_STAAN RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::108     2e-09  36%  424 aa  PYRC_STAAM RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::108     2e-09  36%  424 aa  PYRC_STAAC RecName: Full=Dihydroorotase;         Short=DHOase;     
   21::333     4e-09  28%  578 aa  ADEC_LACS1 RecName: Full=Adenine deaminase;         Short=Adenase; 
   22::110     8e-09  36%  579 aa  ADEC_LISIN RecName: Full=Adenine deaminase;         Short=Adenase; 
   18::105     8e-09  32%  569 aa  ADEC_DESAA RecName: Full=Adenine deaminase;         Short=Adenase; 
   20::110     8e-09  35%  585 aa  ADEC_BACHD RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::365     1e-08  30%  424 aa  MTAD_THEON RecName:
   21::166     2e-08  33%  576 aa  ADEC2_DESPS RecName: Full=Adenine deaminase 2;       
    3::108     3e-08  30%  425 aa  PYRC_PEDPA RecName: Full=Dihydroorotase;         Short=DHOase;     
    6::90      3e-08  41%  565 aa  ADEC_LACDA RecName: Full=Adenine deaminase;       
    3::422     5e-08  28%  423 aa  PYRC_LACLA RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::129     7e-08  38%  428 aa  PYRC_CLOCE RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::58      9e-08  40%  425 aa  PYRC_LACGA RecName: Full=Dihydroorotase;         Short=DHOase;   
    4::101     9e-08  36%  458 aa  HYDL_ARTAU RecName: Full=L-hydantoinase;       
    5::112     1e-07  32%  572 aa  ADEC_CLOPE RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::137     2e-07  39%  428 aa  PYRC_BACP2 RecName: Full=Dihydroorotase;         Short=DHOase;     
   23::111     2e-07  33%  580 aa  ADEC_LISMO RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::82      2e-07  46%  432 aa  PYRC_ELUMP RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::370     2e-07  26%  398 aa  PYRC_CLOBA RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::63      2e-07  42%  422 aa  PYRC_AQUAE RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::61      2e-07  40%  495 aa  HYDA_PSEPU RecName: Full=D-hydantoinase/dihydropyrimidinase;     
    6::104     2e-07  32%  542 aa  DPYS_SACKL RecName: Full=Dihydropyrimidinase;         Short=DHPase;
   22::110     2e-07  33%  579 aa  ADEC_LISW6 RecName: Full=Adenine deaminase;         Short=Adenase; 
   22::110     2e-07  33%  579 aa  ADEC_LISMF RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::58      3e-07  42%  425 aa  PYRC_LACJO RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::68      3e-07  51%  429 aa  MTAD_CALS8 RecName:
   26::133     3e-07  34%  404 aa  HUTI_THEVO RecName: Full=Probable imidazolonepropionase;       
   18::107     4e-07  33%  574 aa  ADEC_THEM4 RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::109     5e-07  30%  427 aa  PYRC_MACCJ RecName: Full=Dihydroorotase;         Short=DHOase;     
   20::403     5e-07  34%  431 aa  MTAD_SYNWW RecName:
   24::103     5e-07  37%  581 aa  ADEC_CLOBA RecName: Full=Adenine deaminase;         Short=Adenase; 
   15::119     6e-07  37%  426 aa  PYRC_LISMO RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::370     6e-07  25%  398 aa  PYRC_CLOBB RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::111     8e-07  35%  425 aa  PYRC_LACH4 RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::111     8e-07  35%  425 aa  PYRC_LACDB RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::111     8e-07  35%  425 aa  PYRC_LACDA RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::121     8e-07  34%  432 aa  MTAD_METMA RecName:
   22::130     1e-06  37%  424 aa  PYRC_GEOMG RecName: Full=Dihydroorotase;         Short=DHOase;     
    6::92      1e-06  33%  454 aa  ALLB_BACLD RecName: Full=Allantoinase;       
   27::377     1e-06  24%  390 aa  IADA_ECOLI RecName: Full=Isoaspartyl dipeptidase;       
   16::61      2e-06  41%  427 aa  PYRC_DESRM RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::62      2e-06  47%  424 aa  MTAD_THESM RecName:
    1::361     2e-06  29%  419 aa  MTAD_PYRFU RecName:
    4::60      2e-06  45%  471 aa  HYDA_BACST RecName: Full=D-hydantoinase;         EC=3.5.2.-;
   18::105     2e-06  34%  570 aa  ADEC_PETMO RecName: Full=Adenine deaminase;         Short=Adenase; 
   24::103     2e-06  37%  581 aa  ADEC_CLOBB RecName: Full=Adenine deaminase;         Short=Adenase; 
    6::62      3e-06  45%  467 aa  PYRC_METAC RecName: Full=Dihydroorotase;         Short=DHOase;   
   17::62      3e-06  58%  427 aa  PYRC_GEOSW RecName: Full=Dihydroorotase;         Short=DHOase;   
   26::113     3e-06  36%  447 aa  PYRC_CORGL RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::102     3e-06  37%  432 aa  MTAD_METAC RecName:
    3::61      3e-06  39%  479 aa  HYDA_PSEAE RecName: Full=D-hydantoinase/dihydropyrimidinase;     
   34::86      3e-06  50%  424 aa  HUTI_GEOKA RecName: Full=Imidazolonepropionase;       
   24::113     3e-06  32%  581 aa  ADEC_LYSSC RecName: Full=Adenine deaminase;         Short=Adenase; 
   18::317     3e-06  28%  577 aa  ADEC_KOSOT RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::63      4e-06  41%  429 aa  PYRC_LACS1 RecName: Full=Dihydroorotase;         Short=DHOase;   
    4::137     4e-06  32%  428 aa  PYRC_BACHD RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::72      4e-06  41%  431 aa  MTAD_HALOH RecName:
   15::119     5e-06  35%  426 aa  PYRC_LISW6 RecName: Full=Dihydroorotase;         Short=DHOase;     
   15::115     5e-06  36%  426 aa  PYRC_LISIN RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::61      5e-06  39%  461 aa  PHYDA_ECOUT RecName: Full=D-phenylhydantoinase;       
    3::61      5e-06  39%  461 aa  PHYDA_ECOL6 RecName: Full=D-phenylhydantoinase;       
    3::61      5e-06  39%  461 aa  PHYDA_ECOL5 RecName: Full=D-phenylhydantoinase;       
    3::61      5e-06  39%  461 aa  PHYDA_ECOK1 RecName: Full=D-phenylhydantoinase;       
    3::61      5e-06  39%  461 aa  PHYDA_ECO81 RecName: Full=D-phenylhydantoinase;       
    3::61      5e-06  39%  461 aa  PHYDA_ECO45 RecName: Full=D-phenylhydantoinase;       
    3::61      5e-06  39%  461 aa  PHYDA_ECO27 RecName: Full=D-phenylhydantoinase;       
   10::68      5e-06  47%  503 aa  DPYS_DICDI RecName: Full=Dihydropyrimidinase;       
    5::61      5e-06  35%  453 aa  ALLB_SALCH RecName: Full=Allantoinase;       
    5::111     5e-06  28%  454 aa  ALLB_BACA2 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   33::123     7e-06  33%  589 aa  Y3012_BACCR RecName: Full=Putative adenine deaminase BC_3012;      
   16::61      7e-06  44%  425 aa  PYRC_LYSSC RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::66      7e-06  40%  424 aa  MTAD_PYRKO RecName:
    5::145     7e-06  29%  446 aa  ALLB_BACSU RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   37::110     7e-06  31%  596 aa  ADEC_MOOTA RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::334     7e-06  28%  556 aa  ADEC_METJA RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::109     7e-06  33%  570 aa  ADEC_CLOAB RecName: Full=Adenine deaminase;         Short=Adenase; 
   15::119     9e-06  34%  426 aa  PYRC_LISMF RecName: Full=Dihydroorotase;         Short=DHOase;     
   15::119     9e-06  34%  426 aa  PYRC_LISMC RecName: Full=Dihydroorotase;         Short=DHOase;     
    1::82      9e-06  38%  542 aa  ADEC_METST RecName: Full=Adenine deaminase;       
   10::97      9e-06  40%  571 aa  ADEC_METS3 RecName: Full=Adenine deaminase;         Short=Adenase; 
   37::341     9e-06  29%  584 aa  ADEC_METBU RecName: Full=Adenine deaminase;         Short=Adenase; 
   18::61      1e-05  49%  431 aa  PYRC_THETN RecName: Full=Dihydroorotase;         Short=DHOase;   
   22::63      1e-05  45%  425 aa  PYRC_GEOUR RecName: Full=Dihydroorotase;         Short=DHOase;   
    5::61      1e-05  35%  453 aa  ALLB_ECOSE RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECOLU RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECOLI RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECOLC RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECOHS RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECODH RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECOBW RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECO8A RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECO55 RecName: Full=Allantoinase;       
    5::61      1e-05  35%  453 aa  ALLB_ECO24 RecName: Full=Allantoinase;       
   17::88      1e-05  34%  563 aa  ADEC_LACPL RecName: Full=Adenine deaminase;       
   20::128     1e-05  30%  577 aa  ADEC_GEOKA RecName: Full=Adenine deaminase;         Short=Adenase; 
   15::349     1e-05  28%  577 aa  ADEC_BACSU RecName: Full=Adenine deaminase;         Short=Adenase; 
   25::363     1e-05  37%  594 aa  ADEC1_LACSS RecName: Full=Adenine deaminase 1;       
  335::716     1e-05  25%  854 aa  UNC33_CAEEL RecName: Full=Protein unc-33;AltName:
    4::63      1e-05  41%  430 aa  PYRC_LACPL RecName: Full=Dihydroorotase;         Short=DHOase;   
    5::113     1e-05  35%  454 aa  ALLB_ENTFA RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    5::61      1e-05  33%  453 aa  ALLB_ECOSM RecName: Full=Allantoinase;       
   15::60      2e-05  42%  426 aa  PYRC_LISMH RecName: Full=Dihydroorotase;         Short=DHOase;   
    1::58      2e-05  40%  425 aa  PYRC_FUSNN RecName: Full=Dihydroorotase;         Short=DHOase;   
  324::396     2e-05  34%  424 aa  PYRC_CLOAB RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::61      2e-05  39%  461 aa  PHYDA_SHIBS RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECOSE RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECOLI RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECOLC RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECOHS RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECODH RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECOBW RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECO8A RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECO7I RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECO57 RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECO55 RecName: Full=D-phenylhydantoinase;       
    3::61      2e-05  39%  461 aa  PHYDA_ECO24 RecName: Full=D-phenylhydantoinase;       
    2::357     2e-05  46%  422 aa  MTAD1_ARCFU RecName:
    3::61      2e-05  42%  518 aa  DHP2_CAEBR RecName: Full=Dihydropyrimidinase 2;       
    5::61      2e-05  33%  453 aa  ALLB_ECOUT RecName: Full=Allantoinase;       
    5::61      2e-05  33%  453 aa  ALLB_ECOL6 RecName: Full=Allantoinase;       
    5::61      2e-05  33%  453 aa  ALLB_ECOL5 RecName: Full=Allantoinase;       
    5::61      2e-05  33%  453 aa  ALLB_ECOK1 RecName: Full=Allantoinase;       
    5::61      2e-05  33%  453 aa  ALLB_ECO81 RecName: Full=Allantoinase;       
    5::61      2e-05  33%  453 aa  ALLB_ECO45 RecName: Full=Allantoinase;       
    5::61      2e-05  33%  453 aa  ALLB_ECO27 RecName: Full=Allantoinase;       
    6::63      2e-05  37%  449 aa  ALLB_DESHY RecName: Full=Allantoinase;       
    6::405     2e-05  30%  449 aa  ALLB_DESHD RecName: Full=Allantoinase;       
   37::122     2e-05  32%  601 aa  ADEC_SILST RecName: Full=Adenine deaminase;         Short=Adenase; 
   30::347     2e-05  30%  571 aa  ADEC_DEHSC RecName: Full=Adenine deaminase;         Short=Adenase; 
   22::130     3e-05  32%  425 aa  PYRC_GEOLS RecName: Full=Dihydroorotase;         Short=DHOase;     
    5::105     3e-05  41%  428 aa  PYRC_BACSU RecName: Full=Dihydroorotase;         Short=DHOase;     
   16::120     3e-05  34%  428 aa  PYRC_BACCR RecName: Full=Dihydroorotase;         Short=DHOase;     
   16::120     3e-05  34%  428 aa  PYRC_BACC4 RecName: Full=Dihydroorotase;         Short=DHOase;     
    1::78      3e-05  36%  423 aa  PYRC_METJA RecName: Full=Dihydroorotase;         Short=DHOase;   
   22::63      3e-05  45%  425 aa  PYRC_GEOSF RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::105     3e-05  34%  428 aa  PYRC_BACLD RecName: Full=Dihydroorotase;         Short=DHOase;     
   34::86      3e-05  41%  424 aa  HUTI_GEOSW RecName: Full=Imidazolonepropionase;       
    5::61      3e-05  33%  453 aa  ALLB_SALTY RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALTI RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALPK RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALPB RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALPA RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALNS RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALHS RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALEP RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALDC RecName: Full=Allantoinase;       
    5::61      3e-05  33%  453 aa  ALLB_SALA4 RecName: Full=Allantoinase;       
   21::101     3e-05  32%  566 aa  ADEC_DESHD RecName: Full=Adenine deaminase;         Short=Adenase; 
    6::62      4e-05  40%  456 aa  PYRC_METMA RecName: Full=Dihydroorotase;         Short=DHOase;   
  242::368     4e-05  32%  434 aa  MTAD_METBU RecName:
   31::79      4e-05  41%  413 aa  HUTI_CHRVO RecName: Full=Imidazolonepropionase;       
    5::63      4e-05  39%  489 aa  DHP1_CAEEL RecName: Full=Dihydropyrimidinase 1;       
   21::108     4e-05  31%  576 aa  ADEC_BACP2 RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::61      6e-05  35%  422 aa  PYRC_STRP8 RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::61      6e-05  35%  422 aa  PYRC_STRP6 RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::61      6e-05  35%  422 aa  PYRC_STRP3 RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::61      6e-05  35%  422 aa  PYRC_STRP1 RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::137     6e-05  34%  428 aa  PYRC_BACC3 RecName: Full=Dihydroorotase;         Short=DHOase;     
   21::62      6e-05  48%  428 aa  PYRC_ANOFW RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::63      6e-05  42%  430 aa  PYRC_ANATD RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::59      6e-05  45%  457 aa  HYDA_BURPI RecName: Full=D-hydantoinase;         EC=3.5.2.-;
    5::63      6e-05  37%  489 aa  DHP1_CAEBR RecName: Full=Dihydropyrimidinase 1;       
    6::65      6e-05  35%  438 aa  ALLB_BACHD RecName: Full=Allantoinase;       
   23::110     6e-05  31%  582 aa  ADEC_OCEIH RecName: Full=Adenine deaminase;         Short=Adenase; 
   22::117     6e-05  31%  573 aa  ADEC_BACLD RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::236     6e-05  28%  577 aa  ADEC_BACA2 RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::57      7e-05  45%  426 aa  PYRC_THEAQ RecName: Full=Dihydroorotase;         Short=DHOase;   
   42::100     7e-05  39%  423 aa  PYRC_SULSY RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::62      7e-05  41%  427 aa  PYRC_ENTFA RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::62      7e-05  42%  426 aa  MTAD_DICT6 RecName:
   31::86      7e-05  45%  424 aa  HUTI_GEOTN RecName: Full=Imidazolonepropionase;       
    4::130     7e-05  25%  448 aa  ALLB_BACSK RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   14::82      7e-05  39%  540 aa  ADEC_FLAPJ RecName: Full=Adenine deaminase;       
   33::360     7e-05  35%  594 aa  ADEC1_DESPS RecName: Full=Adenine deaminase 1;       
    4::58      1e-04  36%  425 aa  PYRC_LACAC RecName: Full=Dihydroorotase;         Short=DHOase;   
   21::109     1e-04  33%  428 aa  PYRC_BACWK RecName: Full=Dihydroorotase;         Short=DHOase;     
   16::61      1e-04  40%  428 aa  PYRC_BACHK RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACCZ RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACCQ RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACC7 RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACC1 RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACC0 RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACAN RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACAH RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACAC RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::61      1e-04  40%  428 aa  PYRC_BACAA RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::61      1e-04  37%  461 aa  PHYDA_ECOLU RecName: Full=D-phenylhydantoinase;       
  335::412     1e-04  45%  443 aa  MTAD1_SYNAS RecName:
    3::59      1e-04  39%  457 aa  HYDA_RHIRD RecName: Full=D-hydantoinase;         EC=3.5.2.-;
   30::347     1e-04  30%  571 aa  ADEC_DEHSB RecName: Full=Adenine deaminase;         Short=Adenase; 
   22::352     1e-04  25%  580 aa  ADEC2_LACSS RecName: Full=Adenine deaminase 2;       
    6::67      1e-04  34%  573 aa  ADEC2_BACSK RecName: Full=Adenine deaminase 2;       
   68::135     1e-04  48%  566 aa  URE1_PSESM RecName: Full=Urease subunit alpha;       
   68::135     1e-04  48%  566 aa  URE1_PSE14 RecName: Full=Urease subunit alpha;       
   68::135     1e-04  48%  566 aa  URE12_PSEU2 RecName: Full=Urease subunit alpha 2;       
    3::61      1e-04  40%  431 aa  PYRC_THEPX RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::61      1e-04  40%  431 aa  PYRC_THEP3 RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::61      1e-04  40%  422 aa  PYRC_STRPN RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::109     1e-04  32%  428 aa  PYRC_BACC2 RecName: Full=Dihydroorotase;         Short=DHOase;     
   30::354     1e-04  25%  600 aa  ADEC4_RHIME RecName: Full=Adenine deaminase 4;       
  293::345     1e-04  45%  570 aa  ADEC2_CARHZ RecName: Full=Adenine deaminase 2;       
    2::61      2e-04  40%  422 aa  PYRC_STRR6 RecName: Full=Dihydroorotase;         Short=DHOase;   
   42::113     2e-04  33%  425 aa  PYRC_STAES RecName: Full=Dihydroorotase;         Short=DHOase;     
   42::113     2e-04  33%  425 aa  PYRC_STAEQ RecName: Full=Dihydroorotase;         Short=DHOase;     
   19::62      2e-04  40%  425 aa  PYRC_PELCD RecName: Full=Dihydroorotase;         Short=DHOase;   
  307::362     2e-04  41%  406 aa  MTAD_THEMA RecName:
  323::408     2e-04  40%  408 aa  HUTI_SHELP RecName: Full=Imidazolonepropionase;       
   30::80      2e-04  45%  423 aa  HUTI_BACWK RecName: Full=Imidazolonepropionase;       
   29::116     2e-04  33%  605 aa  ADEC_STAMF RecName: Full=Adenine deaminase;         Short=Adenase; 
   18::211     2e-04  31%  551 aa  ADEC_METBF RecName: Full=Adenine deaminase;         Short=Adenase; 
   21::101     2e-04  30%  569 aa  ADEC_DESHY RecName: Full=Adenine deaminase;         Short=Adenase; 
   16::122     2e-04  35%  428 aa  PYRC_GEOKA RecName: Full=Dihydroorotase;         Short=DHOase;     
   21::109     2e-04  33%  428 aa  PYRC_BACCN RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::401     2e-04  38%  432 aa  MTAD_METBF RecName:
   30::80      2e-04  47%  423 aa  HUTI_BACCR RecName: Full=Imidazolonepropionase;       
    3::61      2e-04  40%  520 aa  DHP2_CAEEL RecName: Full=Dihydropyrimidinase 2;       
   62::362     2e-04  31%  596 aa  ADEC_META3 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::99      2e-04  36%  565 aa  ADEC_CLOD6 RecName: Full=Adenine deaminase;       
  118::146     3e-04  52%  557 aa  URE1_SULTO RecName: Full=Urease subunit alpha;       
