[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81914.1

[Show Plain Result]


## Summary of Sequence Search
    1::535
    1::535       0.0 100%  535 aa  PYRG_CLOPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::535       0.0 100%  535 aa  PYRG_CLOPE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::535       0.0 100%  535 aa  PYRG_CLOP1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  77%  536 aa  PYRG_CLOB8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::533       0.0  74%  535 aa  PYRG_CLOAB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  73%  537 aa  PYRG_CLOK5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  534 aa  PYRG_CLOCE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529       0.0  68%  535 aa  PYRG_BACSU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529       0.0  68%  535 aa  PYRG_BACA2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529       0.0  69%  531 aa  PYRG_GEOKA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACAN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACAA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACCZ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACC4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACC1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACC0 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACHK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACCQ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACC7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACC3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACC2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACAH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACCR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACWK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  67%  542 aa  PYRG_CLOTH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  68%  535 aa  PYRG_BACCN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529       0.0  67%  535 aa  PYRG_BACLD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529       0.0  67%  535 aa  PYRG_BACP2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::530       0.0  66%  534 aa  PYRG_BACSK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::530       0.0  66%  532 aa  PYRG_BACHD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529       0.0  68%  535 aa  PYRG_CARHZ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531       0.0  66%  535 aa  PYRG_OCEIH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  65%  532 aa  PYRG_LISMF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  65%  532 aa  PYRG_LISIN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  65%  532 aa  PYRG_LISMO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532       0.0  64%  537 aa  PYRG_THETN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  63%  532 aa  PYRG_DESHY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::525       0.0  66%  537 aa  PYRG_MOOTA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  61%  537 aa  PYRG_NATTJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532       0.0  63%  537 aa  PYRG_PELTS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  60%  542 aa  PYRG_SYNWW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAAB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAA9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAA3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAA2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAA1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  61%  536 aa  PYRG_STAS1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  61%  536 aa  PYRG_STAA8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531       0.0  61%  535 aa  PYRG_STAES RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531       0.0  61%  535 aa  PYRG_STAEQ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  61%  535 aa  PYRG_STAHJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::526       0.0  62%  539 aa  PYRG_STACT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538       0.0  60%  540 aa  PYRG_METJA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  58%  534 aa  PYRG_STRP8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529       0.0  58%  534 aa  PYRG_HERA2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  59%  536 aa  PYRG_STRMU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  58%  555 aa  PYRG_PROM1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  59%  536 aa  PYRG_ENTFA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  58%  555 aa  PYRG_PROMT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  59%  535 aa  PYRG_STRR6 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  59%  535 aa  PYRG_STRPN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  58%  549 aa  PYRG_SYNSC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  58%  534 aa  PYRG_STRT2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::529       0.0  59%  551 aa  PYRG_RUBXD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  58%  558 aa  PYRG_PROM3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  58%  537 aa  PYRG_STRE4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  58%  558 aa  PYRG_PROMM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  58%  534 aa  PYRG_STRT1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  58%  555 aa  PYRG_PROM4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  58%  549 aa  PYRG_SYNS9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  58%  537 aa  PYRG_STRS7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  58%  544 aa  PYRG_SYNPX RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  57%  543 aa  PYRG_SYNPW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  59%  530 aa  PYRG_LACSS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  57%  557 aa  PYRG_SYNS3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::529       0.0  61%  555 aa  PYRG_ROSCS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  59%  535 aa  PYRG_LACLA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533       0.0  59%  535 aa  PYRG_LACLM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::534       0.0  59%  541 aa  PYRG_SYMTH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530       0.0  58%  555 aa  PYRG_ACAM1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  57%  534 aa  PYRG_STRPF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531       0.0  56%  547 aa  PYRG_CYAP8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  57%  534 aa  PYRG_STRPD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  57%  534 aa  PYRG_STRPC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  57%  534 aa  PYRG_STRPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  57%  534 aa  PYRG_STRP6 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  57%  534 aa  PYRG_STRP3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  57%  