   70::140     3e-04  49%  570 aa  URE1_CYTH3 RecName: Full=Urease subunit alpha;       
    2::61      3e-04  38%  422 aa  PYRC_STRT2 RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::61      3e-04  38%  422 aa  PYRC_STRT1 RecName: Full=Dihydroorotase;         Short=DHOase;   
  295::359     3e-04  40%  595 aa  ADEC_SERP5 RecName: Full=Adenine deaminase;         Short=Adenase; 
   29::118     4e-04  31%  584 aa  Y3032_BACAN RecName: Full=Putative adenine deaminase
   22::62      4e-04  38%  430 aa  PYRC_SOLUE RecName: Full=Dihydroorotase;         Short=DHOase;   
   10::172     4e-04  29%  404 aa  PYRC_PYRAB RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::62      4e-04  39%  427 aa  PYRC_PELTS RecName: Full=Dihydroorotase;         Short=DHOase;   
    6::57      4e-04  38%  431 aa  PYRC_METTH RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::60      4e-04  40%  427 aa  PYRC_LACLE RecName: Full=Dihydroorotase;         Short=DHOase;   
  299::405     4e-04  37%  433 aa  MTAD_DESRM RecName:
    3::67      4e-04  45%  429 aa  MTAD_CLOTE RecName:
    7::67      4e-04  46%  435 aa  MTAD_BACC3 RecName:
    7::67      4e-04  46%  435 aa  MTAD_BACC0 RecName:
    7::67      4e-04  46%  435 aa  MTAD_BACAN RecName:
    7::67      4e-04  46%  435 aa  MTAD_BACAH RecName:
    7::67      4e-04  46%  435 aa  MTAD_BACAC RecName:
    7::67      4e-04  46%  435 aa  MTAD_BACAA RecName:
   30::80      4e-04  47%  423 aa  HUTI_BACHK RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACCQ RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACC7 RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACC4 RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACC3 RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACC1 RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACC0 RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACAN RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACAH RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACAC RecName: Full=Imidazolonepropionase;       
   30::80      4e-04  47%  423 aa  HUTI_BACAA RecName: Full=Imidazolonepropionase;       
   23::98      4e-04  28%  551 aa  ADEC_LEUCK RecName: Full=Adenine deaminase;       
   17::88      4e-04  30%  553 aa  ADEC1_OENOB RecName: Full=Adenine deaminase 1;       
   53::132     5e-04  29%  573 aa  Y1085_PICTO RecName: Full=Putative adenine deaminase PTO1085;      
   73::140     5e-04  43%  571 aa  URE1_STACT RecName: Full=Urease subunit alpha;       
   25::88      5e-04  34%  420 aa  HUTI_HALMA RecName: Full=Probable imidazolonepropionase;       
   30::80      5e-04  47%  423 aa  HUTI_BACCZ RecName: Full=Imidazolonepropionase;       
   78::119     5e-04  40%  605 aa  ADEC_RHILO RecName: Full=Adenine deaminase;         Short=Adenase; 
   68::132     5e-04  28%  599 aa  ADEC_METKA RecName: Full=Adenine deaminase;         Short=Adenase; 
   24::114     5e-04  27%  579 aa  ADEC_ENTFA RecName: Full=Adenine deaminase;         Short=Adenase; 
   68::135     6e-04  46%  566 aa  URE1_PSEF5 RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURVG RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURS3 RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURM1 RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURCM RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURCJ RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURCH RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURCC RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURCA RecName: Full=Urease subunit alpha;       
   73::137     6e-04  51%  568 aa  URE1_BURA4 RecName: Full=Urease subunit alpha;       
   17::113     6e-04  34%  414 aa  PYRC_PYRFU RecName: Full=Dihydroorotase;         Short=DHOase;     
   15::59      6e-04  40%  430 aa  PYRC_MYCTU RecName: Full=Dihydroorotase;         Short=DHOase;   
   15::59      6e-04  40%  430 aa  PYRC_MYCBO RecName: Full=Dihydroorotase;         Short=DHOase;   
    4::64      6e-04  39%  429 aa  PYRC_LACSS RecName: Full=Dihydroorotase;         Short=DHOase;   
   16::121     6e-04  34%  427 aa  PYRC_BACCL RecName: Full=Dihydroorotase;         Short=DHOase;     
   21::68      6e-04  41%  408 aa  HUTI_IDILO RecName: Full=Imidazolonepropionase;       
  297::362     6e-04  27%  588 aa  ADEC_SHISS RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_SHIFL RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_SHIF8 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ESCF3 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOUT RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOSM RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOSE RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOLU RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOLI RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOLC RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOL6 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOL5 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOK1 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOHS RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECODH RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECOBW RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECO8A RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECO81 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECO7I RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECO5E RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECO57 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECO55 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECO45 RecName: Full=Adenine deaminase;         Short=Adenase; 
  297::362     6e-04  27%  588 aa  ADEC_ECO24 RecName: Full=Adenine deaminase;         Short=Adenase; 
  296::363     6e-04  29%  586 aa  ADEC_BDEBA RecName: Full=Adenine deaminase;         Short=Adenase; 
   16::63      8e-04  40%  428 aa  PYRC_GEOTN RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::62      8e-04  35%  421 aa  PYRC_CLOD6 RecName: Full=Dihydroorotase;         Short=DHOase;   
   33::78      8e-04  40%  498 aa  NDDD_ALCXX RecName: Full=N-acyl-D-aspartate deacylase;       
  299::403     8e-04  36%  428 aa  MTAD_MOOTA RecName:
   23::66      8e-04  45%  435 aa  MTAD_METS3 RecName:
  326::364     8e-04  49%  426 aa  MTAD_DICTD RecName:
   30::78      8e-04  40%  415 aa  HUTI_THEP3 RecName: Full=Imidazolonepropionase;       
    3::76      8e-04  35%  400 aa  HUTI_PARDP RecName: Full=Imidazolonepropionase;       
   32::87      8e-04  38%  424 aa  HUTI_BREBN RecName: Full=Imidazolonepropionase;       
    7::115     8e-04  27%  519 aa  DPYS_MOUSE RecName: Full=Dihydropyrimidinase;         Short=DHPase;
   50::115     8e-04  31%  597 aa  ADEC_PARDP RecName: Full=Adenine deaminase;         Short=Adenase; 
   28::188     8e-04  25%  594 aa  ADEC1_JANSC RecName: Full=Adenine deaminase 1;       
    1::378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGGHDTMDGTYE
NAGA_BACSH      LIIRNITVVNASRDEQMDVWMKDGKIAQIAQHIHAQVDQLEGSGKFLLPGFIDMHIHGSAQMDTMDASDE
NAGA_VIBCH      --LTNCKIYTNDVLVKHAVIINGDKIEAVCPIESLPSEVVDLNGANLSPGFIDLQLNGCGGVMFNDETAE
NAGA_BACSU      LLIKDIAIVTENEVIKGYVGINDGKISTVSPKEPYSKEIQAPADSVLLPGMIDIHIHGGYGADTMDASFS
NAGA_ECOLI      ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
NAGA_ECO57      ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
NAGA_CAEEL      ----NCLVLRSGGLKKEHIWVRNGRIRTVFFEEKTMADVIDCEGLILSPGFIDLQLNGGFGIDSDDKEYE
NAGA_RAT        ----NCRILRGGTLLREDLWVRGGRIKLFFEERRVADEQRDCGGRILAPGFIDVQINGGFGVDFSRATED
NAGA_MOUSE      ----NCRILRGGTLLREDLWVRGGRIKLFFEERRVADEQRDCGGRILAPGFIDVQINGGFGVDFSKATED
NAGA_HUMAN      ----NCRILRGGKLLREDLWVRGGRIKLFFEERRVADERRDCGGRILAPGFIDVQINGGFGVDFSQATED
NAGA_DANRE      ----NCRILKNHKLQWEDLWVREGKI--LNPEKLFFDEQVDCENKIIAPGFIDVQLNGGYGIDFSQASSD
NAGA_BOVIN      ----NCRILRGGALLREDLWVRGGRIKLFFEERRVADEQRDCGGCILAPGFIDVQINGGFGVDFSQASED
NAGA_HAEIN      ----NCVIYTKYDVLRDFAVIINGEIEAVIPQAELETGIIDLQGNNLTAGFIDLQLNGCGGVMFNDQTVE
NAGA_VIBFU      ---------------------ENGTISAIESYDQRHADAIPLGPVDLMPGLIDSHVHGSQGCDVMDATHD
NAGA_DROME      ----NCRLVRDHRIIHDDLWVRDGRI--VNPRTKAHCR-IDCGGAIIAPGYIDLQINGGYGVDFSYDTEE
AGAA_ECOLI      ----------------------------------------------------------------------
ADEC_DESRM      LYIKNIQIVYTETIFSGSLVIKNGKIVAVNPGWEVEAEVFDGKGRFAVPGFMDAHIH-------IEPTLL
ADEC_CLOBM      ------NVCTREVIENTDVAISCGRIALVGDAKHCSTEVIDAKGQYIAPGFLDGHIH-------VESSML
ADEC_CLOB6      ------NVCTREVIENTDVAISCGRIALVGDAKHCSTEVIDAKGQYIAPGFLDGHIH-------VESSML
ADEC_CLOB1      ------NVCTREVIENTDVAISCGRIALVGDAKHCNTEVIDAKGQYIAPGFLDGHIH-------VESSML
ADEC_CLOBL      ------NVCTREVIENTDVAVSCGRIALVGDAKHCNTEVIDAKGQYIAPGFLDGHIH-------VESSML
ADEC_THEAB      VLIKNVNLVFTGKIEKTNIALYKKRIAGIGDDYKVGKEVIDAKGLFAIPGLIDAHVH-------IESSML
ADEC_CLOP1      LIIKNLNVYYFKKFIKGDILINKGKFLHIGKGYEDRLNVIDGEGKYIIPGLIDIHMH-------IESSMT
PYRC_CARHZ      MLIKNGNVVMVEKIRKMDVLIDKGIIVEISPENRSDVEVIDIEGKFLIPGLIDMHVH-------------
PYRC_STAAW      -LIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSVDIIDAKGHFVSPGFVDVHVHEPGGE-----YKE
PYRC_STAAS      -LIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSVDIIDAKGHFVSPGFVDVHVHEPGGE-----YKE
PYRC_STAAR      -LIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSIDIIDAKGHFVSPGFVDVHVHEPGGE-----YKE
PYRC_STAAN      -LIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSVDIIDAKGHFVSPGFVDVHVHEPGGE-----YKE
PYRC_STAAM      -LIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSVDIIDAKGHFVSPGFVDVHVHEPGGE-----YKE
PYRC_STAAC      -LIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSVDIIDAKGHFVSPGFVDVHVHEPGGE-----YKE
ADEC_LACS1      LVLKNAKIVFQAKILTGDIAISDGYIAGIGGSYQGVVEC-NYTGKYVAPGFIEAHIH-------IESSYV
ADEC_LISIN      LVIKNGRIVFSGEIMEGDIAIKNGYIAGIGHFPDAD-QIIDAAGEFISPGFIDAHVH-------VESAMV
ADEC_DESAA      LVLKNAQIVFSGEIQKGDVAVQGGKVAALDSR---DAKIVDLEGRFLTPGLIDAHVH-------IESSMV
ADEC_BACHD      LLIKNGQIVDVFQLEEGDVVIADGEIVAISDPGTYEAEEVDAKGAFIAPAFIDGHVH-------IESSMV
MTAD_THEON      ILIKNGYVVYGENLEKADVLIESNKIVEVNINKSADT-VIDAKGKVVSPGFVNLHTHSADDLPLMDWLQD
ADEC2_DESPS     LVIKNAKVVFNARVIQGDIAIVDGLIAGVGDYS-CKNE-LDAEGQYAAPGFIDSHIH-------IESSYV
PYRC_PEDPA      VLLKNARVIKSHQVQKTDVLVENDRITQIQPEINVEAEIIDVKNQLLMPGLVDIHVH---FRDPGQTDKE
ADEC_LACDA      LLVKNAHVVYLRKFEDVNITIKDGKFYWINPGIEA-AKVIDLQGKYVIPGFVDAHMH-------IDSSMT
PYRC_LACLA      LLIKNGRLVKSNRDEVLDILIENDKIVKIGLNLSVEAEIVDARGLVVAPGLIDVHVHFREPGQTHKETIH
PYRC_CLOCE      LLIKNGHVLDLDRVT--DILAVDGIIHEVGSKDEAGCEVIDATGLYVTPGLVDAHCH------LRDPGYE
PYRC_LACGA      -VIKNGTVYQNGRLIKADVLIEGKKIKAIGTDLDAE-KIIDAQGMLVSPGLVDVHVH-------------
HYDL_ARTAU      VIVKNCRLVSSDGITEADILVKDGKVAAIS-ADTSDVETIDAGGKFVMPGVVDEHVHNRYGRFELDSESA
ADEC_CLOPE      LIIKNLKVYYFKKFIKSDVLINEGKFLHIGKGYEDRLNIIDGEDKYIIPGLIDIHMH-------IESSMT
PYRC_BACP2      -LIKNGFILTSEKVQQ-DIRVEGEVIQAIGHLEREDGEVIDAKGLFVSPGLIDLHVHEPGGEKK-----E
ADEC_LISMO      LVIKNGRIVFSGEIMDGDIAIKNGYIAGIGSFPDAE-KIIDAAGAFIAPGFIDAHVH-------VESAMV
PYRC_ELUMP      -LIKNAHVIDANKIDGKDILIENGKIAAVENKEDNAAKIIDAKGLTAMPGFVDMHTHGQEGKETITGTKA
PYRC_CLOBA      LLIKNARIIDAIQDFKGDIYIKDGVINEIAKEINKDVEVLNCEEKILMPAFIDTHAHFRDPGLTWK---E
PYRC_AQUAE      LIVKNGYVIDPSQNLEGDILVENGKIKKIDKNILVEAEIIDAKGLIVCPGFIDIHVH-------------
HYDA_PSEPU      LLIRGATVVTHEESYPADVLCVDGLIRAIGPNLETDCEILDGSGQYLMPGGIDPHTH-------------
DPYS_SACKL      LIIKNGIICTASDIYAAEIAVNNGKVQLIAASIDLGSEVIDAEGAFITPGGIDAHVHVDEPLKLLGDVVD
ADEC_LISW6      LVIKNGRIVFSGEIMEGDIAIKNGYIAGIGDFSEAE-QIMDAAGEFIVPGFIDAHVH-------VESAMV
ADEC_LISMF      LVIKNGRIVFSGEIMDGDIAIKNGYIAGIGNFPDAE-KIIDAAGAFIAPGFIDAHVH-------VESAMV
PYRC_LACJO      -VIKNGTVYQNGHLIKADVLIDGQKIKAIGTDLEGE-EIIDASGMIVSPGLVDVHVH-------------
MTAD_CALS8      LLIKGATIITLDEVLKGDILIENGKISEISQSIELSKEVINAENLIALPGFINAHTH-------------
HUTI_THEVO      ----------LDFIENATIYIENGKIAKITREHSSDAGDLDAEGSIVIPGLVDSHTHIIGGNRSQEFYQR
ADEC_THEM4      LLIKNVKLVYTGNIEKTNIAILKKRIAGIGNEYNVGKEIFNAKNLYAIPGLIDAHVH-------IESSML
PYRC_MACCJ      -LLRGGKVLVNDELVSKDIRIEDGKIVEMGEKLNVNSEIIELDGKFVSQGFVDVHVHPGGEHK------E
MTAD_SYNWW      -------------IEKGYLLIEDVFIKELGPEGEFD-HIIDGENQVLLPGFINAHTHAATPEDIYWGTML
ADEC_CLOBA      -VVKNGKIVFTGDITRGDIAIVDGFIAGIGKYD--GEQIIDAQDKVIVPGFIDGHMH-------IESTML
PYRC_LISMO      ------------KLESKDVLIQNGKVNLIADSIEVTSEEFDATGKLITPGFIDVHVHPGGEHK------E
PYRC_CLOBB      LLIKNARIIDAIQDFKGDIYIKDGVINEIAQEIKKDVEVLNCEEKILMPAFIDTHAH---FRDPGLTCKE
PYRC_LACH4      -VIKNGTVYQNGRLIHADVLIEDQKIKAIGTDLTGD-KVIDATGKLVSPGLVDVHVH----YRDPGQTYK
PYRC_LACDB      -VIKNGTVYQNGRLIHADVLIEDQKIKAIGTDLTGD-KVIDATGKLVSPGLVDVHVH----YRDPGQTYK
PYRC_LACDA      -VIKNGTVYQNGRLIHADVLIEDQKIKAIGTDLTGD-KVIDATGKLVSPGLVDVHVH----YRDPGQTYK
MTAD_METMA      IIIKNAYVLTMDPIKKGTVVIEDGKITEIGVKKESADTVIDAKGSVVMPGLVNTHTHAA---MTLFRGYA
PYRC_GEOMG      -----------------DILVENGAVKELGKKAPSGTETIDASGLIVTPGLIDMHVHRDPGHEYK----E
ALLB_BACLD      -IIKNGLVILENGEQEVEVGIKDGKIAAIGQDLGTSAKIIDAKGSIVSPGMIDAHVHGGGYRD----EWE
IADA_ECOLI      -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTR
PYRC_DESRM      -----------DTLTCTDILVEEGMIKEIGQLSDSEAEVIAAEGNYVCPGFMDMHVH-------------
MTAD_THESM      ILIKNGYVIYGDKIIKADIYIENNKISKIGKDLTKSADVIDAKGRVISPGFINAHTH-------------
MTAD_PYRFU      MIIKNGMIIYGDEIVRSDVLIEDGVIKEVGKNIRAPADVIDASSHLVIPGLINAHTHVS--MVLLRGLAE
HYDA_BACST      -LIKNGTIVTATDIYEADLLIQDGKIAVIGRNDESGAEVIDATGCYVFPGGIDPHTH-------------
ADEC_PETMO      LVFKNGKIVFNEKVIEEDLAISNGVIIGFGKYE--GKEEVDLEGKFISPGFIDAHLH-------LESAMV
ADEC_CLOBB      -VVKNGKIVFTGDIMRGDIAIVDGFIAGIGQYE--GEQIIYAQNKVIVPGFIDGHMH-------IESTML
PYRC_METAC      --IKNTRIYYNNSLRPAEILIENGKITKIGKRVSSSDMVIDAEGALTLPAGIDVHVH-------------
PYRC_GEOSW      -------------IERTELKIENGFITAIGSKEEAD-EVIDVQGKLISAGFIDLHVH-------------
PYRC_CORGL      ------NVLVYGEGEPTNVFVKDGVIAAIGGTHEAD-RTIDGNGGVLLPGFVDMHVHEPGREDT-----E
MTAD_METAC      IIIKNAYVLTMDPLKNGTVVIEDGKITEINTKENADT-VIDAKGSVVMPGLANTHTHAA---MTLFRGYA
HYDA_PSEAE      LLIRGATVVTHEESYRADVLCANGLIQAINLETPSGCDVLDGGGQYLMPGGIDPHTH-------------
HUTI_GEOKA      -------------IENGSVWIENGTIVAVGPDDEAEAEVIDAKGKTVTPGLIDPHTH-------------
ADEC_LYSSC      -ILKNAQVVYTLTWRKADIVVKNGTIVALDHSNRFHAEVEDAAGSYVIPGLIDGHIH-------IESSML
ADEC_KOSOT      LLLKNARIVFSGEIERANIAIFRKRIAGIGDYSEGK-QVIDLHGAYVVPGLIDAHLH-------IESSMV
PYRC_LACS1      -LIKNGNLYQAGRIYQADVLIEDGKIKAIGKNVKENLVEIDATNKLVAPGLVDVHVH-------------
PYRC_BACHD      -LIKNGSIVTKETVKTQDVLLHDGVISAIGLNEETDAHVIEANGKLVTPGLVDLHVHEPGGE-----AKE
MTAD_HALOH      ILIKNVDVIYTADIKNGYIIIQDNKIKEINDMDNLVYQVISGKGKMALPGLVNAHTHSA-----------
PYRC_LISW6      ------------ELENKDVLIQNGKVNLIADSIEVTSEEFDATGKLIAPGFIDVHVHPGGEHK------E
PYRC_LISIN      ------------ELENKDVLIQNGKVNLIADSIEVTSEEFDATGKLIAPGFIDVHVHPGGEHK------E
PHYDA_ECOUT     VLIKNGIVVNADGQAKQDLLIESGIVRQLGTSPQLPCEEIDASGCYVFPGGVDVHTH-------------
PHYDA_ECOL6     VLIKNGIVVNADGQAKQDLLIESGIVRQLGTSPQLPCEEIDASGCYVFPGGVDVHTH-------------
PHYDA_ECOL5     VLIKNGIVVNADGQAKQDLLIESGIVRQLGTSPQLPCEEIDASGCYVFPGGVDVHTH-------------
PHYDA_ECOK1     VLIKNGIVVNADGQAKQDLLIESGIVRQLGTSPQLPCEEIDASGCYVFPGGVDVHTH-------------
PHYDA_ECO81     VLIKNGIVVNADGQAKQDLLIESGIVRQLGTSPQLPCEEIDASGCYVFPGGVDVHTH-------------
PHYDA_ECO45     VLIKNGIVVNADGQAKQDLLIESGIVRQLGTSPQLPCEEIDASGCYVFPGGVDVHTH-------------
PHYDA_ECO27     VLIKNGIVVNADGQAKQDLLIESGIVRQLGTSPQLPCEEIDASGCYVFPGGVDVHTH-------------
DPYS_DICDI      ILIKNGTVVNDDRYFKSDVLVENGIIKEISPKE--GIKVVDATDKLLLPGGIDTHTH-------------
ALLB_SALCH      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLEEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_BACA2      VIVKGAKAVRKGGTERADIAVKDGKIALIGPGIDENAEVVQADGMYVFPGAVDCHVH---FNEPGREEWE
Y3012_BACCR     ILLKNATYLYMREWMTANIWIYNDRIVYVGPEQLTECEVVDCEGKYVVPGYIEPHAH----------PYQ
PYRC_LYSSC      ------------ELQTVNIAMADGKITAIGQEVTVNAEVIEGNGLIVAPGFVDVHTH-------------
MTAD_PYRKO      ILIKNGHVIYGENLDRADVLIESNRIVSVNINEAADT-VIDATGRVVSPGFINLHTHSPMG---------
ALLB_BACSU      MVIKGAKAVTPDGVIEADIVVQNGVIAEIGSDIEASTEIIQADGKYVFPGVIDCHVHEPGRED-----WE
ADEC_MOOTA      --------VFTGEILPWDIAIKNGRIASVGDVSAAETEVIDASGYYLCPGFMDGHVH-------VESSMV
ADEC_METJA      IVFKNTKIVYTGEVVKGNVAVERDKISFVDLNXXXXXXXXXXKGKYLSPTFIDGHIHIESSH-LIPSEFE
ADEC_CLOAB      LVLKNCNIVFSSEIIRGDLAIDGDTIIGIG-KYKGKTE-IDLSNKYVAPGFIDSHVH-------IESSMV
PYRC_LISMF      ------------ELENKDVLIQNGKVNLIADSIEVTSEEFDATGKLIAPGFIDVHVHPGGEHK------E
PYRC_LISMC      ------------ELENKDVLIQNGKVNLIADSIEVTSEEFDATGKLIAPGFIDVHVHPGGEHK------E
ADEC_METST      MLIKNILNVFTDEIYPGEIKIEHGIIESI---KEVNADFND----IIVPGFIDAHIH-------IESSML
ADEC_METS3      --------VITDSIYPARISVEGGFFKEIVPIVINDDSELDISGIIL-PGFIDSHIH-------IESTML
ADEC_METBU      -------MLYRDIAVKEGYIVGIGDVSSLKGDET---EMIDVTGKHLCPGLMDGHVH-------FESSMV
PYRC_THETN      --------------EKADILINYGIIKGIDKNDVSDAIVIDAEGKYVLPGFVDMHTH-------------
PYRC_GEOUR      -----------------DLLVEDGRIKEIGKKAPAGAEIIDAAGLLVTPGLIDMHVH-------------
ALLB_ECOSE      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECOLU      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECOLI      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECOLC      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECOHS      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECODH      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECOBW      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECO8A      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECO55      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ALLB_ECO24      LIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
ADEC_LACPL      --------VYTREFEATSLWIDHGRIIS-NLRDEIAAQHVDATGQWIVPGMIDAHVH-------MESSMV
ADEC_GEOKA      LVIQNGKIVFTREIIEGDLAIVEGMIVGIGRYE--GEKTIDAEGRYICPGLIDGHVH-------IESSMV
ADEC_BACSU      ------------KRQKADIVIKNGKIMDVYNQEEYEGEIIDAEGQMIVPGFIDGHVH-------IESSMV
ADEC1_LACSS     LIIKNGQLVNVAEIYPAEVAIYQGKIVAVDPDQGTETRVIDAKQQYIVPGLIDGHIH-------VECSKL
UNC33_CAEEL     LLVKNAQIVNDDAIFVADILIEDGIIQNVAPNLEAGAEVLDAAGKLALPAGIDVYT------QVTDSSVD
PYRC_LACPL      -LIKNAQVWQAGQLQTTDILIAEGRIKAIGHQLHDQFHVICADQHFVSPGFVDVHVH-------------
ALLB_ENTFA      LVIKNGLVI----LETGEVIVQGGKIVAIGQDLSGE-RVIDATGLVVSPGMVDAHVHGGGYRDEWEGYVT
ALLB_ECOSM      LIIKNGTVILENEARVVDVAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTH-------------
PYRC_LISMH      ------------ELENKDVLIQNGKVNLIADSIEVTSEEFDATGKLIAPGFIDVHVH-------------
PYRC_FUSNN      MLLKNCKILKNTKFEKVDILIRDNKIKXXXXXXXXXXXXXXXKNRFVTAGFIDVHVH-------------
PYRC_CLOAB      ----------------------------------------------------------------------
PHYDA_SHIBS     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECOSE     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECOLI     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECOLC     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECOHS     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECODH     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECOBW     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECO8A     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECO7I     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECO57     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECO55     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
PHYDA_ECO24     VLIKNGTVVNADGQAKQDLLIESGIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