534 aa  PYRG_STRP1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  57%  544 aa  PYRG_SYNR3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::529       0.0  57%  557 aa  PYRG_ROSS1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::543       0.0  59%  545 aa  PYRG_DESAD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  57%  534 aa  PYRG_STRPM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  56%  534 aa  PYRG_STRA5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528       0.0  57%  551 aa  PYRG_PROMA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  56%  534 aa  PYRG_STRA3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532       0.0  56%  534 aa  PYRG_STRA1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529       0.0  56%  535 aa  PYRG_CYAA5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::528     e-180  57%  536 aa  PYRG_PROM2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-180  58%  549 aa  PYRG_GLOVI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::528     e-180  57%  536 aa  PYRG_PROMS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::528     e-180  57%  536 aa  PYRG_PROM0 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-180  56%  546 aa  PYRG_SYNP6 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528     e-180  57%  538 aa  PYRG_SYNAS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-180  62%  597 aa  PYRG_PELLD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529     e-180  57%  535 aa  PYRG_LACBA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::528     e-180  57%  536 aa  PYRG_PROM5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529     e-180  58%  532 aa  PYRG_LACS1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532     e-179  55%  552 aa  PYRG_SYNP2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-179  56%  546 aa  PYRG_SYNE7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    7::549     e-179  57%  551 aa  PYRG_DESPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::537     e-179  58%  557 aa  PYRG_CHLT3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::536     e-178  55%  542 aa  PYRG_LEPIN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::536     e-178  55%  542 aa  PYRG_LEPIC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530     e-178  55%  558 aa  PYRG_CYAP7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-178  57%  537 aa  PYRG_STRGC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::527     e-178  56%  531 aa  PYRG_AQUAE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-177  56%  543 aa  PYRG_THEEB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::526     e-177  58%  551 aa  PYRG_THERP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-177  57%  537 aa  PYRG_STRSV RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-177  56%  546 aa  PYRG_MICAN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-177  61%  565 aa  PYRG_CHLPD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529     e-177  56%  545 aa  PYRG_ANAVT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529     e-177  56%  545 aa  PYRG_ANASP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-177  55%  552 aa  PYRG_SYNY3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-176  57%  571 aa  PYRG_TRIEI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-176  61%  594 aa  PYRG_PROVI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-176  58%  533 aa  PYRG_METMP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530     e-175  56%  549 aa  PYRG_ACIC5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529     e-175  55%  537 aa  PYRG_LACPL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-175  60%  565 aa  PYRG_PELPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    7::534     e-175  57%  608 aa  PYRG_FRASC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-175  60%  565 aa  PYRG_CHLP8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::533     e-174  56%  551 aa  PYRG_RHOBA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::545     e-174  57%  568 aa  PYRG_SACEN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::530     e-174  55%  534 aa  PYRG_PELCD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::531     e-174  55%  546 aa  PYRG_GRAFK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::528     e-173  54%  546 aa  PYRG_MYXXD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-173  55%  536 aa  PYRG_PROM9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-173  56%  550 aa  PYRG_DESVM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532     e-173  55%  544 aa  PYRG_SYNJA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-173  57%  548 aa  PYRG_DESDG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-173  60%  569 aa  PYRG_CHLL2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532     e-173  57%  534 aa  PYRG_GEOSF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    6::529     e-173  57%  555 aa  PYRG_ANADF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-172  56%  547 aa  PYRG_DESVV RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-172  56%  547 aa  PYRG_DESVH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-172  55%  544 aa  PYRG_SYNJB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-172  57%  543 aa  PYRG_THICR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::523     e-172  53%  534 aa  PYRG_HYDS0 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-171  54%  540 aa  PYRG_LACJO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-171  56%  558 aa  PYRG_ACIBL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-171  56%  539 aa  PYRG_LACDA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::537     e-171  57%  540 aa  PYRG_ONYPE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-171  55%  539 aa  PYRG_LACAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-171  56%  542 aa  PYRG_HAHCH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::535     e-170  54%  537 aa  PYRG_FLAPJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    6::541     e-170  56%  552 aa  PYRG_THEFY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::528     e-170  54%  536 aa  PYRG_PROMP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-170  56%  539 aa  PYRG_LACDB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::552     e-169  56%  590 aa  PYRG_MYCS2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::523     e-169  54%  537 aa  PYRG_FLAJ1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-169  56%  543 aa  PYRG_SACD2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::533     e-169  54%  536 aa  PYRG_TREDE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::531     e-169  54%  539 aa  PYRG_LACH4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532     e-169  56%  536 aa  PYRG_GEOSL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-168  56%  583 aa  PYRG_MYCMM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::528     e-168  54%  549 aa  PYRG_CYAP4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::531     e-168  54%  539 aa  PYRG_CYTH3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-168  59%  569 aa  PYRG_CHLCH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-168  54%  565 aa  PYRG_SALRD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-168  55%  551 aa  PYRG_HALHL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::534     e-168  55%  534 aa  PYRG_BDEBA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-168  57%  545 aa  PYRG_ALCBS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-167  56%  583 aa  PYRG_MYCUA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    7::548     e-167  54%  569 aa  PYRG_NOCSJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::549     e-167  56%  585 aa  PYRG_MYCGI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   14::550     e-167  54%  553 aa  PYRG_BIFLO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-167  56%  590 aa  PYRG_MYCLE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-167  56%  590 aa  PYRG_MYCLB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532     e-167  56%  538 aa  PYRG_GEOMG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-167  56%  586 aa  PYRG_MYCTU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-167  56%  586 aa  PYRG_MYCTA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-167  56%  586 aa  PYRG_MYCBT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-167  56%  586 aa  PYRG_MYCBP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-167  56%  586 aa  PYRG_MYCBO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::541     e-167  55%  546 aa  PYRG_DECAR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::536     e-167  56%  536 aa  PYRG_AYWBP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::554     e-166  56%  566 aa  PYRG_LEIXX RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::528     e-166  55%  545 aa  PYRG_AZOSE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-166  55%  540 aa  PYRG_ALHEH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::529     e-166  55%  535 aa  PYRG_PELPD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-166  56%  546 aa  PYRG_AZOSB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529     e-165  54%  545 aa  PYRG_NOSP7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::540     e-165  55%  542 aa  PYRG_METFK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-165  55%  555 aa  PYRG_COXB1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-165  55%  555 aa  PYRG_COXBN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::552     e-165  56%  583 aa  PYRG_MYCVP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530     e-165  54%  533 aa  PYRG_PYRKO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-165  55%  555 aa  PYRG_COXBR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-165  55%  555 aa  PYRG_COXBU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-165  55%  555 aa  PYRG_COXB2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-164  54%  542 aa  PYRG_META3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532     e-164  54%  535 aa  PYRG_GEOLS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   13::544     e-164  56%  550 aa  PYRG_THET2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530     e-164  54%  533 aa  PYRG_THEGJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   13::544     e-164  56%  550 aa  PYRG_THET8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    6::535     e-164  54%  555 aa  PYRG_ANADE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    6::535     e-164  54%  555 aa  PYRG_ANAD2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-164  53%  544 aa  PYRG_NEIM0 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-164  54%  546 aa  PYRG_VIBHB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::541     e-164  54%  546 aa  PYRG_FRAP2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::552     e-164  55%  591 aa  PYRG_RHOSR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-163  55%  542 aa  PYRG_MARAV RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::548     e-163  55%  554 aa  PYRG_CORGL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::548     e-163  55%  554 aa  PYRG_CORGB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    6::535     e-163  54%  555 aa  PYRG_ANASK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-163  54%  546 aa  PYRG_VIBPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::547     e-163  56%  550 aa  PYRG_LAWIP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::540     e-163  53%  558 aa  PYRG_ACIC1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::552     e-163  55%  589 aa  PYRG_RHOOB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-163  54%  545 aa  PYRG_VIBVY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-163  54%  545 aa  PYRG_VIBVU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-163  54%  545 aa  PYRG_PSYIN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::531     e-163  54%  534 aa  PYRG_GEOUR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::530     e-163  54%  533 aa  PYRG_THEON RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-163  53%  544 aa  PYRG_NEIMB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-163  52%  544 aa  PYRG_NEIG2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-163  52%  544 aa  PYRG_NEIG1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-163  59%  564 aa  PYRG_PROA2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-163  54%  555 aa  PYRG_STRGG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529     e-162  55%  566 aa  PYRG_NITMU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   26::524     e-162  56%  546 aa  PYRG_CHLSY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   26::524     e-162  56%  546 aa  PYRG_CHLAA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-162  54%  564 aa  PYRG_NITEC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-162  55%  544 aa  PYRG_GRABC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::543     e-162  53%  546 aa  PYRG_FRATW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::543     e-162  53%  546 aa  PYRG_FRATT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::543     e-162  53%  546 aa  PYRG_FRATN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::543     e-162  53%  546 aa  PYRG_FRAT1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-162  54%  545 aa  PYRG_VIBCM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-162  54%  545 aa  PYRG_VIBCH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-162  54%  545 aa  PYRG_VIBC3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-162  54%  545 aa  PYRG_ACTP2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::543     e-162  53%  546 aa  PYRG_FRATO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::543     