MTAD1_ARCFU     ILIKNAKILTPKGIVEGNLKVEGKKISEIGGKAVKSDVVIDGSRKAVIPGFFNTHTHAA-----------
DHP2_CAEBR      LLIKNGTIVNDDAMFKSDVLVHDGKIVEIAPSIDPGLEVVDATDRFVIPGGIDPHTH-------------
ALLB_ECOUT      LIIKNGTVILENEARVVDIAVKDGKIAAIGQDLGDAKDVMDASGLVVSPGMVDAHTH-------------
ALLB_ECOL6      LIIKNGTVILENEARVVDIAVKDGKIAAIGQDLGDAKDVMDASGLVVSPGMVDAHTH-------------
ALLB_ECOL5      LIIKNGTVILENEARVVDIAVKDGKIAAIGQDLGDAKDVMDASGLVVSPGMVDAHTH-------------
ALLB_ECOK1      LIIKNGTVILENEARVVDIAVKDGKIAAIGQDLGDAKDVMDASGLVVSPGMVDAHTH-------------
ALLB_ECO81      LIIKNGTVILENEARVVDIAVKDGKIAAIGQDLGDAKDVMDASGLVVSPGMVDAHTH-------------
ALLB_ECO45      LIIKNGTVILENEARVVDIAVKDGKIAAIGQDLGDAKDVMDASGLVVSPGMVDAHTH-------------
ALLB_ECO27      LIIKNGTVILENEARVVDIAVKDGKIAAIGQDLGDAKDVMDASGLVVSPGMVDAHTH-------------
ALLB_DESHY      LILRNGNVVCPDGVRKADIAVSDGKIVLIAEEIPGDAEVIDAAGKHVFPGITDGHVH-------------
ALLB_DESHD      LILRNGNVVCPDGVRKADIAVSDGKIVLIAEEIPGDAEIIDAAGKHIFPGITDGHVH-------------
ADEC_SILST      ------NVHTREVLEGHDIAIKAGRIAYVGPDASYETEVIDAEGRYMMPGLCDGHMHIESGMLTP-----
ADEC_DEHSC      --------VFNAEIEQANVAVFDGKIAGVGDYRHGK-EVIDLKGAYLLPGLINGHTH-------VESSML
PYRC_GEOLS      -----------------DVVVENGLVKEIGKATSAGAETIDASGKYVVPGLIDMHVH---LRDPGLEYKE
PYRC_BACSU      -------------IKNGWILNENGEITAIGKLDATDNEVIDAKGLLVSPGFVDLHVHEPGGEKK-----E
PYRC_BACCR      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVHPGGEHK------E
PYRC_BACC4      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVHPGGEHK------E
PYRC_METJA      MLLKNCRIIKDNKIIEGDILIENGRXXXXXXXXXXXXXXXXXXNSLVIPGVIDAHVHFRWGEDFLSGSLA
PYRC_GEOSF      -----------------DLLVVAGRIKELGKKAPADAEVIDAAGLLVTPGLIDMHVH-------------
PYRC_BACLD      -----------EKVQR-DIRVEGDAISEIGSLEAASGEVIDADGLFVSPGLVDLHVHEPGGEKK-----E
HUTI_GEOSW      -------------IENGSVWVEDGKIAAVGTDEEAEAEIVDATGKTVTPGLVDPHTH-------------
ALLB_SALTY      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALTI      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALPK      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALPB      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALPA      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALNS      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALHS      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALEP      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALDC      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ALLB_SALA4      LIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTH-------------
ADEC_DESHD      LVLKNAQVVFSEEILVRDVAVEDGVIVGVGQYQ--GREEVDLSGKYLCPGFIDAHLH-------LESTLV
PYRC_METMA      --IKNTRIYYNNSLQPAEIIIEHGKITKIGKRVSSSDMVIDAKGSLTLPAGIDVHVH-------------
MTAD_METBU      ----------------------------------------------------------------------
HUTI_CHRVO      -------------LEGHALLLRDGHIEAVLPQAEADAAAFDGEGRWVTPGFVDCHTH-------------
DHP1_CAEEL      LVIKNGTVVNEDGMFKADVLVRNGIIVEVSPNITADTEVIDATDRLVIPGGIDPHTH-------------
ADEC_BACP2      LVIKHAKVVFNQEWIDADVAVENGQIVGIGEYE--GEQELDAVGQMLVPGFIDGHVH-------IESSMV
PYRC_STRP8      ILIKNGRVMKSQRDQVADVLIDGKQIVKIASAIECEAQVIDASGLIVAPGLVDIHVH-------------
PYRC_STRP6      ILIKNGRVMKSQRDQVADVLIDGKQIVKIASAIECEAQVIDASGLIVAPGLVDIHVH-------------
PYRC_STRP3      ILIKNGRVMKSQRDQVADVLIDGKQIVKIASAIECEAQVIDASGLIVAPGLVDIHVH-------------
PYRC_STRP1      ILIKNGRVMKSQRDQVADVLIDGKQIVKIASAIECEAQVIDASGLIVAPGLVDIHVH-------------
PYRC_BACC3      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVHPGGEHK------E
PYRC_ANOFW      -----------------DIKVAGGRIVQIDLHAEADDEVIDVDGQFVAPGFVDVHVH-------------
PYRC_ANATD      ILIKNAQIVNSNKLEKADILIVDDKIEKIGKNIEENPDIIDTSGKYVMPSFTDIHCH-------------
HYDA_BURPI      IIIKNGTIVTADGISRADLGIKDGKITALGPAER----TIDAAGRYVFPGGIDVHTH-------------
DHP1_CAEBR      LVIKNGTVVNEDGMFKADVLVKNGIIVEVSPKIIAEMEIIDATDRLVIPGGIDPHTH-------------
ALLB_BACHD      LIIRSSTVVTETTTYRADVAIRNGIVSAITEPGSIDGPAIDGTGLHLFPGMVDVHVH-------------
ADEC_OCEIH      LVIKNAEVVFTGDWKKTDVAIADGYIAGLGNYE--GLQTVDATGKKIVPGLINGHIH-------IESTML
ADEC_BACLD      -VIKNGKIVFNQEWLETDIAITDGAIVGLGEYEGGN--IIDAEGQMIVPGFIDGHVH-------IESSMV
ADEC_BACA2      --------------QKADTVIKNGKIMDVFNQEWISAEVIDAEGQMIVPGFIDGHVH-------IESSMV
PYRC_THEAQ      ILIRNVRLV--DAMERGDVLIGEGRILSLEGGEAK--QVVDGTGCFLAPGFLDLHAH-------------
PYRC_SULSY      ------------------------------------CEVIDAEGKIITPSFTDIHVHFRDPGQTYK---E
PYRC_ENTFA      -LIKNGKIIKKEQLIEAALWLENGVIHAIGESDEADFEVFDANGQLITPGLVDVHVH-------------
MTAD_DICT6      ILIEDVNILIDDKIENKNILIENDIIKQISDSKSFERYIIDGKNKIALPGLVNTHTH-------------
HUTI_GEOTN      ----------LQIIENGSVWIERGVIIAVGPDDELEADVIDARGKTVTPGLIDPHTH-------------
ALLB_BACSK      LCITGGRVVLPSGVEETDVGIQAGKIARIGPKKEARC-IMNANGQYVFPGAVDTHVHSEPGRTEWEGFFT
ADEC_FLAPJ      ------------RIYSGEITIQNGKIISIIEKNH---EVKN----YILPGFIDAHIH-------IESSML
ADEC1_DESPS     --------VMSNEVYLADVAIYEERIVAIGKVEEYETEVIDVTGLYLLPGLIDGHLHS-------ECSKL
PYRC_LACAC      -VIKNGTVYQNGRLIHADVLIEDQKIKVIGTNLTGDKE-FDATGKLVAPGLVDVHVH-------------
PYRC_BACWK      -----------------DLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVHPGGEHK------E
PYRC_BACHK      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACCZ      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACCQ      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACC7      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACC1      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACC0      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACAN      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACAH      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACAC      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PYRC_BACAA      ------------KIVATDLLVQDGKIAKVAENITADAEVIDVNGKLIAPGLVDVHVH-------------
PHYDA_ECOLU     VLIKNGTVVNADGQAKQDLLIESAIVRQLNISPQLPYEEIDATGCYVFPGGVDVHTH-------------
MTAD1_SYNAS     ----------------------------------------------------------------------
HYDA_RHIRD      IIIKNGTIVTADGISPADLGIKDGKIAQIGGTFGPAGRTIDASGRYVFPGGIDVHTH-------------
ADEC_DEHSB      --------VFNAEIEQTNVAVFDGKIAGVGDYRHGK-EVIDLKGAYLLPGLINGHTH-------VESSML
ADEC2_LACSS     -IIKNAKIVYNARIIEGTLAIADSRFLGIDAAYTAD-NVINAHGQYVVPGLIDPHIH-------IESANV
ADEC2_BACSK     -LVKNVRVAYTQQFIASDVAIDEGRFVAIGHSDELESTIIDGQGQQMIPGLIDIHLH-------------
URE1_PSESM      -LITNALIIDHWGIVKADVGIKNGRIAAINPDIQPDVEVIAGEGMILTAGGVDTHIH-------------
URE1_PSE14      -LITNALIIDHWGIVKADVGIKNGRIAAINPDIQPDVEVIAGEGMILTAGGVDTHIH-------------
URE12_PSEU2     -LITNALIIDHWGIVKADVGIKNGRIAAINPDIQPDVEVIAGEGMILTAGGVDTHIH-------------
PYRC_THEPX      MIIKNGTVIDFGSEATADILIDYGIIKAIDKNQVSDGIVIDATGKYVLPGFVDMHTH-------------
PYRC_THEP3      MIIKNGTVIDFGSEATADILIDYGIIKAIDKNQVSDGIVIDATGKYVLPGFVDMHTH-------------
PYRC_STRPN      LLIKNGRVMDLDQV--CDVLVQDGKIKIASEITEEGAETIDATGLVVAPGLVDIHVH-------------
PYRC_BACC2      ------------KIVATDLLVQDGKIAKVAENITADAEVIEVNGNLIAPGLVDVHVHPGGEHK------E
ADEC4_RHIME     --------VVSEEIYQADVAIYRDRIIAVGDISEYQTEIIDAADRYLTPGMIDGHLHV------------
ADEC2_CARHZ     ----------------------------------------------------------------------
PYRC_STRR6      LLIKNGRVMDLDQV--CDVLVQDGKIIKIAPETEEGAETIDATGHVVAPGLVDIHVH-------------
PYRC_STAES      -------------------------------------EVIDAKGNLIAPGFVDVHVHPGGEHK------E
PYRC_STAEQ      -------------------------------------EVIDAKGNLIAPGFVDVHVHPGGEHK------E
PYRC_PELCD      --------------EKFDVLIEDNRIAQVGTDQTADAEKIDAAGCLVVPGLIDIHVH-------------
MTAD_THEMA      ----------------------------------------------------------------------
HUTI_SHELP      ----------------------------------------------------------------------
HUTI_BACWK      ----------LPVIENGAVGIENGVVTFVGTAEEAKGEVIDCDGKMVSPGLVDPHTH-------------
ADEC_STAMF      IVISNVNLVLTEILDNASIIISGKRIAGAGKYSELNTLVIDGENNYAMPGFIDPHIH-------IESSLL
ADEC_METBF      ---------------KGEIAVEHGKIISIEEKEH-DIE------QYILPGLVDAHVH-------IESSMT
ADEC_DESHY      LVLKNAQVVFSEEILVRDVAVGDGMIVGVGQYQ--GREEVDLSGKYLCPGFIDAHLH-------LESTLV
PYRC_GEOKA      ------------ELMRTHIKIEHGTIAAIQPLEANEEDVIDVGGRLIVPGLIDLHVHEPGGE-----AKE
PYRC_BACCN      -----------------DLLVQDGKIAKIAKNISAEAEVIDVNGKLIAPGLVDVHVHPGGEHK------E
MTAD_METBF      IIVKNAYVMTMDPLKNGTVVIEDGKITEIGEKSESADTVIDAKHSVVMPGLVNTHTHAA-----------
HUTI_BACCR      ----------LPVIENGVVGIENGVITFVGTAEEAKGEVIDSGGKMVSPGLVDPHTH-------------
DHP2_CAEEL      LLIKNGTIVNDDAIFKSDVLVLDGRIVEIAPQPTPGLEVVDATDRLVIPGGIDPHTH-------------
ADEC_META3      -----------------------------NTRSEAPVKIIDLKGKFVCPTFIDAHIHIESSHITPSGVSK
ADEC_CLOD6      IVLKNGTIVFTEELITGDVAIVGDTIVGIGDYKEIDCS-----NKYISPGFIDAHMH-------IESTMV
URE1_SULTO      -------------------------------------EIISGEGLIATPGFIDTHIHWVAPQQVFD----
URE1_CYTH3      LLITNALIIDYTGIYKADIGIKNGHIKAIGPGVHPDMEVIAGEGMIITAGGIDNHIH-------------
PYRC_STRT2      LLIKNGRVVDLDT--QADVLVDGKKVVKIAENIDADAQVIDATGLVVAPGLVDIHVH-------------
PYRC_STRT1      LLIKNGRVVDLDT--QADVLVDGKKVVKIAENIDADAQVIDATGLVVAPGLVDIHVH-------------
ADEC_SERP5      ----------------------------------------------------------------------
Y3032_BACAN     -LLKNATYLYIREWMQANIWIYDDRIIYVGPEQLHECEVIDCDGKYVVPSYIEPHAH----------PYQ
PYRC_SOLUE      -----------------DVFIVDGRIAGVAPNSSPKAEVFDATGMIVAPGFIDMHVH-------------
PYRC_PYRAB      --------LYNGRIIDGSIGVKDGKITKFSLREKGDNKIKVEKGKIILPGLIDVHVHLRDFNETHK---E
PYRC_PELTS      LLIKGGTVVVAGKIEEKDVFIVDGKIRAGAHVNTAGAEVLDASGKLVVPGLIDMHVH-------------
PYRC_METTH      --LENCRV---DRDLTVNIGVDDGKIVQISRGRIDASEKIDLKGYFVLPGLIDAHVH-------------
PYRC_LACLE      ILLKNGLVYQEGEFIKEDVLISGSKIQAIGPEE--GAEVYDLKGKLLAPGLVDIHEH-------------
MTAD_DESRM      ----------------------------------------------------------------------
MTAD_CLOTE      ILIENVMIVTMDEIKEGYILIKEDKIKEVNNKE--NLYIINGEGRCAIPGLVNAHTH-------------
MTAD_BACC3      ----NATIVTMNEIENGYIIVENDKIIDVNSGEEVD-EVIDMKGKWVLPGLVNTHTH-------------
MTAD_BACC0      ----NATIVTMNEIENGYIIVENDKIIDVNSGEEVD-EVIDMKGKWVLPGLVNTHTH-------------
MTAD_BACAN      ----NATIVTMNEIENGYIIVENDKIIDVNSGEEVD-EVIDMKGKWVLPGLVNTHTH-------------
MTAD_BACAH      ----NATIVTMNEIENGYIIVENDKIIDVNSGEEVD-EVIDMKGKWVLPGLVNTHTH-------------
MTAD_BACAC      ----NATIVTMNEIENGYIIVENDKIIDVNSGEEVD-EVIDMKGKWVLPGLVNTHTH-------------
MTAD_BACAA      ----NATIVTMNEIENGYIIVENDKIIDVNSGEEVD-EVIDMKGKWVLPGLVNTHTH-------------
HUTI_BACHK      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACCQ      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACC7      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACC4      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACC3      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACC1      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACC0      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACAN      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACAH      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACAC      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
HUTI_BACAA      ----------LPVIENGAVGIENGVITFVGTAEEAKGEVIDCGGKMVSPGLVDPHTH-------------
ADEC_LEUCK      --------------ETSELWIDHDKIVYRGRRSDLQAQTFDAQGQYIVPGLIDAHMH-------IESSLL
ADEC1_OENOB     --------VFNQRFEDTELWIDNGSIYFRGKSKDLTAKNFNAEGNYIVPGLIDAHLH-------IESSLL
Y1085_PICTO     --------IYTKRISSGNIAIASGRIAYIGPLKNNDTRIIKNDFL-IAPGYIEGHAH----------PFQ
URE1_STACT      -VITNAVIIDYDKVYKADLGIKNGYIKAGNPDIMDDVDIISGEGKIVTAGGIDTHVH-------------
HUTI_HALMA      ----------LETYEDGAVAIVDGTVAAVGPTTEVTAEAVDADGQAVIPGFVDPHTHALFAGDRSD----
HUTI_BACCZ      ----------LPVIENGAVGIENGVITFVGTVEEAKGEVIDCGGKMVSPGLVDPHTH-------------
ADEC_RHILO      -------------------------------------KVVDAGGRYLVPGLCDAHMHVESGMVT------
ADEC_METKA      -------------IRTGYVIWDGGRLLGVTRNEPEHADVIDVDGI-ICPGFVDAHVH-------VESSGL
ADEC_ENTFA      -----------------NVAIKNDKFYYIYEEENVNLQTINAENQWMIPGLIDAHMH-------IESSMT
URE1_PSEF5      -LITNALIIDHWGIVKADVGLKDGRIAAINPDIQPDVEVIAGEGMILTAGGIDTHIH-------------
URE1_BURVG      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
URE1_BURS3      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
URE1_BURM1      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
URE1_BURCM      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
URE1_BURCJ      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
URE1_BURCH      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
URE1_BURCC      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
URE1_BURCA      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
URE1_BURA4      ------NAVILDHIVKADIAIKHGRIAAIGKAGNPDIEVIAGEGLIVTAGGIDTHIH-------------
PYRC_PYRFU      ---------------EGYIGIEDGKISKISLREKGDHKIKVDKGKVILPGLIDVHVH---LRDFEESYKE
PYRC_MYCTU      --------------ERVDVLVDDGQIAQIGPDLAIPADVIDATGHVLLPGFVDLHTH-------------
PYRC_MYCBO      --------------ERVDVLVDDGQIAQIGPDLAIPADVIDATGHVLLPGFVDLHTH-------------
PYRC_LACSS      -LIQNGQLLIDDQLVKRDIAIEKGRITAIEPTDEPTETIFDAQGALVSAGLIDGHVH-------------
PYRC_BACCL      ------------ELMRTHIKIEHGTIAAILYEQEANEDVIDVGGRLIVPGLIDLHVHEPGGE-----AKE
HUTI_IDILO      -------------IQDATVIINKGKIEFVGAAFDAPAEVIDGNGGLLTPGLIDCHTH-------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_ESCF3      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSM      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLU      ----------------------------------------------------------------------
ADEC_ECOLI      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECOHS      ----------------------------------------------------------------------
ADEC_ECODH      ----------------------------------------------------------------------
ADEC_ECOBW      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO5E      ----------------------------------------------------------------------
ADEC_ECO57      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_BDEBA      ----------------------------------------------------------------------
PYRC_GEOTN      ------------QLVRTHIKIEHGNIAAIHHEQLFEADVIDVGGKLIAPGLIDVHVH-------------
PYRC_CLOD6      ILIKNGRVIKSQRDENIDLIIKENKIYKIGKFDESDEKIIDASGNVVAPGLVDVHVH-------------
NDDD_ALCXX      ---------------QGDLAVRGGRIVALGDFAHAPVPVIDARGLALAPGFIDSHTHDDG----------
MTAD_MOOTA      ----------------------------------------------------------------------
MTAD_METS3      ---------------KGSLLIKNDKIAEIGTDESNVDKVIDAKGKILLPGFVNTHTH-------------
MTAD_DICTD      ----------------------------------------------------------------------
HUTI_THEP3      ----------IEEIEDAYIAIKDGKILAASPAAISAKEKIDAKGMIAIPGFVDPHTH-------------
HUTI_PARDP      -LLHHAQLVTMDEIEQGALVIEAGRISWIGPETDLPAQYADATGRLVTPGLIDCHTHIVFGGD-------
HUTI_BREBN      ----------LSIIEDGSIWLEDGVIQRVGTDEDLEAQIIDASGKLVTPGLIDPHTH-------------
DPYS_MOUSE      LLIRGGRIVNDDFSQVADVLVEDGVVRALGPPEDASLRILDAAGKLVLPGGIDTHTHPFMGSQSVDDFYQ
ADEC_PARDP      -----------------DVAVADGRVAYVGPDAGPSVQVIEADGRFMVPGLIDAHMHVESGMLTPAG---
ADEC1_JANSC     LVIRGAKVVLVEVMDGWDVAIKHGRFAYVGPDSHCDTQVEELSGHYLIPGLCDGHMHIESGMLTP-----


                         .         .         *         .         .         .         .:140
query           AINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPD
NAGA_BACSH      GLHIHGPITIKEGTTSFLATTMTQSFDWFDRAQRQCGNNFSPKSDEAEVLGLHIEGPFVSKQRAGAQPLD
NAGA_VIBCH      TIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQS--LGLHLEGPYLNVMKKGIHSVD
NAGA_BACSU      TLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREWKXXXXXXXXXXXXHLEGPFVSPKRAGAQPKE
NAGA_ECOLI      TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVKKGTHNPN
NAGA_ECO57      TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVKKGTHNPN
NAGA_CAEEL      GLALVAKQLLAHGVTSFSPTVITSSPETYHKILPLL-KPSNASSEGAGNLGAHLEGPFISADKRGCHPEQ
NAGA_RAT        VGSGVALVLLSHGVTSFCPTLVTSPPEVYHKVLPQI-PVKSGGPHGAGVLGVHLEGPFISREKRGAHPEA
NAGA_MOUSE      VGSGVALVLLSHGVTSFCPTLVTSPPEVYHKVLPQI-PVKSGGPHGAGVLGVHLEGPFISREKRGAHPEA
NAGA_HUMAN      VGSGVALVILSHGVTSFCPTLVTSPPEVYHKVVPQI-PVKSGGPHGAGVLGLHLEGPFISREKRGAHPEA
NAGA_DANRE      GVALVAKKILEHGVTSFCPTLVTSPPHIYHKVIPEL-RVQDGGPEGAGVLGIHLEGPFISEEKRGAHPPK
NAGA_BOVIN      VGSGVALVILSHGVTSFCPTLVTSPLEVYHKVLPQI-PVKSGGPHGAGVLGVHLEGPFISREKRGAHPEA
NAGA_HAEIN      TLEIMQETNLKSGCTSFLPTFITAPDENIKSAVKIMREYLNKHKNQA--LGLHIEGPYLSIEKKGVHRPE
NAGA_VIBFU      SLNTMSRYFXXXXXXXXXXXXXXXXXXKIRAALAQVAKSKHDGVDGAEILGAYLEGPYFTEKNKGAHPTQ
NAGA_DROME      GVATVARGLVKSGVTSFCPTLVTSPSDSYHTILPRI---PAEVPKGAGILGIHAEGPFINPQKKGAQTID
AGAA_ECOLI      ----------------------------------------------------------------------
ADEC_DESRM      SPEALASVIVPWGTTTLFADPMEIANVAGLKGVEAL----------------------------------
ADEC_CLOBM      SVSEYARSVVPHGTVG-----IYMDPHEICNVL-GLNGVRYMIEDGK---GTPLKNMVTTPSCVPA----
ADEC_CLOB6      SVSEYARSVVPHGTVG-----IYMDPHEICNVL-GLNGVRYMIEDGK---GTPLKNMVTTPSCVPA----
ADEC_CLOB1      SVSEYARSVVPHGTVG-----IYMDPHEICNVL-GLNGVRYMIEDGK---GTPLKNMVTTPSCVPA----
ADEC_CLOBL      SVSEYARSVVPHGTVG-----IYMDPHEICNVL-GLNGVRYMIEDGK---GTPLKNMVTTPSCVPA----
ADEC_THEAB      SPTEFAKLILPFGTTTIIADPHEIANVLGVEGIEYMIKS-TEG---------------------------
ADEC_CLOP1      IPREFSKAAIKHGVTTVVADPHEIANVFGIRGIEEFIKFK------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_STAAW      TIETGTKAAARGGFTTVCPMPNTRPVPDSVEHFEALQK--------------------------------
PYRC_STAAS      TIETGTKAAARGGFTTVCPMPNTRPVPDSVEHFEALQK--------------------------------
PYRC_STAAR      TIETGTKAAARGGFTTVCPMPNTRPVPDSVEHFEALQK--------------------------------
PYRC_STAAN      TIETGTKAAARGGFTTVCPMPNTRPVPDSVEHFEALQK--------------------------------
PYRC_STAAM      TIETGTKAAARGGFTTVCPMPNTRPVPDSVEHFEALQK--------------------------------
PYRC_STAAC      TIETGTKAAARGGFTTVCPMPNTRPVPDSVEHFEALQK--------------------------------
ADEC_LACS1      SPEEFSRVFIPRGTTTIL-----------ADPHEIVNVAGLKGLD-----------YMVNAAKNAKMDIR
ADEC_LISIN      TPSEFARVLLPNGVTTIITDPHEIA---------------------------------------------
ADEC_DESAA      SPYQYARTVILHGTTAVIADPHEIA---------------------------------------------
ADEC_BACHD      APEQFAKVVVPHGVTTVIADPHEIA---------------------------------------------
MTAD_THEON      HIREYTKVMIKSGTTTFL---------DMYFFMDAVAEVTLE---------SGLRG-YLSYGMIDLGDPE
ADEC2_DESPS     SPEELGRLLVPHGTTTIIADPHEIANVCGLKGLDMIEAAKRTALDGANIDAREMEKPITYDEVLG-----
PYRC_PEDPA      DVVSGSAAAVKGGFTTVLTMPNVDPVPDTPEKMTAMVK--------------------------------
ADEC_LACDA      TPKVMGQTIGKYGTTTII----------------------------------------------------
PYRC_LACLA      AAGGFTRVVMMANTKPILSTPKVLTETLEIADKEDI-KIDAVGSITQDFDGEHLTDELIKAGAIGFS--D
PYRC_CLOCE      YKEDITRSAAKGGFTSVMPNTNPVLDNEAMVKY-VINKAKTDGFLNVFPIGALSKG--------------
PYRC_LACGA      ----------------------------------------------------------------------
HYDL_ARTAU      AVGGITTII--EMPITFPPTT-------------------------------------------------
ADEC_CLOPE      IPREFSKAAIKHGVTTVVADPHEIANVFGVRGIEEFIKFK------------------------------
PYRC_BACP2      TIETGSKAAARGGYTTIAAMPNTRPVPDTKEQMEWLMN-RIEETSSVRVL------PYITTRQIGEEMTD
ADEC_LISMO      TPAEFARVLLPNGVTTIVTDPHEIA---------------------------------------------
PYRC_ELUMP      AL--------------------------------------------------------------------
PYRC_CLOBA      DLESGSKAALKGGYTG---VCLMANTKPICSSKEVVQYVRTQNFDGLNEFKDDNKVKAISDDGVGVSNSN
PYRC_AQUAE      ----------------------------------------------------------------------
HYDA_PSEPU      ----------------------------------------------------------------------
DPYS_SACKL      TMEHATRSAVAGGTT----TVVAFSTQDVSK---------------------------------------
ADEC_LISW6      TPAEFARVLLPNGVTTIVTDPHEIA---------------------------------------------
ADEC_LISMF      TPAEFARVLLPNGVTTIVTDPHEIA---------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
MTAD_CALS8      ----------------------------------------------------------------------
HUTI_THEVO      ASGYTYSEILRSGNKTVRDTANSSADEIFTQSMKRIADAVSHGT--------------------------
ADEC_THEM4      SPIEFAKMILPNGTTTIIADPHEIA---------------------------------------------
PYRC_MACCJ      TIESGTRAAARGGFTTVCPMPNTRPVPDSVEHIEALNQS-------------------------------
MTAD_SYNWW      AIVE----MIKSGTTTF--NDMYFCMDEVARAVE------LSGMRAVLARGMVGVGP-ESEQAI------
ADEC_CLOBA      TPNELSKVLIQHGVTTVM----------------------------------------------------
PYRC_LISMO      TILTGTKAAARGGYTTICSMPNTKPVPDSKEVMESI-QAKIKETAKVRVL--------------------
PYRC_CLOBB      DLESGSKAALRGGYTG---VCLMANTKPICSSKEVVQYVRTQNFDGLNEFKDDNEVKAISDDGVGVSNSN
PYRC_LACH4      EDIETGSKAAAHGTVGAMPNVTPVPTPDLMKKMVQENKQK------------------------------
PYRC_LACDB      EDIETGSKAAAHGTVGAMPNVTPVPTPDLMKKMVQENKQK------------------------------
PYRC_LACDA      EDIETGSKAAAHGTVGAMPNVTPVPTPDLMKKMVQENKQK------------------------------
MTAD_METMA      DDLQLAEWLEKH----IWPAEAQLTAEDVYRGLEMIRSGTTSFAD-------------------------
PYRC_GEOMG      DIVSGTKAAAAGGFTSVMPNTKPVNDNKAVTSY-IIAKAKAEGSVNVFPVGSITQG--------------
ALLB_BACLD      GYDTGTRAAAKGGVTTFI----------------------------------------------------
IADA_ECOLI      TPEVALSRLTEAGVTSVVG---LLGTDSISRHPESL-LAKTRALNEEGISAWMLTGAYPSRTITGSVEKD
PYRC_DESRM      ----------------------------------------------------------------------
MTAD_THESM      ----------------------------------------------------------------------
MTAD_PYRFU      DVRELKRKDIYWGTLLGLARSGVTTFVDMYFHIEEVAKATIE---------VGLRG-FLGYGMVDLENRE
HYDA_BACST      ----------------------------------------------------------------------
ADEC_PETMO      TIEEFAKTVIPLGTLTLVADPHEIA---------------------------------------------
ADEC_CLOBB      TPNELSKVLIQHGVTTVM----------------------------------------------------
PYRC_METAC      ----------------------------------------------------------------------
PYRC_GEOSW      ----------------------------------------------------------------------
PYRC_CORGL      TIATGSAAAAKGGFTAVFTMANTTPVMD------------------------------------------
MTAD_METAC      DDLQLAEWLEKH----IWPAEAQLKAEDVYK---------------------------------------
HYDA_PSEAE      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
ADEC_LYSSC      TPGEFSRVLIPHGITTVITDPHEIA---------------------------------------------
ADEC_KOSOT      SPVEFAKTVLPRGTTTVIADPHEIANVLGLDGVEYLIKS-TEGVPPSSVPATNLEGARISVDMIGEKHPR
PYRC_LACS1      ----------------------------------------------------------------------
PYRC_BACHD      TIETGTKAAAKGGFTTVAAMPNTRPVPDSAEQMSWL----TGRIDETGVVRV-LPYAAITTRQLGRELTD
MTAD_HALOH      ----------------------------------------------------------------------
PYRC_LISW6      TILTGTKAAARGGYTTICSMPNTKPVPDSKEVMERL-QAKIKETAEVRVL--------------------
PYRC_LISIN      TILTGTKAAARGGYTTIMPNTKPVPSKEVMNSLQAKIKETAE----------------------------
PHYDA_ECOUT     ----------------------------------------------------------------------
PHYDA_ECOL6     ----------------------------------------------------------------------
PHYDA_ECOL5     ----------------------------------------------------------------------
PHYDA_ECOK1     ----------------------------------------------------------------------
PHYDA_ECO81     ----------------------------------------------------------------------
PHYDA_ECO45     ----------------------------------------------------------------------
PHYDA_ECO27     ----------------------------------------------------------------------
DPYS_DICDI      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACA2      GIETGSNMLAAGGCTSYFDMPLTVTAENLLAKAE------------------------------------
Y3012_BACCR     LYNTLANHAMQFGTTTFINDNLTL----------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
MTAD_PYRKO      ----------------------------------------------------------------------
ALLB_BACSU      GFETGSQMMAAGGCTTYIPSTVT-AEHLLAKAELGRQKSAVDFALWGGLVPGHIEDPMAEAGAIG-----
ADEC_MOOTA      TVTQFARAVLPGGTTA------------------------------------------------------
ADEC_METJA      KFSGVSKVVIDAGKEGILFMLNDAKILDVYVMLPSCVPATNLETSGAEITAENIEELILLDNVLGVMNYP
ADEC_CLOAB      SPKEFARAVISRGTTTIIVDPHEIA--NVC----------------------------------------
PYRC_LISMF      TILTGTQAAARGGYTTICSMPNTKPVPDSKEVMESL-QAKIKETAKVRVL--------------------
PYRC_LISMC      TILTGTQAAARGGYTTICSMPNTKPVPDSKEVMESL-QAKIKETAKVRVL--------------------
ADEC_METST      TPSRFAEIALRHGTTSVIADPHEIA---------------------------------------------
ADEC_METS3      TPAQFAKLAVRFGTTSV-----------VCDPHEIANVAGTDGID-------------------------
ADEC_METBU      TLSQFAVPALAHGTTSVVIDPHEIANVLGRGGIELV-------LDEAATLPLNA---FVAVSSC------
PYRC_THETN      ----------------------------------------------------------------------
PYRC_GEOUR      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ADEC_LACPL      APSELGKVLLQHGVTT------------------------------------------------------
ADEC_GEOKA      PPSEFARVVLPHGVTTVIADPHEIAVAGVCGIQFMLDEAKRTPLD-------------------------
ADEC_BACSU      TPIEFAKAVLPHGVTTVVTDPHEIANVSGEKGIEFMLEQARH-----TPLNIHFMLPSSVPAASFERSGA
ADEC1_LACSS     SMTSFAEAVVPHGTTSII----------------------------------------------------
UNC33_CAEEL     DLSTGCKSAIAGGTGTIVEVVRPRGAESVVSAVKRVKNQLEKSGISCHVALS------VAITDFCEQEMS
PYRC_LACPL      ----------------------------------------------------------------------
ALLB_ENTFA      G----TAACAKGGVTTFMEMPLNQIPATVDKSLEIKYKA-------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_FUSNN      ----------------------------------------------------------------------
PYRC_CLOAB      ----------------------------------------------------------------------
PHYDA_SHIBS     ----------------------------------------------------------------------
PHYDA_ECOSE     ----------------------------------------------------------------------
PHYDA_ECOLI     ----------------------------------------------------------------------
PHYDA_ECOLC     ----------------------------------------------------------------------
PHYDA_ECOHS     ----------------------------------------------------------------------
PHYDA_ECODH     ----------------------------------------------------------------------
PHYDA_ECOBW     ----------------------------------------------------------------------
PHYDA_ECO8A     ----------------------------------------------------------------------
PHYDA_ECO7I     ----------------------------------------------------------------------
PHYDA_ECO57     ----------------------------------------------------------------------
PHYDA_ECO55     ----------------------------------------------------------------------
PHYDA_ECO24     ----------------------------------------------------------------------
MTAD1_ARCFU     ----------------------------------------------------------------------
DHP2_CAEBR      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ADEC_SILST      --AEFARAVIPHGTTTMFTDPHEIA---------------------------------------------
ADEC_DEHSC      DIAQYARAVVSHGTLALITDLHEIS--NVCGK---------EGID--YVLDASADLPL----SIFLQVPS
PYRC_GEOLS      DIISGTRAAVAGGFTSVMPNTKP-AIDNKAIASYIINKAKTEGACNVFPVGTITQG--------------
PYRC_BACSU      TIETGAKAAARGGYTTVAAMPNTRPVPDTKEQME------------------------------------
PYRC_BACCR      TIETGTLAAAKGGFTTICAMPNTRPVPDCREHMEDLQK-RIEEKAHVNVL--------------------
PYRC_BACC4      TIETGTLAAAKGGFTTICAMPNTRPVPDCREHMEDLQK-RIEEKAHVNVL--------------------
PYRC_METJA      GIN-------------------------------------------------------------------
PYRC_GEOSF      ----------------------------------------------------------------------
PYRC_BACLD      TIETGAKAAARGGFTTVAAMPNTRPVPDTKEQME------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
ADEC_DESHD      APPELIHSALQWGTTTFI----------------------------------------------------
PYRC_METMA      ----------------------------------------------------------------------
MTAD_METBU      ----------------------------------------------------------------------
HUTI_CHRVO      ----------------------------------------------------------------------
DHP1_CAEEL      ----------------------------------------------------------------------
ADEC_BACP2      TPAEFSKAVVPHGVTTVVTDPHEIA---------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
PYRC_BACC3      TIETGTLAAAKGGFTTICAMPNTRPVPDCREHMEDLQNRIKEKAH-VNVLGA------ITVRQVGSEMTD
PYRC_ANOFW      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
DHP1_CAEBR      ----------------------------------------------------------------------
ALLB_BACHD      ----------------------------------------------------------------------
ADEC_OCEIH      TPREFSKVMLKHGVTTAITDPHEIA---------------------------------------------
ADEC_BACLD      TPPEFAKAVIPHGVTTVVTDPHEIANVSGVKGLE------------------------------------
ADEC_BACA2      TPIEFAKAVLPHGVTTVITDPHEIANVSGAKGISMIEQAKKAPLNIRFMLPSCVPAASFERSGAVLKAED
PYRC_THEAQ      ----------------------------------------------------------------------
PYRC_SULSY      DIESGSKAAVAGGYTTVVCMPNTIPAID------------------------------------------
PYRC_ENTFA      ----------------------------------------------------------------------
MTAD_DICT6      ----------------------------------------------------------------------
HUTI_GEOTN      ----------------------------------------------------------------------
ALLB_BACSK      G----SRSLAAGGTTTYVEMPLNALP---ATTNRANLQRKLEAAKGQNYVDYSFYGGLVPTN--------
ADEC_FLAPJ      VPSEFAKIAVLHGTVATISDPHEIA---------------------------------------------
ADEC1_DESPS     SITSFAKAVVPCGTTSIV----------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_BACWK      TIETGTLAAAKGGFTTICAMPNTRPVPDCKEHMEDLQK--------------------------------
PYRC_BACHK      ----------------------------------------------------------------------
PYRC_BACCZ      ----------------------------------------------------------------------
PYRC_BACCQ      ----------------------------------------------------------------------
PYRC_BACC7      ----------------------------------------------------------------------
PYRC_BACC1      ----------------------------------------------------------------------
PYRC_BACC0      ----------------------------------------------------------------------
PYRC_BACAN      ----------------------------------------------------------------------
PYRC_BACAH      ----------------------------------------------------------------------
PYRC_BACAC      ----------------------------------------------------------------------
PYRC_BACAA      ----------------------------------------------------------------------
PHYDA_ECOLU     ----------------------------------------------------------------------
MTAD1_SYNAS     ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_DEHSB      DIAQYARAVVSNGTLALITDLHEIS--NVCGK---------EGID--YVLDASADLPL----SIFLQVPS
ADEC2_LACSS     SPAVFGSLVTPHGTTTILADPHEIVNVAGMRGLEYM---------VASAKNTALDIKYTMPSCVPAAN--
ADEC2_BACSK     ----------------------------------------------------------------------
URE1_PSESM      ----------------------------------------------------------------------
URE1_PSE14      ----------------------------------------------------------------------
URE12_PSEU2     ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_BACC2      TIETGTLAAAKGGFTTICSMPNTRPVPDCREHMEDLQK--------------------------------
ADEC4_RHIME     ---ECSKLSL----TSFAKAVLPLGTTSIVSGLDQI--IVVGGPDAARFLDEVRQTPLKVFWGAPCKTP-
ADEC2_CARHZ     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STAES      TIESGTKAAARGGFTTVCPMPNTRPVPDTVEHVRELRQRISE----------------------------
PYRC_STAEQ      TIESGTKAAARGGFTTVCPMPNTRPVPDTVEHVRELRQRISE----------------------------
PYRC_PELCD      ----------------------------------------------------------------------
MTAD_THEMA      ----------------------------------------------------------------------
HUTI_SHELP      ----------------------------------------------------------------------
HUTI_BACWK      ----------------------------------------------------------------------
ADEC_STAMF      TPHGFAKLALRHGTTT------------------------------------------------------
ADEC_METBF      VPSVFARMAVARGTVAVVSDPHEIAEEGIDYMLEDARKAPLKVFFG--VPSCVPATPFESAGAVDAEAVD
ADEC_DESHY      APPELIHSALQWGTTTFI----------------------------------------------------
PYRC_GEOKA      TIETGTLAAAKGGFTTVAAMPNTNPAPDRKEQMEWL-QARIRETARVNVL--------------------
PYRC_BACCN      TIETGTLAAAKGGFTTICAMPNTRPVPDSKEHMEDLQK--------------------------------
MTAD_METBF      ----------------------------------------------------------------------
HUTI_BACCR      ----------------------------------------------------------------------
DHP2_CAEEL      ----------------------------------------------------------------------
ADEC_META3      VIHEIANVVGVNGIKFMLNDAKLL---DVYCMVPSCVPATELETNGAPITSKDIEELF------------
ADEC_CLOD6      MPIELSKKLLKSGTTTII----------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_CYTH3      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
ADEC_SERP5      ----------------------------------------------------------------------
Y3032_BACAN     LYNTLANHAMQFGTTTFINDNLTL----------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_PYRAB      TIETGTKAAVHGGITTVMPNTKPVMDEKTLKMREFLFKKKSYADYALGFLLAGNE---------------
PYRC_PELTS      ----------------------------------------------------------------------
PYRC_METTH      ----------------------------------------------------------------------
PYRC_LACLE      ----------------------------------------------------------------------
MTAD_DESRM      ----------------------------------------------------------------------
MTAD_CLOTE      ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HUTI_BACHK      ----------------------------------------------------------------------
HUTI_BACCQ      ----------------------------------------------------------------------
HUTI_BACC7      ----------------------------------------------------------------------
HUTI_BACC4      ----------------------------------------------------------------------
HUTI_BACC3      ----------------------------------------------------------------------
HUTI_BACC1      ----------------------------------------------------------------------
HUTI_BACC0      ----------------------------------------------------------------------
HUTI_BACAN      ----------------------------------------------------------------------
HUTI_BACAH      ----------------------------------------------------------------------
HUTI_BACAC      ----------------------------------------------------------------------
HUTI_BACAA      ----------------------------------------------------------------------
ADEC_LEUCK      APSEFSKLVVPHGITRVIADPHEIAS--------------------------------------------
ADEC1_OENOB     APSELAKLELRHGVTS------------------------------------------------------
Y1085_PICTO     IYNPVNEIMIRHGTSMVISDDLPI----------------------------------------------
URE1_STACT      ----------------------------------------------------------------------
HUTI_HALMA      ----------------------------------------------------------------------
HUTI_BACCZ      ----------------------------------------------------------------------
ADEC_RHILO      -VTEFCRAVIPHGTTS------------------------------------------------------
ADEC_METKA      RPARYAEIVVREGTTA------------------------------------------------------
ADEC_ENTFA      TPTIFSKAVVRYGVTTVIADAHEMANVFGLEGLKAFMAAETE----------------------------
URE1_PSEF5      ----------------------------------------------------------------------
URE1_BURVG      ----------------------------------------------------------------------
URE1_BURS3      ----------------------------------------------------------------------
URE1_BURM1      ----------------------------------------------------------------------
URE1_BURCM      ----------------------------------------------------------------------
URE1_BURCJ      ----------------------------------------------------------------------
URE1_BURCH      ----------------------------------------------------------------------
URE1_BURCC      ----------------------------------------------------------------------
URE1_BURCA      ----------------------------------------------------------------------
URE1_BURA4      ----------------------------------------------------------------------
PYRC_PYRFU      SIESGTKAAVHGGITVVMPNTKPIMDEKTLKLREHLFKRKS-----------------------------
PYRC_MYCTU      ----------------------------------------------------------------------
PYRC_MYCBO      ----------------------------------------------------------------------
PYRC_LACSS      ----------------------------------------------------------------------
PYRC_BACCL      TIETGTLAAAKGGFTTVAAMPNTNPAPDRKEQMEWL-QARIRETARVNVL--------------------
HUTI_IDILO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_ESCF3      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSM      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLU      ----------------------------------------------------------------------
ADEC_ECOLI      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECOHS      ----------------------------------------------------------------------
ADEC_ECODH      ----------------------------------------------------------------------
ADEC_ECOBW      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO5E      ----------------------------------------------------------------------
ADEC_ECO57      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_BDEBA      ----------------------------------------------------------------------
PYRC_GEOTN      ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
MTAD_MOOTA      ----------------------------------------------------------------------
MTAD_METS3      ----------------------------------------------------------------------
MTAD_DICTD      ----------------------------------------------------------------------
HUTI_THEP3      ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_BREBN      ----------------------------------------------------------------------
DPYS_MOUSE      G----TKAALAGGTTMIIDFAIPQKGSSLIEAFE------------------------------------
ADEC_PARDP      ----FAAAVIPHGTTT------------------------------------------------------
ADEC1_JANSC     --AEFTRAVIPHGTTSMFTDPHEIANVFGLRGVRLMHDEAL-----LQPINVFTQMPSCAPSAPGLETTG


                         +         .         .         .         .         *         .:210
query           FLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHA
NAGA_BACSH      YIVQPDMEVIKKWQALSGQKIKQITLAPEEPNGMAAVQSLSESGVIVSIGHSDATFEQMQEAVQLGASQG
NAGA_VIBCH      F-IRPSDDTMIDTICANSDVIAKVTLAPENNKPEHIEK-LVKAGIVVSIGHTNATYSEARKSFESGITFA
NAGA_BACSU      WIRPSDVELFKKWQQEAGGLIKIVTLAPEEDQHFELIRHLKDESIIASMGHTXXXXXXXXXXXXXXXXHM
NAGA_ECOLI      FVRKPDAA-LVDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
NAGA_ECO57      FVRKPDAA-LVDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
NAGA_CAEEL      LVITSLSPNPVEII-EHTENIAIVTMAPELEGAQEAIEYFXXXXXXXXXXXXXAKLGPGEMAVLSGAKMI
NAGA_RAT        YLRSFGANAFHDVLATYGDNVCIVTLAPELDRSHEVIQALTAKGIRVSLGHSVADLRAAEVAVQSGATFI