e-162  53%  546 aa  PYRG_FRATH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::543     e-162  53%  546 aa  PYRG_FRATF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-162  54%  545 aa  PYRG_ACTPJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-162  54%  545 aa  PYRG_ACTP7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-162  54%  564 aa  PYRG_NITEU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::535     e-162  55%  562 aa  PYRG_PROAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-161  53%  546 aa  PYRG_SHESR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-161  54%  543 aa  PYRG_PSEF5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::541     e-161  53%  543 aa  PYRG_PSYWF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-161  54%  546 aa  PYRG_VIBFM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-161  53%  545 aa  PYRG_SHESW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-161  53%  545 aa  PYRG_SHEPC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::543     e-161  55%  546 aa  PYRG_FRATM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-161  53%  544 aa  PYRG_DICNV RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-161  54%  543 aa  PYRG_PSE14 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   26::524     e-161  55%  547 aa  PYRG_CHLAD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-161  54%  543 aa  PYRG_PSEFS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-161  54%  546 aa  PYRG_VIBSL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-161  53%  545 aa  PYRG_SHEB9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-161  53%  545 aa  PYRG_SHEB8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-161  53%  545 aa  PYRG_SHEB5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-161  55%  583 aa  PYRG_MYCPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::549     e-161  55%  583 aa  PYRG_MYCA1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-160  53%  546 aa  PYRG_SHESA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-160  53%  546 aa  PYRG_SHESM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::549     e-160  53%  554 aa  PYRG_CORK4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-160  53%  545 aa  PYRG_SHEB2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-160  54%  543 aa  PYRG_PSEU2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-160  53%  542 aa  PYRG_PSEPW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-160  53%  542 aa  PYRG_PSEPK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-160  53%  542 aa  PYRG_PSEP1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530     e-160  53%  537 aa  PYRG_PYRHO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-160  54%  543 aa  PYRG_PSESM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-160  54%  543 aa  PYRG_PSEPF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-160  54%  544 aa  PYRG_HAEPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-160  55%  544 aa  PYRG_PSYA2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::533     e-160  53%  542 aa  PYRG_PARUW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::537     e-160  56%  565 aa  PYRG_CHLTE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::541     e-160  51%  545 aa  PYRG_BUCAT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-160  53%  546 aa  PYRG_SHEPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-160  54%  544 aa  PYRG_PSYCK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-160  53%  542 aa  PYRG_PSEPG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530     e-159  56%  537 aa  PYRG_PYRFU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-159  55%  545 aa  PYRG_LEGPL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::524     e-159  54%  532 aa  PYRG_ARCFU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  53%  545 aa  PYRG_AERHH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  53%  546 aa  PYRG_VIBF1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  54%  545 aa  PYRG_TOLAT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-159  53%  542 aa  PYRG_PSEAE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-159  53%  542 aa  PYRG_PSEAB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-159  53%  542 aa  PYRG_PSEA8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-159  53%  542 aa  PYRG_PSEA7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-159  52%  545 aa  PYRG_SHEDO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-159  55%  545 aa  PYRG_LEGPH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-159  55%  545 aa  PYRG_LEGPC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-159  55%  545 aa  PYRG_LEGPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::541     e-159  51%  545 aa  PYRG_BUCA5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  52%  546 aa  PYRG_SHEON RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  53%  545 aa  PYRG_SHEWM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530     e-159  53%  537 aa  PYRG_PYRAB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  53%  545 aa  PYRG_SHEFN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::535     e-159  53%  553 aa  PYRG_BUCAP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::541     e-159  51%  545 aa  PYRG_BUCAI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  53%  545 aa  PYRG_SHEAM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  52%  545 aa  PYRG_SALNS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-159  53%  545 aa  PYRG_AERS4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALTY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALTI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALSV RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALPC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALHS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALG2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALEP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALDC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALCH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-158  55%  543 aa  PYRG_ACICJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-158  53%  545 aa  PYRG_ACIBC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALPK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  52%  545 aa  PYRG_SALA4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-158  53%  544 aa  PYRG_LARHH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  53%  545 aa  PYRG_HAEDU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-158  52%  542 aa  PYRG_PSEE4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-158  53%  552 aa  PYRG_METCA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   22::528     e-158  53%  544 aa  PYRG_DEHSC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   22::528     e-158  53%  544 aa  PYRG_DEHSB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  