NAGA_MOUSE      YLRSFEANAFHDVLATYGDNVCIVTLAPELDRSHEVIQALTAQGIRVSLGHSVADLRAAEVAVQSGATFI
NAGA_HUMAN      HLRSFEADAFQDLLATYGDNVRIVTLAPELGRSHEVIRALTARGICVSLGHSVADLRAAEDAVWSGATFI
NAGA_DANRE      FLVADLMETYGQL-----ENVAMVTLAPELTNSAAAIHELSSRGITVSVGHSMADLSQAEEAVQNGATFI
NAGA_BOVIN      HLRSFEADAFQDVLATYGDNVRIVTLAPELGHSQEVIRALTALGICVSLGHSVADLGTAEEAVQSGATFI
NAGA_HAEIN      YIITPEMKDF---LCENGDVITKMTIAAENPTINYTPDFV-KAGIIVSVGHSNATYEVAKAAFHKGATFA
NAGA_VIBFU      WFRELAVEELEDWISYSDNQLLKVALAPEKTGALDAIRYLDAHGIHVMLGHSDADYEQVKAALAAGAKGI
NAGA_DROME      KGLSTLKETYGSL-----ERIKIITLAPEKVTDPEVIGQLVERGITVALGHSMASLSDGERAVQQGATLI
AGAA_ECOLI      ----------------------------------------------------------------------
ADEC_DESRM      ----------------------------------------------------------------------
ADEC_CLOBM      ---VPGFEDTGAAVG--PEDVRETMKWDEIVGLGEMMNF---PGILYSTDHAHGVVGETLKASKTVTGHY
ADEC_CLOB6      ---VPGFEDTGAAVG--PEDVRETMKWDEIVGLGEMMNF---PGILYSTDHAHGVVGETLKASKTVTGHY
ADEC_CLOB1      ---VPGFEDTGAAVG--PEDVRETMKWDEIVGLGEMMNF---PGILYSTDHAHGVVGETLKASKTVTGHY
ADEC_CLOBL      ---VPGFEDTGAAVG--PEDVRETMKWDEIVGLGEMMNF---PGILYSTDHAHGVVGETLKASKTVTGHY
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_CLOP1      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_STAAW      ----------------------------------------------------------------------
PYRC_STAAS      ----------------------------------------------------------------------
PYRC_STAAR      ----------------------------------------------------------------------
PYRC_STAAN      ----------------------------------------------------------------------
PYRC_STAAM      ----------------------------------------------------------------------
PYRC_STAAC      ----------------------------------------------------------------------
ADEC_LACS1      YMMPPPATNFETSGADYADDMEDALKTGEVDGLAELMNF---PGVI---NADDKMIDEILMAKKYGAGHA
ADEC_LISIN      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
ADEC_BACHD      ----------------------------------------------------------------------
MTAD_THEON      KTEKEVNERIMKFIEGLDSDRVHFVFGPSIALLKEVRRLANEHGKLITIHVSETMAEIGQISERYGKSPV
ADEC2_DESPS     ----------------------------------------------------------------------
PYRC_PEDPA      ----------------------------------------------------------------------
ADEC_LACDA      ----------------------------------------------------------------------
PYRC_LACLA      DGIPLTDAGVLRLISIHEED-------PNLIG----TLGVNDGEVAHKCGFTGAMARDSMIAYETGARHI
PYRC_CLOCE      ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_CLOPE      ----------------------------------------------------------------------
PYRC_BACP2      F---------------------------------------------------------------------
ADEC_LISMO      ----------------------------------------------------------------------
PYRC_ELUMP      ----------------------------------------------------------------------
PYRC_CLOBA      IMLEAAKENNWVLMSHAESPEFS---KSDMRIAENMMTIRDVELAKLSGAHVHMCHVSTKEALKCIIAAK
PYRC_AQUAE      ----------------------------------------------------------------------
HYDA_PSEPU      ----------------------------------------------------------------------
DPYS_SACKL      ----------------------------------------------------------------------
ADEC_LISW6      ----------------------------------------------------------------------
ADEC_LISMF      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
MTAD_CALS8      ----------------------------------------------------------------------
HUTI_THEVO      ----------------------------------------------------------------------
ADEC_THEM4      ----------------------------------------------------------------------
PYRC_MACCJ      ----------------------------------------------------------------------
MTAD_SYNWW      -------EDSRELIGKWQGQAISFRLGPHLERVMQLSDEL-QAGIHIHVAETRVEYEDILK--QYGKTPV
ADEC_CLOBA      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_CLOBB      IMLEAAKENNWVLMSHAESPEFS---KSDMRIAENMMTIRDVELAKLSGAHVHMCHVSTKEALKCIIAAK
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
MTAD_METMA      ----------------------------------------------------------------------
PYRC_GEOMG      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
IADA_ECOLI      VAIIDRVIGVKCAISDHRSAAPDVYHLANMAAESRVGGLLGGKGVTVHMGDSKKALQDLLENCDVPISKP
PYRC_DESRM      ----------------------------------------------------------------------
MTAD_THESM      ----------------------------------------------------------------------
MTAD_PYRFU      KLEVEIKEKFYEYVTKINSPLVNFVLAPHATCSLECLKWVSKKAVTIHLSETKKEVEEIRK--KYGMT-P
HYDA_BACST      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_CLOBB      ----------------------------------------------------------------------
PYRC_METAC      ----------------------------------------------------------------------
PYRC_GEOSW      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HYDA_PSEAE      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
ADEC_LYSSC      ----------------------------------------------------------------------
ADEC_KOSOT      VLGLGEVMNYPDIINGDHDSIAKIELIPGISG-KDLNAYIC---AFIRSDHECTNVEEAKEKLARGMSVA
PYRC_LACS1      ----------------------------------------------------------------------
PYRC_BACHD      F---------------------------------------------------------------------
MTAD_HALOH      ----------------------------------------------------------------------
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
PHYDA_ECOUT     ----------------------------------------------------------------------
PHYDA_ECOL6     ----------------------------------------------------------------------
PHYDA_ECOL5     ----------------------------------------------------------------------
PHYDA_ECOK1     ----------------------------------------------------------------------
PHYDA_ECO81     ----------------------------------------------------------------------
PHYDA_ECO45     ----------------------------------------------------------------------
PHYDA_ECO27     ----------------------------------------------------------------------
DPYS_DICDI      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACA2      ----------------------------------------------------------------------
Y3012_BACCR     ----------------------------------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
MTAD_PYRKO      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC_METJA      AVINEDEEMLKKIEVAKKYNKLIDGHCPKLKG-WELNKYISHG---IMSDHESVDEDEALEKLRLG----
ADEC_CLOAB      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
ADEC_METST      ----------------------------------------------------------------------
ADEC_METS3      ----------------------------------------------------------------------
ADEC_METBU      --VPATS---FETAGASVDDIVSLIANENVVGLGEMMDY---PGVVLSMIRTALKERLVVDG-HCPALSR
PYRC_THETN      ----------------------------------------------------------------------
PYRC_GEOUR      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ADEC_LACPL      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BACSU      ILKAADLKPFYE-----EEEVLGLAEVMDYVSVQQAEKDMVQKLLDARVAGKR------IDGHLAGLS--
ADEC1_LACSS     ----------------------------------------------------------------------
UNC33_CAEEL     ELVKNEGINSFVLDGVSLTDDKLLELFEHVKRLGALIRVVPENKSIVAMLEKKQSRPESLEGNLASCPSI
PYRC_LACPL      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_FUSNN      ----------------------------------------------------------------------
PYRC_CLOAB      ----------------------------------------------------------------------
PHYDA_SHIBS     ----------------------------------------------------------------------
PHYDA_ECOSE     ----------------------------------------------------------------------
PHYDA_ECOLI     ----------------------------------------------------------------------
PHYDA_ECOLC     ----------------------------------------------------------------------
PHYDA_ECOHS     ----------------------------------------------------------------------
PHYDA_ECODH     ----------------------------------------------------------------------
PHYDA_ECOBW     ----------------------------------------------------------------------
PHYDA_ECO8A     ----------------------------------------------------------------------
PHYDA_ECO7I     ----------------------------------------------------------------------
PHYDA_ECO57     ----------------------------------------------------------------------
PHYDA_ECO55     ----------------------------------------------------------------------
PHYDA_ECO24     ----------------------------------------------------------------------
MTAD1_ARCFU     ----------------------------------------------------------------------
DHP2_CAEBR      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ADEC_SILST      ----------------------------------------------------------------------
ADEC_DEHSC      -CVPAT---HLETAGANSQDVADLLRLPNVTGLGEMMNFPGVLGVPSVLDKIIAAAGKVLDG------HA
PYRC_GEOLS      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
PYRC_BACCR      ----------------------------------------------------------------------
PYRC_BACC4      ----------------------------------------------------------------------
PYRC_METJA      ----------------------------------------------------------------------
PYRC_GEOSF      ----------------------------------------------------------------------
PYRC_BACLD      ----------------------------------------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
ADEC_DESHD      ----------------------------------------------------------------------
PYRC_METMA      ----------------------------------------------------------------------
MTAD_METBU      ----------------------------------------------------------------------
HUTI_CHRVO      ----------------------------------------------------------------------
DHP1_CAEEL      ----------------------------------------------------------------------
ADEC_BACP2      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
PYRC_BACC3      F---------------------------------------------------------------------
PYRC_ANOFW      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
DHP1_CAEBR      ----------------------------------------------------------------------
ALLB_BACHD      ----------------------------------------------------------------------
ADEC_OCEIH      ----------------------------------------------------------------------
ADEC_BACLD      ----------------------------------------------------------------------
ADEC_BACA2      LVLGLAEVMDYVSVAEGEEDMLQKLLDAKRHGKRHLAGLSSDRTAMVSNDHEVTTKEEALDRIRRG----
PYRC_THEAQ      ----------------------------------------------------------------------
PYRC_SULSY      ----------------------------------------------------------------------
PYRC_ENTFA      ----------------------------------------------------------------------
MTAD_DICT6      ----------------------------------------------------------------------
HUTI_GEOTN      ----------------------------------------------------------------------
ALLB_BACSK      ----------------------------------------------------------------------
ADEC_FLAPJ      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_BACWK      ----------------------------------------------------------------------
PYRC_BACHK      ----------------------------------------------------------------------
PYRC_BACCZ      ----------------------------------------------------------------------
PYRC_BACCQ      ----------------------------------------------------------------------
PYRC_BACC7      ----------------------------------------------------------------------
PYRC_BACC1      ----------------------------------------------------------------------
PYRC_BACC0      ----------------------------------------------------------------------
PYRC_BACAN      ----------------------------------------------------------------------
PYRC_BACAH      ----------------------------------------------------------------------
PYRC_BACAC      ----------------------------------------------------------------------
PYRC_BACAA      ----------------------------------------------------------------------
PHYDA_ECOLU     ----------------------------------------------------------------------
MTAD1_SYNAS     ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_DEHSB      -CVPAT---HLETAGANSQDVADLLRLPNVTGLGEMMNFPGVLGVPSVLDKIIAATGKVMDG------HA
ADEC2_LACSS     ----PTLETSGAVITADE-----IKQSYDQGLTYGLAEFMNYPGVV---NADDGVLDELLVSL-----NA
ADEC2_BACSK     ----------------------------------------------------------------------
URE1_PSESM      ----------------------------------------------------------------------
URE1_PSE14      ----------------------------------------------------------------------
URE12_PSEU2     ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_BACC2      ----------------------------------------------------------------------
ADEC4_RHIME     YTMPRSTVGHYFSPKDHRDT----HHWPECVGIWETVRFIQEED------------EDVLQAIEIGQANR
ADEC2_CARHZ     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STAES      ----------------------------------------------------------------------
PYRC_STAEQ      ----------------------------------------------------------------------
PYRC_PELCD      ----------------------------------------------------------------------
MTAD_THEMA      ----------------------------------------------------------------------
HUTI_SHELP      ----------------------------------------------------------------------
HUTI_BACWK      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_METBF      RLLASEMMNFPGVVMEFPEVIAKLESAKKIDGGTDLQKYV---GAGISTDHESFAYEEAVEKIKLG----
ADEC_DESHY      ----------------------------------------------------------------------
PYRC_GEOKA      ----------------------------------------------------------------------
PYRC_BACCN      ----------------------------------------------------------------------
MTAD_METBF      ----------------------------------------------------------------------
HUTI_BACCR      ----------------------------------------------------------------------
DHP2_CAEEL      ----------------------------------------------------------------------
ADEC_META3      ------KQNNYRILGLGE--VMNYIGVXXXXXXXXXXXXMAKKYNKLIDGHAQLTREDLINYVN------
ADEC_CLOD6      ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_CYTH3      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
ADEC_SERP5      ----------------------------------------------------------------------
Y3032_BACAN     ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_PYRAB      ----PVKADFYKIMGASTGGIYSKNFEEDYAKALDITSVHAEDYELIS----------------------
PYRC_PELTS      ----------------------------------------------------------------------
PYRC_METTH      ----------------------------------------------------------------------
PYRC_LACLE      ----------------------------------------------------------------------
MTAD_DESRM      ----------------------------------------------------------------------
MTAD_CLOTE      ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HUTI_BACHK      ----------------------------------------------------------------------
HUTI_BACCQ      ----------------------------------------------------------------------
HUTI_BACC7      ----------------------------------------------------------------------
HUTI_BACC4      ----------------------------------------------------------------------
HUTI_BACC3      ----------------------------------------------------------------------
HUTI_BACC1      ----------------------------------------------------------------------
HUTI_BACC0      ----------------------------------------------------------------------
HUTI_BACAN      ----------------------------------------------------------------------
HUTI_BACAH      ----------------------------------------------------------------------
HUTI_BACAC      ----------------------------------------------------------------------
HUTI_BACAA      ----------------------------------------------------------------------
ADEC_LEUCK      ----------------------------------------------------------------------
ADEC1_OENOB     ----------------------------------------------------------------------
Y1085_PICTO     ----------------------------------------------------------------------
URE1_STACT      ----------------------------------------------------------------------
HUTI_HALMA      ----------------------------------------------------------------------
HUTI_BACCZ      ----------------------------------------------------------------------
ADEC_RHILO      ----------------------------------------------------------------------
ADEC_METKA      ----------------------------------------------------------------------
ADEC_ENTFA      ----------------------------------------------------------------------
URE1_PSEF5      ----------------------------------------------------------------------
URE1_BURVG      ----------------------------------------------------------------------
URE1_BURS3      ----------------------------------------------------------------------
URE1_BURM1      ----------------------------------------------------------------------
URE1_BURCM      ----------------------------------------------------------------------
URE1_BURCJ      ----------------------------------------------------------------------
URE1_BURCH      ----------------------------------------------------------------------
URE1_BURCC      ----------------------------------------------------------------------
URE1_BURCA      ----------------------------------------------------------------------
URE1_BURA4      ----------------------------------------------------------------------
PYRC_PYRFU      ----------------------------------------------------------------------
PYRC_MYCTU      ----------------------------------------------------------------------
PYRC_MYCBO      ----------------------------------------------------------------------
PYRC_LACSS      ----------------------------------------------------------------------
PYRC_BACCL      ----------------------------------------------------------------------
HUTI_IDILO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_ESCF3      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSM      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLU      ----------------------------------------------------------------------
ADEC_ECOLI      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECOHS      ----------------------------------------------------------------------
ADEC_ECODH      ----------------------------------------------------------------------
ADEC_ECOBW      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO5E      ----------------------------------------------------------------------
ADEC_ECO57      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_BDEBA      ----------------------------------------------------------------------
PYRC_GEOTN      ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
MTAD_MOOTA      ----------------------------------------------------------------------
MTAD_METS3      ----------------------------------------------------------------------
MTAD_DICTD      ----------------------------------------------------------------------
HUTI_THEP3      ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_BREBN      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ADEC_PARDP      ----------------------------------------------------------------------
ADEC1_JANSC     FEIGP-------------DDVSEAMAWPGIVGLGEMMNF-------------------------------


                         .         .         .         +         .         .         .:280
query           THLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGM
NAGA_BACSH      THLYNQMRPFHHRDPXXXXXXXXXDIKAELIVDFIHMHEGAVEMAYRLKGADGIILITDAMRAKGMPYGE
NAGA_VIBCH      THLFNAMTPMVGREPGVVGAIYDTEVYAGIIADGFHVDYANIRIAHKIKG-EKLVLVTDATAPAGAEMDY
NAGA_BACSU      THLYNAMSPFHHREPGVIGALAHDGFVTELIADGIHSHPLAAKLAFLAKGSSKLILITDSMRAKGLKDGV
NAGA_ECOLI      THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDATAPAGANIEQ
NAGA_ECO57      THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDATAPAGANIEQ
NAGA_CAEEL      THLFNAMQSYHHRDPGLIGLLTSSKLTPDIISDGIHTHDSALRIAYHTNSAGLVL-VTDAIAALGMSDGV
NAGA_RAT        THLFNAMLPFHHRDPGIVGLLTSDQIFYGMIADGIHTNPAALRIAHRAH-PQGLVLVTDAVPALGLGNGR
NAGA_MOUSE      THLFNAMLPFHHRDPGIVGLLTSDQIFYGMIADGIHTNPAALRIAHRAH-PQGLVLVTDAVPALGLGNGR
NAGA_HUMAN      THLFNAMLPFHHRDPGIVGLLTSDRLPAGMIADGTHTNPAALRIAHRAH-PQGLVLVTDAIPALGLGNGR
NAGA_DANRE      THLFNAMLPFHHRDPGIVGLLTSDRIPPGMIADGIHTHPAALRIAHRAHPAG-LVLVTDAVTAMGLPPGR
NAGA_BOVIN      THLFNAMLPFHHRDPGIVGLLTSDRLPAGMIADGIHTNPAALRIAHRPKG---LVLVTDAVPALGLGNGR
NAGA_HAEIN      THLHNAMSPISSREMGVVGAVLDSDVYTGIIVDGVHINYGNVRIDKKIKG-DKLCIVTDSIAAAGAPPEL
NAGA_VIBFU      VHCYNGMRGLHHRDPGVVGALLHPHCFVEMIADGHHVHPAAIDVAHRCCGS-RMTLITDAMRATGMPDGQ
NAGA_DROME      THLFNAMLPFHHRDPGLVGLLASDAVPFGIISDGVHTHPAALRIAYRTH-PQGLILVTDAISALGLEEGV
AGAA_ECOLI      -HCYNGMTGLHHREPGMVGALTDKRAWLELIADGHHV-HPAAMSLCCCCAKERIVLITDAMQAAGMPDGR
ADEC_DESRM      ----------------------------------------------------------------------
ADEC_CLOBM      S------LPETGK--GLNG----------YIASGVRCCHESTRAALAKMRLGMYTMFREGSAWHDLKEVS
ADEC_CLOB6      S------LPETGK--GLNG----------YIASGVRCCHESTR------AEDALAKMRLGMYAMFREGSA
ADEC_CLOB1      S------LPETGK--GLNG----------YIASGVRCCHESTR------AEDALAKMRLGMYAMFREGSA
ADEC_CLOBL      S------LPETGK--GLNG----------YIASGVRCCHESTR------AEDALAKMRLGMYAMFREGSA
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_CLOP1      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_STAAW      ----------------------------------------------------------------------
PYRC_STAAS      ----------------------------------------------------------------------
PYRC_STAAR      ----------------------------------------------------------------------
PYRC_STAAN      ----------------------------------------------------------------------
PYRC_STAAM      ----------------------------------------------------------------------
PYRC_STAAC      ----------------------------------------------------------------------
ADEC_LACS1      PQVVGKLNAYIAAGPANDHECSTLEEAEERLARGMYLL---LREGSVTQDLRKLLIVNTANSRRCL----
ADEC_LISIN      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
ADEC_BACHD      ----------------------------------------------------------------------
MTAD_THEON      VLLDD--IGFFGRDVIIAGVWLDSRDIQILARHGVTVAHPASNMKLASGVMPLQRLLNAGVNVGLGTDGS
ADEC2_DESPS     ----------------------------------------------------------------------
PYRC_PEDPA      ----------------------------------------------------------------------
ADEC_LACDA      ----------------------------------------------------------------------
PYRC_LACLA      QHLSAGESVEVVRFAKNLGAKITAEVTPQHFSITEQMIFTNAKLNPPLRSTTDIGKIIEG-----LKDGT
PYRC_CLOCE      ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_CLOPE      ----------------------------------------------------------------------
PYRC_BACP2      ----------------------------------------------------------------------
ADEC_LISMO      ----------------------------------------------------------------------
PYRC_ELUMP      ----------------------------------------------------------------------
PYRC_CLOBA      NEGANITLEVTPHHIGLTKEINDYRVN------------PPIR---EKEDVEEII-------------KA
PYRC_AQUAE      ----------------------------------------------------------------------
HYDA_PSEPU      ----------------------------------------------------------------------
DPYS_SACKL      ----------------------------------------------------------------------
ADEC_LISW6      ----------------------------------------------------------------------
ADEC_LISMF      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
MTAD_CALS8      ----------------------------------------------------------------------
HUTI_THEVO      ----------------------------------------------------------------------
ADEC_THEM4      ----------------------------------------------------------------------
PYRC_MACCJ      ----------------------------------------------------------------------
MTAD_SYNWW      SHL-ESLGLFQGRQ---VLAAHCVHLNEEEI--GILHQY-QVGVAHNPESNMK-LASGIAPVPRMLESGI
ADEC_CLOBA      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_CLOBB      DEGANITLEVTPHHIGLTKEINDYRVN------------PPIR---EKEDVEEII-------------KA
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
MTAD_METMA      ----------------------------------------------------------------------
PYRC_GEOMG      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
IADA_ECOLI      THLFEQALEFARKTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDD-----------
PYRC_DESRM      ----------------------------------------------------------------------
MTAD_THESM      ----------------------------------------------------------------------
MTAD_PYRFU      TQLLDEVGLLNEKLIAAHGVWLSEEMLSSANATVVHCPASNMKLGSGVFPLRKALDL-----------GV
HYDA_BACST      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_CLOBB      ----------------------------------------------------------------------
PYRC_METAC      ----------------------------------------------------------------------
PYRC_GEOSW      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HYDA_PSEAE      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
ADEC_LYSSC      ----------------------------------------------------------------------
ADEC_KOSOT      RNLDELLPLINEKNYPFISFCTDDKHPNDILNEG-HIDY-MIRYAIK-KGIDPITAVRAATINTARHYNL
PYRC_LACS1      ----------------------------------------------------------------------
PYRC_BACHD      ----------------------------------------------------------------------
MTAD_HALOH      ----------------------------------------------------------------------
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
PHYDA_ECOUT     ----------------------------------------------------------------------
PHYDA_ECOL6     ----------------------------------------------------------------------
PHYDA_ECOL5     ----------------------------------------------------------------------
PHYDA_ECOK1     ----------------------------------------------------------------------
PHYDA_ECO81     ----------------------------------------------------------------------
PHYDA_ECO45     ----------------------------------------------------------------------
PHYDA_ECO27     ----------------------------------------------------------------------
DPYS_DICDI      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACA2      ----------------------------------------------------------------------
Y3012_BACCR     ----------------------------------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
MTAD_PYRKO      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC_METJA      ---------------------LKLMIREGTASKNIYL----LNICKKIKDFRNIMLVSD-----------
ADEC_CLOAB      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
ADEC_METST      ----------------------------------------------------------------------
ADEC_METS3      ----------------------------------------------------------------------
ADEC_METBU      EQLFGYMC---------------AGISTDHESIEYEEALEKLRLGMK-------LMIREGSAAKALDKFL
PYRC_THETN      ----------------------------------------------------------------------
PYRC_GEOUR      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ADEC_LACPL      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BACSU      TDLINIRTAFVLNDHEVT----SKEEALDRIRRGMYVAKNTLNVAVNEKNARRFFFCTDDKHV----DDL
ADEC1_LACSS     ----------------------------------------------------------------------
UNC33_CAEEL     VQVSSADSLAAIEKARASGALAHAEIASAAVADGSALFSQDLRFASAH--------LTDVPLRRGAPDRM
PYRC_LACPL      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_FUSNN      ----------------------------------------------------------------------
PYRC_CLOAB      ----------------------------------------------------------------------
PHYDA_SHIBS     ----------------------------------------------------------------------
PHYDA_ECOSE     ----------------------------------------------------------------------
PHYDA_ECOLI     ----------------------------------------------------------------------
PHYDA_ECOLC     ----------------------------------------------------------------------
PHYDA_ECOHS     ----------------------------------------------------------------------
PHYDA_ECODH     ----------------------------------------------------------------------
PHYDA_ECOBW     ----------------------------------------------------------------------
PHYDA_ECO8A     ----------------------------------------------------------------------
PHYDA_ECO7I     ----------------------------------------------------------------------
PHYDA_ECO57     ----------------------------------------------------------------------
PHYDA_ECO55     ----------------------------------------------------------------------
PHYDA_ECO24     ----------------------------------------------------------------------
MTAD1_ARCFU     ----------------------------------------------------------------------
DHP2_CAEBR      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ADEC_SILST      ----------------------------------------------------------------------
ADEC_DEHSC      --------------PGLSGKDLNAYISAGIHSDHIHLAYIMIREGSSEKNLAELLLVTDQTYKRCL----
PYRC_GEOLS      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
PYRC_BACCR      ----------------------------------------------------------------------
PYRC_BACC4      ----------------------------------------------------------------------
PYRC_METJA      ----------------------------------------------------------------------
PYRC_GEOSF      ----------------------------------------------------------------------
PYRC_BACLD      ----------------------------------------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
ADEC_DESHD      ----------------------------------------------------------------------
PYRC_METMA      ----------------------------------------------------------------------
MTAD_METBU      --------------PGVLAAIWLSDGDMDILADNVNIAHNPVSNMKLASGVAPVMKLLDKGANVCLTDGC
HUTI_CHRVO      ----------------------------------------------------------------------
DHP1_CAEEL      ----------------------------------------------------------------------
ADEC_BACP2      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
PYRC_BACC3      ----------------------------------------------------------------------
PYRC_ANOFW      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
DHP1_CAEBR      ----------------------------------------------------------------------
ALLB_BACHD      ----------------------------------------------------------------------
ADEC_OCEIH      ----------------------------------------------------------------------
ADEC_BACLD      ----------------------------------------------------------------------
ADEC_BACA2      ----------------------------------------------------------------------
PYRC_THEAQ      ----------------------------------------------------------------------
PYRC_SULSY      ----------------------------------------------------------------------
PYRC_ENTFA      ----------------------------------------------------------------------
MTAD_DICT6      ----------------------------------------------------------------------
HUTI_GEOTN      ----------------------------------------------------------------------
ALLB_BACSK      ----------------------------------------------------------------------
ADEC_FLAPJ      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_BACWK      ----------------------------------------------------------------------
PYRC_BACHK      ----------------------------------------------------------------------
PYRC_BACCZ      ----------------------------------------------------------------------
PYRC_BACCQ      ----------------------------------------------------------------------
PYRC_BACC7      ----------------------------------------------------------------------
PYRC_BACC1      ----------------------------------------------------------------------
PYRC_BACC0      ----------------------------------------------------------------------
PYRC_BACAN      ----------------------------------------------------------------------
PYRC_BACAH      ----------------------------------------------------------------------
PYRC_BACAC      ----------------------------------------------------------------------
PYRC_BACAA      ----------------------------------------------------------------------
PHYDA_ECOLU     ----------------------------------------------------------------------
MTAD1_SYNAS     ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_DEHSB      --------------PGLSGKDLNAYISAGIHSDHIHLAYIMIREGSSEKNLAELLLVTDKTYKRCL----
ADEC2_LACSS     RKMIDGHSPALHGQGAAAGVHNDHECTLDRISRGMYVYLRYGTVSKNMPTLLKGVTPQNARFCCLCGDDL
ADEC2_BACSK     ----------------------------------------------------------------------
URE1_PSESM      ----------------------------------------------------------------------
URE1_PSE14      ----------------------------------------------------------------------
URE12_PSEU2     ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_BACC2      ----------------------------------------------------------------------
ADEC4_RHIME     LPVLGCC-------PMTRGARLNGYMQSGVRAD--HESYTPEEMLEKLRAGMHVV-VRESSISHFLSDNL
ADEC2_CARHZ     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STAES      ----------------------------------------------------------------------
PYRC_STAEQ      ----------------------------------------------------------------------
PYRC_PELCD      ----------------------------------------------------------------------
MTAD_THEMA      ----------------------------------------------------------------------
HUTI_SHELP      ----------------------------------------------------------------------
HUTI_BACWK      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_METBF      ----------------------------------------------------------------------
ADEC_DESHY      ----------------------------------------------------------------------
PYRC_GEOKA      ----------------------------------------------------------------------
PYRC_BACCN      ----------------------------------------------------------------------
MTAD_METBF      ----------------------------------------------------------------------
HUTI_BACCR      ----------------------------------------------------------------------
DHP2_CAEEL      ----------------------------------------------------------------------
ADEC_META3      -----------------MGIMSDHECTTE--DEALEKLQLGLKLMVREGTASKLLKIIDILKRKGTYNKL
ADEC_CLOD6      ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_CYTH3      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
ADEC_SERP5      ----------------------------------------------------------------------
Y3032_BACAN     ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_PYRAB      ----------------------------------------------------------------------
PYRC_PELTS      ----------------------------------------------------------------------
PYRC_METTH      ----------------------------------------------------------------------
PYRC_LACLE      ----------------------------------------------------------------------
MTAD_DESRM      ----------------------------------------------------------------------
MTAD_CLOTE      ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HUTI_BACHK      ----------------------------------------------------------------------
HUTI_BACCQ      ----------------------------------------------------------------------
HUTI_BACC7      ----------------------------------------------------------------------
HUTI_BACC4      ----------------------------------------------------------------------
HUTI_BACC3      ----------------------------------------------------------------------
HUTI_BACC1      ----------------------------------------------------------------------
HUTI_BACC0      ----------------------------------------------------------------------
HUTI_BACAN      ----------------------------------------------------------------------
HUTI_BACAH      ----------------------------------------------------------------------
HUTI_BACAC      ----------------------------------------------------------------------
HUTI_BACAA      ----------------------------------------------------------------------
ADEC_LEUCK      ----------------------------------------------------------------------
ADEC1_OENOB     ----------------------------------------------------------------------
Y1085_PICTO     ----------------------------------------------------------------------
URE1_STACT      ----------------------------------------------------------------------
HUTI_HALMA      ----------------------------------------------------------------------
HUTI_BACCZ      ----------------------------------------------------------------------
ADEC_RHILO      ----------------------------------------------------------------------
ADEC_METKA      ----------------------------------------------------------------------
ADEC_ENTFA      ----------------------------------------------------------------------
URE1_PSEF5      ----------------------------------------------------------------------
URE1_BURVG      ----------------------------------------------------------------------
URE1_BURS3      ----------------------------------------------------------------------
URE1_BURM1      ----------------------------------------------------------------------
URE1_BURCM      ----------------------------------------------------------------------
URE1_BURCJ      ----------------------------------------------------------------------
URE1_BURCH      ----------------------------------------------------------------------
URE1_BURCC      ----------------------------------------------------------------------
URE1_BURCA      ----------------------------------------------------------------------
URE1_BURA4      ----------------------------------------------------------------------
PYRC_PYRFU      ----------------------------------------------------------------------
PYRC_MYCTU      ----------------------------------------------------------------------
PYRC_MYCBO      ----------------------------------------------------------------------
PYRC_LACSS      ----------------------------------------------------------------------
PYRC_BACCL      ----------------------------------------------------------------------