53%  545 aa  PYRG_CITK8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-158  53%  545 aa  PYRG_ACIBY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-158  53%  545 aa  PYRG_ACIBT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-158  53%  545 aa  PYRG_ACIBS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-158  53%  545 aa  PYRG_ACIB5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-158  53%  545 aa  PYRG_ACIB3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  53%  546 aa  PYRG_SHEHH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-158  54%  550 aa  PYRG_NITOC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-158  54%  542 aa  PYRG_MESSB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::538     e-158  56%  544 aa  PYRG_ZYMMO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::551     e-158  53%  555 aa  PYRG_CORJK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-158  53%  546 aa  PYRG_ALISL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::529     e-158  56%  565 aa  PYRG_CHLPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-158  53%  546 aa  PYRG_THIDA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-158  53%  543 aa  PYRG_PSEU5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-158  53%  543 aa  PYRG_ALTMD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-157  52%  545 aa  PYRG_SALAR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-157  52%  545 aa  PYRG_KLEP3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-157  54%  547 aa  PYRG_THISH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-157  52%  545 aa  PYRG_KLEP7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-157  52%  545 aa  PYRG_SHELP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-157  53%  543 aa  PYRG_PSEA6 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-157  54%  543 aa  PYRG_CAMJ8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532     e-157  51%  543 aa  PYRG_BAUCH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::532     e-157  53%  545 aa  PYRG_TROWT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::532     e-157  53%  545 aa  PYRG_TROW8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::534     e-157  53%  547 aa  PYRG_PHYAS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-157  54%  543 aa  PYRG_CAMJR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-157  54%  543 aa  PYRG_CAMJJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-157  53%  543 aa  PYRG_PSEMY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-157  52%  545 aa  PYRG_SHESH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-157  52%  542 aa  PYRG_MANSM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-157  52%  545 aa  PYRG_ERWT9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-157  53%  546 aa  PYRG_CHRVO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-157  53%  543 aa  PYRG_CAMJD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   22::528     e-157  53%  544 aa  PYRG_DEHE1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-157  54%  542 aa  PYRG_BRUA1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-157  51%  544 aa  PYRG_NEIMF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-157  53%  545 aa  PYRG_HAEI8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-157  54%  542 aa  PYRG_BRUSI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-157  54%  542 aa  PYRG_BRUME RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-156  51%  544 aa  PYRG_NEIMA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-156  53%  543 aa  PYRG_CAMJE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  54%  542 aa  PYRG_BRUO2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  54%  542 aa  PYRG_BRUMB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  54%  542 aa  PYRG_BRUAB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  54%  542 aa  PYRG_BRUA2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::538     e-156  52%  545 aa  PYRG_PROMH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-156  53%  545 aa  PYRG_HAEIG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-156  53%  545 aa  PYRG_HAEIE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-156  53%  545 aa  PYRG_HAEIN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_PHOPR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_SERP5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ENT38 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERE8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_SHISS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_SHIFL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_SHIF8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_SHIDS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_SHIBS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_SHIB3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ESCF3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOUT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOSM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOSE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOLU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOLI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOLC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOL6 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOL5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOK1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOHS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECODH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECOBW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO8A RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO81 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO7I RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO5E RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO57 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO55 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO45 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO24 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_ECO27 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::541     e-156  52%  547 aa  PYRG_DESDA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_PECCP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  53%  542 aa  PYRG_BRUSU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  53%  542 aa  PYRG_BRUC2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERPY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERPP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERPN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERPG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERPE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  52%  545 aa  PYRG_YERP3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-156  53%  542 aa  PYRG_OCHA4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::530     e-156  51%  