HUTI_IDILO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_ESCF3      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSM      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLU      ----------------------------------------------------------------------
ADEC_ECOLI      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECOHS      ----------------------------------------------------------------------
ADEC_ECODH      ----------------------------------------------------------------------
ADEC_ECOBW      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO5E      ----------------------------------------------------------------------
ADEC_ECO57      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_BDEBA      ----------------------------------------------------------------------
PYRC_GEOTN      ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
MTAD_MOOTA      -------------------------------------------------------------------DGA
MTAD_METS3      ----------------------------------------------------------------------
MTAD_DICTD      ----------------------------------------------------------------------
HUTI_THEP3      ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_BREBN      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ADEC_PARDP      ----------------------------------------------------------------------
ADEC1_JANSC     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE
NAGA_BACSH      YDLGGQLVHVTESGAHLSNGSLAGSILTMDQAVRNMRQITNCTLEELVKMSSYNAAQQLKLTN-KGQLTE
NAGA_VIBCH      FIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKK
NAGA_BACSU      YEFGGQSVTVRGRTALLSDGTLAGSILKMNEGARHMREFTNCSWTDIANITSENAAKQLGIFDRKGSVTV
NAGA_ECOLI      FIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
NAGA_ECO57      FIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
NAGA_CAEEL      HKLGTQTIHVKGLEAKLDTNTTAGSVASMPYCIRHLMKATGCPIEFALQSATHKPATLLGVSDEKGTLDV
NAGA_RAT        HTLGQQEVEV-DGLIAYIAGTLSGSIAPMDVCIRHFLQATGCSVESALEAASLHPAQLLGLEKTKGSLDF
NAGA_MOUSE      HTLGQQEVEV-DGLIAYIAGTLGGSIAPMDVCVRHFLQATGCSVESALEAASLHPAQMLGLEKTKGSLDF
NAGA_HUMAN      HTLGQQEVEV-DGLTAYVAGTLSGSIAPMDVCVRHFLQATGCSMESALEAASLHPAQLLGLEKSKGTLDF
NAGA_DANRE      HTLGQQQIDIQ-GLHAYVAGTLSGSIATMDMCVRHFREASGCTVEAALEAASLHPAQLLGISHRKGTLEF
NAGA_BOVIN      HTLGQQEVEV-DGLTAYVAGTLSGSIAPMDTCVRHFLQATGCSVESALEAASLHPAQLLGLEKRKGTLDF
NAGA_HAEIN      FTFVGKTIYIKEGRCYDANDTIAGASITMMESIKNAVEYVEIPLAEAIRMSNLYPARAIGIDDRLGSVEK
NAGA_VIBFU      YTLGEYQVDMKQGVVMXXXXXXXXXXXXXXRGVKNIHRWLNVPIEQAWLMASYTPAESLGIQHQLGSLEV
NAGA_DROME      HHIGQLPLQVKQGKAFIATETLCGSIAPMDECVRIFQKATDCSVVYAIEAATLHPAQCLKIEKQKGTLDF
AGAA_ECOLI      YTLCGEEVQMHGGVVRTASGGLAGSTLSVDAAVRNMVELTGVTPAEAIHMASLHPARMLGVDGVLGSLKP
ADEC_DESRM      ----------------------------------NVQKAIALGLNPIIQMATINTAKHFRLDHYLGALTP
ADEC_CLOBM      KAITGNKVDSR--FAVLISDDTHPHTLLLDHIIKRAIEEGIEPLT-AIQMVTINCAQCFQMDHELGSITP
ADEC_CLOB6      WSKAITENKVDSRFAVLISDDTHPHTLLLDHIIKRAIEEGIEPLT-AIQMVTINCAQCFQMDHELGSITP
ADEC_CLOB1      WSKAITENKVDSRFAVLISDDTHPHTLLLDHIIKRAIEEGIEPLT-AIQMVTINCAQCFQMDHELGSITP
ADEC_CLOBL      WSKAITENKVDSRFAVLISDDTHPHTLLLDHIIKRAIEEGIEPLT-AIQMVTINCAQCFQMDHELGSITP
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_CLOP1      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_STAAW      ----------------------------------------------------------------------
PYRC_STAAS      ----------------------------------------------------------------------
PYRC_STAAR      ----------------------------------------------------------------------
PYRC_STAAN      ----------------------------------------------------------------------
PYRC_STAAM      ----------------------------------------------------------------------
PYRC_STAAC      ----------------------------------------------------------------------
ADEC_LACS1      --LSGDDVQAKTA---INKGHLDNSIICIDEGLNPI---------TAIQMATLNPAEYCGLND-RGAIAP
ADEC_LISIN      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
ADEC_BACHD      ----------------------------------------------------------------------
MTAD_THEON      ASNNNLDMLDEMKLAALLH-----KVHNLDPTVAD--------AETVFRMATVNGARALGL--KAGIIKE
ADEC2_DESPS     ----------------------------------------------------------------------
PYRC_PEDPA      ----------------------------------------------------------------------
ADEC_LACDA      ----------------------------------------------------------------------
PYRC_LACLA      IDVIATDREEKNVSLDKAPSGMIGLETSLQLGLTNLVAKGHLTLSELLTKMTVNPAKLYNFD--AGYLAE
PYRC_CLOCE      ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_CLOPE      ----------------------------------------------------------------------
PYRC_BACP2      ----------------------------------------------------------------------
ADEC_LISMO      ----------------------------------------------------------------------
PYRC_ELUMP      ----------------------------------------------------------------------
PYRC_CLOBA      IKMGNIDTIGTDHAPHTLSPGMVGLETAFPICYTKLVRENGVSLNELSKLMSLNPAKLLGMN--KGKISI
PYRC_AQUAE      ----------------------------------------------------------------------
HYDA_PSEPU      ----------------------------------------------------------------------
DPYS_SACKL      ----------------------------------------------------------------------
ADEC_LISW6      ----------------------------------------------------------------------
ADEC_LISMF      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
MTAD_CALS8      ----------------------------------------------------------------------
HUTI_THEVO      ----------------------------------------------------------------------
ADEC_THEM4      ----------------------------------------------------------------------
PYRC_MACCJ      ----------------------------------------------------------------------
MTAD_SYNWW      AVALGTDGASSNNNLDMLSSSFLHKVNTMDPMV--------LPAYQALEMATANGAISLGMGNELGRLEP
ADEC_CLOBA      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_CLOBB      IKMGNVDTIGTDHAPHTLSPGMVGLETAFPICYTKLVRENGVSLNELSKLMSLNPARLLGMN--KGRISI
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
MTAD_METMA      ----------------------------------------------------------------------
PYRC_GEOMG      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
IADA_ECOLI      -------------EGNLTHIGVAG-FETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTG-KGEILP
PYRC_DESRM      ----------------------------------------------------------------------
MTAD_THESM      ----------------------------------------------------------------------
MTAD_PYRFU      NVALGTDGAASNNTLDMLREMRLASLLQ-KVAHLNIVKS-----EEILKMATVNPAKALGL--KSGVIKE
HYDA_BACST      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_CLOBB      ----------------------------------------------------------------------
PYRC_METAC      ----------------------------------------------------------------------
PYRC_GEOSW      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HYDA_PSEAE      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
ADEC_LYSSC      ----------------------------------------------------------------------
ADEC_KOSOT      RSMG------------------------------------------------------------------
PYRC_LACS1      ----------------------------------------------------------------------
PYRC_BACHD      ----------------------------------------------------------------------
MTAD_HALOH      ----GTDGTSSNNNLDLIEEARSGSFLQK----VNDLDSTALPVDTVLKMLTVNGAKILGFD-KLGVLKE
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
PHYDA_ECOUT     ----------------------------------------------------------------------
PHYDA_ECOL6     ----------------------------------------------------------------------
PHYDA_ECOL5     ----------------------------------------------------------------------
PHYDA_ECOK1     ----------------------------------------------------------------------
PHYDA_ECO81     ----------------------------------------------------------------------
PHYDA_ECO45     ----------------------------------------------------------------------
PHYDA_ECO27     ----------------------------------------------------------------------
DPYS_DICDI      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACA2      ----------------------------------------------------------------------
Y3012_BACCR     ----------------------------------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
MTAD_PYRKO      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC_METJA      ------DVCIKD---------LDGYMLNI------LRKATNYPI-EAIQMVTINPANYFGFDVG---IKA
ADEC_CLOAB      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
ADEC_METST      ----------------------------------------------------------------------
ADEC_METS3      ----------------------------------------------------------------------
ADEC_METBU      PRLIGDGVSLENHPSDLLKGYM-------DVIVRRAIELGLSPL-DAISMCTINAAKHYRVDHIVGSLSM
PYRC_THETN      ----------------------------------------------------------------------
PYRC_GEOUR      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ADEC_LACPL      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BACSU      LSEGSVNHQVKMAIQAGLNPFLAYQLGSLNAA-------------------------ECYGLDTKGAIAP
ADEC1_LACSS     -----------------------------------------------IQMATINSAEAYRIDDQVGLIAP
UNC33_CAEEL     IALSTQPLVVVNSATRVAAKDFAGAEERMAVVWERAVRSGRIDAMRFVAVTSTNAAKMFNMYPKKGRIAV
PYRC_LACPL      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_FUSNN      ----------------------------------------------------------------------
PYRC_CLOAB      ---------------------MIGLETALSLAVTNLVKTGDLTYRDMISKLTINPARFYNLD--RGYIKE
PHYDA_SHIBS     ----------------------------------------------------------------------
PHYDA_ECOSE     ----------------------------------------------------------------------
PHYDA_ECOLI     ----------------------------------------------------------------------
PHYDA_ECOLC     ----------------------------------------------------------------------
PHYDA_ECOHS     ----------------------------------------------------------------------
PHYDA_ECODH     ----------------------------------------------------------------------
PHYDA_ECOBW     ----------------------------------------------------------------------
PHYDA_ECO8A     ----------------------------------------------------------------------
PHYDA_ECO7I     ----------------------------------------------------------------------
PHYDA_ECO57     ----------------------------------------------------------------------
PHYDA_ECO55     ----------------------------------------------------------------------
PHYDA_ECO24     ----------------------------------------------------------------------
MTAD1_ARCFU     ---------------------------------------------EVFEAATLNGAKAFGI--KSGVIKE
DHP2_CAEBR      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_DESHD      ------DPKLKNGEFMRVWGGISACQTTLQGLLTHAYHDRKFPLVKIAQLTAQHVNEIFKIKD-KGQIAL
ADEC_SILST      ----------------------------------------------------------------------
ADEC_DEHSC      ------FVVDDRSCADLKSDG------DIDAVVRKAIRLGLDPV-RAIQLASINTAEYFHLQG-HGAIAP
PYRC_GEOLS      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
PYRC_BACCR      ----------------------------------------------------------------------
PYRC_BACC4      ----------------------------------------------------------------------
PYRC_METJA      ----------------------------------------------------------------------
PYRC_GEOSF      ----------------------------------------------------------------------
PYRC_BACLD      ----------------------------------------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
ADEC_DESHD      ----------------------------------------------------------------------
PYRC_METMA      ----------------------------------------------------------------------
MTAD_METBU      ASNNNLDMFDEMKTAALLQ-----KVDTMDP--------TALPAKQVLEMATVNGAK--ALDINSGVLRK
HUTI_CHRVO      ----------------------------------------------------------------------
DHP1_CAEEL      ----------------------------------------------------------------------
ADEC_BACP2      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
PYRC_BACC3      ----------------------------------------------------------------------
PYRC_ANOFW      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
DHP1_CAEBR      ----------------------------------------------------------------------
ALLB_BACHD      ----------------------------------------------------------------------
ADEC_OCEIH      ----------------------------------------------------------------------
ADEC_BACLD      ----------------------------------------------------------------------
ADEC_BACA2      ----------------------------------------------------------------------
PYRC_THEAQ      ----------------------------------------------------------------------
PYRC_SULSY      ----------------------------------------------------------------------
PYRC_ENTFA      ----------------------------------------------------------------------
MTAD_DICT6      ----------------------------------------------------------------------
HUTI_GEOTN      ----------------------------------------------------------------------
ALLB_BACSK      ----------------------------------------------------------------------
ADEC_FLAPJ      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------MDNVVRQAIKAGVEPIT-AIQMATINSAEAYRIDHLVGSITP
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_BACWK      ----------------------------------------------------------------------
PYRC_BACHK      ----------------------------------------------------------------------
PYRC_BACCZ      ----------------------------------------------------------------------
PYRC_BACCQ      ----------------------------------------------------------------------
PYRC_BACC7      ----------------------------------------------------------------------
PYRC_BACC1      ----------------------------------------------------------------------
PYRC_BACC0      ----------------------------------------------------------------------
PYRC_BACAN      ----------------------------------------------------------------------
PYRC_BACAH      ----------------------------------------------------------------------
PYRC_BACAC      ----------------------------------------------------------------------
PYRC_BACAA      ----------------------------------------------------------------------
PHYDA_ECOLU     ----------------------------------------------------------------------
MTAD1_SYNAS     ---------------------------------------TLMPAETVVRMATCQGARVLGMDGITGCLKA
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_DEHSB      ------FVVDDRSCADLKSDG------DIDAVVRKAIRLGLDPV-RAIQLASINTAEYFHLQG-HGAIAP
ADEC2_LACSS     QSVTLRETG------------------HLDESIRVAIQNGIDPLT-AIQMATINTAQCTGLSDRGG-IAP
ADEC2_BACSK     ----------------------------------------------------------------------
URE1_PSESM      ----------------------------------------------------------------------
URE1_PSE14      ----------------------------------------------------------------------
URE12_PSEU2     ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_BACC2      ----------------------------------------------------------------------
ADEC4_RHIME     RIVTEMGVKALRRISFCTDDVVASDILSLDNMVRMAMAMGISPM-AAIQMATINGAEALRIDHKVGSISP
ADEC2_CARHZ     -------------------------------------------LPTVLQMATINAANYFRLYDL-GAIAP
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STAES      ----------------------------------------------------------------------
PYRC_STAEQ      ----------------------------------------------------------------------
PYRC_PELCD      ----------------------------------------------------------------------
MTAD_THEMA      ----------------------------------------NLDVNTCLKMVTYDGAQ--AMGFKSGKIEE
HUTI_SHELP      ------------------SSPLCSSLLMLNMGC-TLFRLTP---EEALAGMTRNAAKALGVEDSVGVLKP
HUTI_BACWK      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_METBF      ----------------------------------------------------------------------
ADEC_DESHY      ----------------------------------------------------------------------
PYRC_GEOKA      ----------------------------------------------------------------------
PYRC_BACCN      ----------------------------------------------------------------------
MTAD_METBF      ----------------------------------NTFSPTALPARQVLQMGTVNGAK--ALGTETGMLKV
HUTI_BACCR      ----------------------------------------------------------------------
DHP2_CAEEL      ----------------------------------------------------------------------
ADEC_META3      FKLVSDDISVKD----LKEGYL---INTLKKAVKYV-----SPI-EAIQMITINPANYFGLDME---IKP
ADEC_CLOD6      ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_CYTH3      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
ADEC_SERP5      ------------------------------VALLNMLIEQGLPATDVLRMATLNAAIRLQRNDL-GLIAA
Y3032_BACAN     ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_PYRAB      ----------------------------------------------------------------------
PYRC_PELTS      ----------------------------------------------------------------------
PYRC_METTH      ----------------------------------------------------------------------
PYRC_LACLE      ----------------------------------------------------------------------
MTAD_DESRM      ----GTDGTASNNNLDMLEELRAGSFLQ-KVSTMN---PEVIPAYRALQMATIDGALCMGLGDRVGLIKE
MTAD_CLOTE      ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HUTI_BACHK      ----------------------------------------------------------------------
HUTI_BACCQ      ----------------------------------------------------------------------
HUTI_BACC7      ----------------------------------------------------------------------
HUTI_BACC4      ----------------------------------------------------------------------
HUTI_BACC3      ----------------------------------------------------------------------
HUTI_BACC1      ----------------------------------------------------------------------
HUTI_BACC0      ----------------------------------------------------------------------
HUTI_BACAN      ----------------------------------------------------------------------
HUTI_BACAH      ----------------------------------------------------------------------
HUTI_BACAC      ----------------------------------------------------------------------
HUTI_BACAA      ----------------------------------------------------------------------
ADEC_LEUCK      ----------------------------------------------------------------------
ADEC1_OENOB     ----------------------------------------------------------------------
Y1085_PICTO     ----------------------------------------------------------------------
URE1_STACT      ----------------------------------------------------------------------
HUTI_HALMA      ----------------------------------------------------------------------
HUTI_BACCZ      ----------------------------------------------------------------------
ADEC_RHILO      ----------------------------------------------------------------------
ADEC_METKA      ----------------------------------------------------------------------
ADEC_ENTFA      ----------------------------------------------------------------------
URE1_PSEF5      ----------------------------------------------------------------------
URE1_BURVG      ----------------------------------------------------------------------
URE1_BURS3      ----------------------------------------------------------------------
URE1_BURM1      ----------------------------------------------------------------------
URE1_BURCM      ----------------------------------------------------------------------
URE1_BURCJ      ----------------------------------------------------------------------
URE1_BURCH      ----------------------------------------------------------------------
URE1_BURCC      ----------------------------------------------------------------------
URE1_BURCA      ----------------------------------------------------------------------
URE1_BURA4      ----------------------------------------------------------------------
PYRC_PYRFU      ----------------------------------------------------------------------
PYRC_MYCTU      ----------------------------------------------------------------------
PYRC_MYCBO      ----------------------------------------------------------------------
PYRC_LACSS      ----------------------------------------------------------------------
PYRC_BACCL      ----------------------------------------------------------------------
HUTI_IDILO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_SHIFL      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_SHIF8      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ESCF3      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOUT      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOSM      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOSE      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOLU      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOLI      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOLC      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOL6      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOL5      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOK1      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOHS      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECODH      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECOBW      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECO8A      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECO81      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECO7I      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECO5E      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECO57      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECO55      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECO45      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_ECO24      ----------------------------IDALIRRLIEQHNVPLHVAYRVASWSTARHFGL-NHLGLLAP
ADEC_BDEBA      ----------------------------INYLIKELINKHGVAVHVAYRLATYSAARHFGL-KRLGLVAP
PYRC_GEOTN      ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
MTAD_MOOTA      SSNNNLDMVAETRTAALLAKGITGD-------------PTVVPAHQALVMATLNGARALGLEKEIGTLEA
MTAD_METS3      ----------------------------------------------------------------------
MTAD_DICTD      ------------------------------------------PAKEALNMATKNGMEILGFENS-GIIKE
HUTI_THEP3      ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_BREBN      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ADEC_PARDP      ----------------------------------------------------------------------
ADEC1_JANSC     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GYDADLILFDDNIDIKYVIVNGKLVHKA
NAGA_BACSH      GYDADAVIVDEHLLLHQTIKAGRI----
NAGA_VIBCH      GMIANLTVFDRDFNVKATVVNGQ-----
NAGA_BACSU      GKDADLVIVSSDCEVILTICRGNI----
NAGA_ECOLI      GKVANLTAFTPDFKITKTIVNGNEV---
NAGA_ECO57      GKVANLTAFTPDFKITKTIVNGNEV---
NAGA_CAEEL      GRLADFVLIDKNVTVKATFCSGKRVFLA
NAGA_RAT        GADADFVVLDDTLHVQATYISGELVWQA
NAGA_MOUSE      GADADFVVLDDTLHVQATYISGELVWQA
NAGA_HUMAN      GADADFVVLDDSLHVQATYISGELVWQA
NAGA_DANRE      GADADFIVLDDMLTVRETYIAGQQV---
NAGA_BOVIN      GADADFVVLDDSLHVRATYISGELV---
NAGA_HAEIN      GKIANLAVFTPNYQVIGTVVNGK-----
NAGA_VIBFU      GKYASMVAVSSDFSIEKTWVKGRLVFDA
NAGA_DROME      GSDADFVLLDDQLRVLSTWIAGVCVHR-
AGAA_ECOLI      GKRASVVALDSGLHVQQIWIQGQL----
ADEC_DESRM      GKVADIVLLDDLVEIKYVFKNGKLV---
ADEC_CLOBM      GKCADIVLIEDLKDVKIVIIDGNLVAK-
ADEC_CLOB6      GKCADIVLIEDLKDVKIVIIDGNLVAK-
ADEC_CLOB1      GKCADIVFIEDLKDVKIVIIDGNLVAK-
ADEC_CLOBL      GKCADIVFIEDLKDVKIVIIDGNLVAK-
ADEC_THEAB      ----------------------------
ADEC_CLOP1      ----------------------------
PYRC_CARHZ      ----------------------------
PYRC_STAAW      ----------------------------
PYRC_STAAS      ----------------------------
PYRC_STAAR      ----------------------------
PYRC_STAAN      ----------------------------
PYRC_STAAM      ----------------------------
PYRC_STAAC      ----------------------------
ADEC_LACS1      GRRADMVVFE------------------
ADEC_LISIN      ----------------------------
ADEC_DESAA      ----------------------------
ADEC_BACHD      ----------------------------
MTAD_THEON      GYLADIAIIDFN----------------
ADEC2_DESPS     ----------------------------
PYRC_PEDPA      ----------------------------
ADEC_LACDA      ----------------------------
PYRC_LACLA      NGPADLVIFDAENDVKYTICDGKIVYQA
PYRC_CLOCE      ----------------------------
PYRC_LACGA      ----------------------------
HYDL_ARTAU      ----------------------------
ADEC_CLOPE      ----------------------------
PYRC_BACP2      ----------------------------
ADEC_LISMO      ----------------------------
PYRC_ELUMP      ----------------------------
PYRC_CLOBA      GVDADLVLID--IDKKIKVDSNEFISK-
PYRC_AQUAE      ----------------------------
HYDA_PSEPU      ----------------------------
DPYS_SACKL      ----------------------------
ADEC_LISW6      ----------------------------
ADEC_LISMF      ----------------------------
PYRC_LACJO      ----------------------------
MTAD_CALS8      ----------------------------
HUTI_THEVO      ----------------------------
ADEC_THEM4      ----------------------------
PYRC_MACCJ      ----------------------------
MTAD_SYNWW      GYRADMIIMNANIDVNSVIIDGKIV---
ADEC_CLOBA      ----------------------------
PYRC_LISMO      ----------------------------
PYRC_CLOBB      GVEADLVLID--IDKKIKVDSNEFVSK-
PYRC_LACH4      ----------------------------
PYRC_LACDB      ----------------------------
PYRC_LACDA      ----------------------------
MTAD_METMA      ----------------------------
PYRC_GEOMG      ----------------------------
ALLB_BACLD      ----------------------------
IADA_ECOLI      GNDADLLVMTPELRIEQVYARGKLMVK-
PYRC_DESRM      ----------------------------
MTAD_THESM      ----------------------------
MTAD_PYRFU      GYIADLALIN------------------
HYDA_BACST      ----------------------------
ADEC_PETMO      ----------------------------
ADEC_CLOBB      ----------------------------
PYRC_METAC      ----------------------------
PYRC_GEOSW      ----------------------------
PYRC_CORGL      ----------------------------
MTAD_METAC      ----------------------------
HYDA_PSEAE      ----------------------------
HUTI_GEOKA      ----------------------------
ADEC_LYSSC      ----------------------------
ADEC_KOSOT      ----------------------------
PYRC_LACS1      ----------------------------
PYRC_BACHD      ----------------------------
MTAD_HALOH      GYLADIILIGLNNDVTTVIVNGRVIMK-
PYRC_LISW6      ----------------------------
PYRC_LISIN      ----------------------------
PHYDA_ECOUT     ----------------------------
PHYDA_ECOL6     ----------------------------
PHYDA_ECOL5     ----------------------------
PHYDA_ECOK1     ----------------------------
PHYDA_ECO81     ----------------------------
PHYDA_ECO45     ----------------------------
PHYDA_ECO27     ----------------------------
DPYS_DICDI      ----------------------------
ALLB_SALCH      ----------------------------
ALLB_BACA2      ----------------------------
Y3012_BACCR     ----------------------------
PYRC_LYSSC      ----------------------------
MTAD_PYRKO      ----------------------------
ALLB_BACSU      ----------------------------
ADEC_MOOTA      ----------------------------
ADEC_METJA      GNEASFVIFEDNFKVYNIVIKGRFL---
ADEC_CLOAB      ----------------------------
PYRC_LISMF      ----------------------------
PYRC_LISMC      ----------------------------
ADEC_METST      ----------------------------
ADEC_METS3      ----------------------------
ADEC_METBU      GRKADIIVLED-----------------
PYRC_THETN      ----------------------------
PYRC_GEOUR      ----------------------------
ALLB_ECOSE      ----------------------------
ALLB_ECOLU      ----------------------------
ALLB_ECOLI      ----------------------------
ALLB_ECOLC      ----------------------------
ALLB_ECOHS      ----------------------------
ALLB_ECODH      ----------------------------
ALLB_ECOBW      ----------------------------
ALLB_ECO8A      ----------------------------
ALLB_ECO55      ----------------------------
ALLB_ECO24      ----------------------------
ADEC_LACPL      ----------------------------
ADEC_GEOKA      ----------------------------
ADEC_BACSU      GFDADLLFVSDNVTVTMTMVKGQTV---
ADEC1_LACSS     GRNADILLVSDAFEIKRVLAKGQPV---
UNC33_CAEEL     GADADLVIWD------------------
PYRC_LACPL      ----------------------------
ALLB_ENTFA      ----------------------------
ALLB_ECOSM      ----------------------------
PYRC_LISMH      ----------------------------
PYRC_FUSNN      ----------------------------
PYRC_CLOAB      GHRADIVIFDP--DEKYTVKEEEFQSKA
PHYDA_SHIBS     ----------------------------
PHYDA_ECOSE     ----------------------------
PHYDA_ECOLI     ----------------------------
PHYDA_ECOLC     ----------------------------
PHYDA_ECOHS     ----------------------------
PHYDA_ECODH     ----------------------------
PHYDA_ECOBW     ----------------------------
PHYDA_ECO8A     ----------------------------
PHYDA_ECO7I     ----------------------------
PHYDA_ECO57     ----------------------------
PHYDA_ECO55     ----------------------------
PHYDA_ECO24     ----------------------------
MTAD1_ARCFU     GYEADIVLVD------------------
DHP2_CAEBR      ----------------------------
ALLB_ECOUT      ----------------------------
ALLB_ECOL6      ----------------------------
ALLB_ECOL5      ----------------------------
ALLB_ECOK1      ----------------------------
ALLB_ECO81      ----------------------------
ALLB_ECO45      ----------------------------
ALLB_ECO27      ----------------------------
ALLB_DESHY      ----------------------------
ALLB_DESHD      GYDADFALVD--LDHEFTLQAEDLFYK-
ADEC_SILST      ----------------------------
ADEC_DEHSC      GYLANMIVCQEQLDIDMVFHKGKLV---
PYRC_GEOLS      ----------------------------
PYRC_BACSU      ----------------------------
PYRC_BACCR      ----------------------------
PYRC_BACC4      ----------------------------
PYRC_METJA      ----------------------------
PYRC_GEOSF      ----------------------------
PYRC_BACLD      ----------------------------
HUTI_GEOSW      ----------------------------
ALLB_SALTY      ----------------------------
ALLB_SALTI      ----------------------------
ALLB_SALPK      ----------------------------
ALLB_SALPB      ----------------------------
ALLB_SALPA      ----------------------------
ALLB_SALNS      ----------------------------
ALLB_SALHS      ----------------------------
ALLB_SALEP      ----------------------------
ALLB_SALDC      ----------------------------
ALLB_SALA4      ----------------------------
ADEC_DESHD      ----------------------------
PYRC_METMA      ----------------------------
MTAD_METBU      DYNADVIIIDMN----------------
HUTI_CHRVO      ----------------------------
DHP1_CAEEL      ----------------------------
ADEC_BACP2      ----------------------------
PYRC_STRP8      ----------------------------
PYRC_STRP6      ----------------------------
PYRC_STRP3      ----------------------------
PYRC_STRP1      ----------------------------
PYRC_BACC3      ----------------------------
PYRC_ANOFW      ----------------------------
PYRC_ANATD      ----------------------------
HYDA_BURPI      ----------------------------
DHP1_CAEBR      ----------------------------
ALLB_BACHD      ----------------------------
ADEC_OCEIH      ----------------------------
ADEC_BACLD      ----------------------------
ADEC_BACA2      ----------------------------
PYRC_THEAQ      ----------------------------
PYRC_SULSY      ----------------------------
PYRC_ENTFA      ----------------------------
MTAD_DICT6      ----------------------------
HUTI_GEOTN      ----------------------------
ALLB_BACSK      ----------------------------
ADEC_FLAPJ      ----------------------------
ADEC1_DESPS     GKIADIVMVDEGFQVQAVLTDGKLV---
PYRC_LACAC      ----------------------------
PYRC_BACWK      ----------------------------
PYRC_BACHK      ----------------------------
PYRC_BACCZ      ----------------------------
PYRC_BACCQ      ----------------------------
PYRC_BACC7      ----------------------------
PYRC_BACC1      ----------------------------
PYRC_BACC0      ----------------------------
PYRC_BACAN      ----------------------------
PYRC_BACAH      ----------------------------
PYRC_BACAC      ----------------------------
PYRC_BACAA      ----------------------------
PHYDA_ECOLU     ----------------------------
MTAD1_SYNAS     GMKADFILIDLNSDVKTVFINGKMVMK-
HYDA_RHIRD      ----------------------------
ADEC_DEHSB      GYLANMIVCQEQLDIDMVFHKGKLV---
ADEC2_LACSS     GLKADFLLVDDHFNVNQTFIDGQKI---
ADEC2_BACSK     ----------------------------
URE1_PSESM      ----------------------------
URE1_PSE14      ----------------------------
URE12_PSEU2     ----------------------------
PYRC_THEPX      ----------------------------
PYRC_THEP3      ----------------------------
PYRC_STRPN      ----------------------------
PYRC_BACC2      ----------------------------
ADEC4_RHIME     GRTADILIVNDLRDIEAVVANG------
ADEC2_CARHZ     GYRADILVFEDEFKPKYVFKDGKLV---
PYRC_STRR6      ----------------------------
PYRC_STAES      ----------------------------
PYRC_STAEQ      ----------------------------
PYRC_PELCD      ----------------------------
MTAD_THEMA      GWNADLVVIDLDLPEMFPVQNIKLVH--
HUTI_SHELP      GMQADFCLWDYGVDVKEVVKNGKLVHQ-
HUTI_BACWK      ----------------------------
ADEC_STAMF      ----------------------------
ADEC_METBF      ----------------------------
ADEC_DESHY      ----------------------------
PYRC_GEOKA      ----------------------------
PYRC_BACCN      ----------------------------
MTAD_METBF      GMKADLIVVDKGSDVRTTIVNGKVL---
HUTI_BACCR      ----------------------------
DHP2_CAEEL      ----------------------------
ADEC_META3      DNYADLIIFDDEFKINSVIIKGK-----
ADEC_CLOD6      ----------------------------
URE1_SULTO      ----------------------------
URE1_CYTH3      ----------------------------
PYRC_STRT2      ----------------------------
PYRC_STRT1      ----------------------------
ADEC_SERP5      GRVADLVVFDSQLRAQQVYVAGKL----
Y3032_BACAN     ----------------------------
PYRC_SOLUE      ----------------------------
PYRC_PYRAB      ----------------------------
PYRC_PELTS      ----------------------------
PYRC_METTH      ----------------------------
PYRC_LACLE      ----------------------------
MTAD_DESRM      GMRGDVILLDNSSDVRTVVIDGKVV---
MTAD_CLOTE      ----------------------------
MTAD_BACC3      ----------------------------
MTAD_BACC0      ----------------------------
MTAD_BACAN      ----------------------------
MTAD_BACAH      ----------------------------
MTAD_BACAC      ----------------------------
MTAD_BACAA      ----------------------------
HUTI_BACHK      ----------------------------
HUTI_BACCQ      ----------------------------
HUTI_BACC7      ----------------------------
HUTI_BACC4      ----------------------------
HUTI_BACC3      ----------------------------
HUTI_BACC1      ----------------------------
HUTI_BACC0      ----------------------------
HUTI_BACAN      ----------------------------
HUTI_BACAH      ----------------------------
HUTI_BACAC      ----------------------------
HUTI_BACAA      ----------------------------
ADEC_LEUCK      ----------------------------
ADEC1_OENOB     ----------------------------
Y1085_PICTO     ----------------------------
URE1_STACT      ----------------------------
HUTI_HALMA      ----------------------------
HUTI_BACCZ      ----------------------------
ADEC_RHILO      ----------------------------
ADEC_METKA      ----------------------------
ADEC_ENTFA      ----------------------------
URE1_PSEF5      ----------------------------
URE1_BURVG      ----------------------------
URE1_BURS3      ----------------------------
URE1_BURM1      ----------------------------
URE1_BURCM      ----------------------------
URE1_BURCJ      ----------------------------
URE1_BURCH      ----------------------------
URE1_BURCC      ----------------------------
URE1_BURCA      ----------------------------
URE1_BURA4      ----------------------------
PYRC_PYRFU      ----------------------------
PYRC_MYCTU      ----------------------------
PYRC_MYCBO      ----------------------------
PYRC_LACSS      ----------------------------
PYRC_BACCL      ----------------------------
HUTI_IDILO      ----------------------------
ADEC_SHISS      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_SHIFL      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_SHIF8      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ESCF3      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOUT      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOSM      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOSE      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOLU      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOLI      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOLC      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOL6      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOL5      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOK1      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOHS      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECODH      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECOBW      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECO8A      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECO81      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECO7I      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECO5E      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECO57      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECO55      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECO45      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_ECO24      GKQADIVLLSDKVTVQQVLVKGE-----
ADEC_BDEBA      GKKADLVFLKDAVDIQEVMIGGKFV---
PYRC_GEOTN      ----------------------------
PYRC_CLOD6      ----------------------------
NDDD_ALCXX      ----------------------------
MTAD_MOOTA      GKKADLILVDRGSDVDTVIVNGKIL---
MTAD_METS3      ----------------------------
MTAD_DICTD      GYKADLILVNIN----------------
HUTI_THEP3      ----------------------------
HUTI_PARDP      ----------------------------
HUTI_BREBN      ----------------------------
DPYS_MOUSE      ----------------------------
ADEC_PARDP      ----------------------------
ADEC1_JANSC     ----------------------------