532 aa  PYRG_MYCMS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-155  53%  543 aa  PYRG_NOVAD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-155  52%  545 aa  PYRG_EDWI9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-155  52%  545 aa  PYRG_ERWCT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::525     e-155  52%  534 aa  PYRG_METBU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-155  53%  545 aa  PYRG_ACIAD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::530     e-155  51%  532 aa  PYRG_MYCCT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-155  53%  542 aa  PYRG_COLP3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-155  52%  542 aa  PYRG_PASMU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   24::529     e-155  54%  533 aa  PYRG_METTH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::539     e-155  53%  573 aa  PYRG_NOCFA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-155  53%  543 aa  PYRG_GLUOX RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::546     e-155  51%  549 aa  PYRG_STRCO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   11::530     e-154  53%  548 aa  PYRG_NATPD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-154  53%  542 aa  PYRG_MARMM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-154  51%  541 aa  PYRG_MAGSA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::539     e-154  52%  543 aa  PYRG_AZOVD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::546     e-154  52%  549 aa  PYRG_STRAW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   41::552     e-154  54%  579 aa  PYRG_MYCSS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   41::552     e-154  54%  579 aa  PYRG_MYCSK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   41::552     e-154  54%  579 aa  PYRG_MYCSJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-153  52%  543 aa  PYRG_RHOPT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-153  52%  543 aa  PYRG_RHOPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::538     e-153  52%  544 aa  PYRG_HYPNA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   16::541     e-153  53%  553 aa  PYRG_HALMA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-153  52%  542 aa  PYRG_ACTSZ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::528     e-153  52%  531 aa  PYRG_SULTO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-153  52%  542 aa  PYRG_RHORT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-153  52%  552 aa  PYRG_BURA4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-153  55%  544 aa  PYRG_ERYLH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-153  52%  553 aa  PYRG_BURM1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-153  51%  543 aa  PYRG_BRAJA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-153  51%  552 aa  PYRG_BURVG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::532     e-153  49%  533 aa  PYRG_BACFR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::532     e-153  49%  533 aa  PYRG_BACFN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-153  53%  554 aa  PYRG_XYLFA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-153  51%  542 aa  PYRG_NITHX RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::546     e-153  52%  552 aa  PYRG_DELAS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::528     e-153  54%  539 aa  PYRG_CHLFF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-153  52%  550 aa  PYRG_BURS3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-152  50%  545 aa  PYRG_SODGM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-152  52%  566 aa  PYRG_POLNA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::538     e-152  50%  548 aa  PYRG_BLOPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::541     e-152  50%  550 aa  PYRG_BLOFL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_XANCB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_XANCP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_XANC8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-152  53%  543 aa  PYRG_SPHAL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_STRMK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_STRM5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::535     e-152  52%  535 aa  PYRG_SPICI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::528     e-152  54%  537 aa  PYRG_CHLAB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_XANC5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   21::529     e-152  53%  535 aa  PYRG_METKA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-152  51%  548 aa  PYRG_BORPD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::527     e-152  52%  529 aa  PYRG_SULAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_XYLFT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_XYLFM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-152  52%  554 aa  PYRG_XYLF2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::531     e-152  50%  535 aa  PYRG_SULSO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-152  51%  543 aa  PYRG_RHOP5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-152  51%  552 aa  PYRG_BURCM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-151  52%  554 aa  PYRG_XANAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-151  51%  545 aa  PYRG_PHOLL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-151  53%  542 aa  PYRG_SINMW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-151  52%  542 aa  PYRG_RHIME RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::534     e-151  49%  539 aa  PYRG_PORG3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-151  51%  543 aa  PYRG_NITWN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-151  51%  545 aa  PYRG_ENTS8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-151  53%  548 aa  PYRG_CHRSD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::535     e-151  50%  537 aa  PYRG_BACTN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-151  52%  543 aa  PYRG_RHOP2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::534     e-151  49%  539 aa  PYRG_PORGI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-151  52%  554 aa  PYRG_XANOR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-151  52%  554 aa  PYRG_XANOP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-151  52%  554 aa  PYRG_XANOM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-151  51%  552 aa  PYRG_BURCJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-151  51%  552 aa  PYRG_BURCC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-151  52%  542 aa  PYRG_AGRT5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-151  51%  552 aa  PYRG_BURCH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-151  51%  552 aa  PYRG_BURCA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::532     e-151  51%  538 aa  PYRG_AERPE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::540     e-151  50%  547 aa  PYRG_JANMA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::535     e-151  52%  545 aa  PYRG_NAUPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-151  51%  542 aa  PYRG_RHOCS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-151  50%  545 aa  PYRG_HAMD5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-151  51%  543 aa  PYRG_BRASB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-150  50%  550 aa  PYRG_BORPE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-150  50%  550 aa  PYRG_BORPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-150  50%  550 aa  PYRG_BORBR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::535     e-150  52%  542 aa  PYRG_RHILW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-150  52%  542 aa  PYRG_METC4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-150  50%  550 aa  PYRG_BORA1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::535     e-150  52%  542 aa  PYRG_RHIL3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-150  51%  542 aa  PYRG_METS4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-150  51%  543 aa  PYRG_BRASO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::529     e-150  49%  529 aa  PYRG_WOLPM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::546     e-150  50%  552 aa  PYRG_ACISJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-150  52%  542 aa  PYRG_RHILO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::533     e-150  52%  555 aa  PYRG_HALWD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-150  52%  542 aa  PYRG_METRJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-150  51%  542 aa  PYRG_BARHE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::538     e-149  52%  544 aa  PYRG_SPHWW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-149  52%  542 aa  PYRG_METPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::531     e-149  49%  544 aa  PYRG_BUCBP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-149  51%  557 aa  PYRG_BURPP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::526     e-149  51%  531 aa  PYRG_PYRCJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-149  51%  542 aa  PYRG_METSB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-149  50%  552 aa  PYRG_HERAR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::528     e-149  53%  537 aa  PYRG_CHLCV RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-149  51%  557 aa  PYRG_BURXL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::541     e-149  51%  547 aa  PYRG_RHOS4 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-149  51%  543 aa  PYRG_RHOPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-149  51%  550 aa  PYRG_CAUSK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-149  51%  542 aa  PYRG_SULDN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::541     e-149  51%  547 aa  PYRG_RHOSK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::541     e-149  51%  547 aa  PYRG_RHOS1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::535     e-149  51%  542 aa  PYRG_RHIEC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::535     e-149  51%  542 aa  PYRG_RHIE6 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::532     e-149  49%  532 aa  PYRG_EHRCR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   34::538     e-149  53%  553 aa  PYRG_DEIGD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-149  51%  542 aa  PYRG_METNO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-148  51%  544 aa  PYRG_PSEHT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::539     e-148  52%  546 aa  PYRG_PHEZH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-148  51%  553 aa  PYRG_BURM9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-148  50%  559 aa  PYRG_VARPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::541     e-148  51%  547 aa  PYRG_RHOS5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::530     e-148  51%  537 aa  PYRG_COPPD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::543     e-148  51%  547 aa  PYRG_JANSC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::546     e-148  53%  559 aa  PYRG_COREF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::541     e-148  51%  553 aa  PYRG_BURP8 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::527     e-148  52%  546 aa  PYRG_METTP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-148  52%  545 aa  PYRG_IDILO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-148  52%  542 aa  PYRG_BART1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-148  51%  553 aa  PYRG_BURPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-148  51%  553 aa  PYRG_BURP1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-148  51%  553 aa  PYRG_BURMS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-148  51%  553 aa  PYRG_BURMA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-148  51%  553 aa  PYRG_BURM7 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-148  52%  542 aa  PYRG_BARQU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-148  51%  547 aa  PYRG_SILPO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-148  51%  547 aa  PYRG_SILST RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-148  50%  542 aa  PYRG_HAES1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::546     e-147  50%  552 aa  PYRG_DIAST RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    6::533     e-147  48%  538 aa  PYRG_EHRCJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-147  51%  550 aa  PYRG_CAUCR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::543     e-147  51%  550 aa  PYRG_CAUCN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-147  51%  553 aa  PYRG_BURTA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::532     e-147  50%  532 aa  PYRG_MESFL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    6::533     e-147  50%  540 aa  PYRG_EHRRW RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    6::533     e-147  50%  543 aa  PYRG_EHRRG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-146  50%  553 aa  PYRG_POLSQ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-146  50%  563 aa  PYRG_POLSJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   22::523     e-146  53%  534 aa  PYRG_METST RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-146  51%  542 aa  PYRG_BEII9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::537     e-146  51%  543 aa  PYRG_GLUDA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::546     e-146  49%  559 aa  PYRG_ACIAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-146  50%  542 aa  PYRG_PARL1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::540     e-146  51%  547 aa  PYRG_DINSH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::528     e-145  51%  537 aa  PYRG_CHLPN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-145  51%  544 aa  PYRG_AZOBR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-145  50%  555 aa  PYRG_RHOFD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-145  50%  550 aa  PYRG_RALEH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::518     e-145  50%  534 aa  PYRG_PICTO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::536     e-145  51%  542 aa  PYRG_BARBK RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::537     e-145  50%  543 aa  PYRG_RHOPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-145  50%  550 aa  PYRG_RALEJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::534     e-145  49%  540 aa  PYRG_RICBR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-145  49%  550 aa  PYRG_CUPTR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-145  49%  554 aa  PYRG_RALSO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::545     e-145  50%  558 aa  PYRG_POLNS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   34::542     e-145  53%  556 aa  PYRG_DEIDV RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::543     e-145  50%  547 aa  PYRG_ROSDO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::546     e-144  50%  552 aa  PYRG_WOLSU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::542     e-144  49%  546 aa  PYRG_WIGBR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::526     e-144  51%  539 aa  PYRG_CHLTA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::530     e-144  49%  542 aa  PYRG_CALMQ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::554     e-144  50%  563 aa  PYRG_LEPCP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::526     e-144  51%  539 aa  PYRG_CHLTR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::526     e-144  51%  539 aa  PYRG_CHLTB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::526     e-144  51%  539 aa  PYRG_CHLT2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::522     e-144  50%  540 aa  PYRG_THEVO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-144  49%  549 aa  PYRG_RALME RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-144  49%  553 aa  PYRG_RALPJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::535     e-143  51%  553 aa  PYRG_HALSA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::535     e-143  51%  553 aa  PYRG_HALS3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::544     e-143  50%  547 aa  PYRG_PARDP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::528     e-143  52%  536 aa  PYRG_CHLMU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::542     e-143  49%  554 aa  PYRG_VEREI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::531     e-141  47%  537 aa  PYRG_RICFE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::523     e-141  51%  529 aa  PYRG_METMJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::538     e-141  49%  540 aa  PYRG_HELHP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::535     e-140  48%  541 aa  PYRG_ANAPZ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::538     e-140  49%  538 aa  PYRG_PELUB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::531     e-140  47%  537 aa  PYRG_RICRS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::531     e-140  47%  537 aa  PYRG_RICRO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::532     e-140  48%  539 aa  PYRG_WOLTR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::531     e-139  47%  537 aa  PYRG_RICPU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   34::542     e-139  51%  544 aa  PYRG_DEIRA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::531     e-139  47%  537 aa  PYRG_RICCN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::523     e-138  50%  526 aa  PYRG_METB6 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::546     e-138  49%  548 aa  PYRG_NEOSM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::523     e-138  49%  534 aa  PYRG_METMA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-138  49%  545 aa  PYRG_ACIF5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::536     e-138  49%  545 aa  PYRG_ACIF2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::524     e-136  50%  527 aa  PYRG_METLZ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::503     e-135  49%  534 aa  PYRG_METAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    4::520     e-135  48%  526 aa  PYRG_THEAB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::522     e-134  50%  525 aa  PYRG_METPE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::577     e-133  48%  586 aa  PYRG_RICPR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::577     e-133  47%  583 aa  PYRG_RICTY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::503     e-133  48%  534 aa  PYRG_METBF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   26::517     e-132  49%  530 aa  PYRG_PYRAE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::522     e-131  46%  545 aa  PYRG_THEAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::536     e-131  46%  538 aa  PYRG_HELPJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::536     e-130  46%  538 aa  PYRG_HELPY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::536     e-129  46%  538 aa  PYRG_HELPH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::537     e-128  45%  560 aa  PYRG_ANAMM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    8::537     e-128  45%  560 aa  PYRG_ANAMF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::523     e-127  48%  527 aa  PYRG_METHJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::573     e-126  47%  577 aa  PYRG_TREPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::573     e-126  47%  577 aa  PYRG_TREPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   26::547     e-125  47%  578 aa  PYRG2_XENLA RecName: Full=CTP synthase 2;       
    2::550     e-125  46%  644 aa  PYRG_DROPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::549     e-124  46%  627 aa  PYRG_DROME RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   20::556     e-124  48%  578 aa  PYRG_CANGA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    3::514     e-124  47%  524 aa  PYRG_THEMA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-123  44%  586 aa  PYRG2_CHICK RecName: Full=CTP synthase 2;       
    2::538     e-123  46%  586 aa  PYRG2_MOUSE RecName: Full=CTP synthase 2;       
    2::538     e-123  46%  586 aa  PYRG2_RAT RecName: Full=CTP synthase 2;         EC=6.3.4.2;AltName:
    2::538     e-122  45%  586 aa  PYRG2_BOVIN RecName: Full=CTP synthase 2;       
   20::558     e-121  47%  576 aa  PYRG_ASHGO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::538     e-121  45%  586 aa  PYRG2_HUMAN RecName: Full=CTP synthase 2;       
    2::563     e-119  45%  569 aa  PYRG_DICDI RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::548     e-118  44%  591 aa  PYRG1_MOUSE RecName: Full=CTP synthase 1;       
    1::533     e-118  42%  533 aa  PYRG_BORGA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   26::548     e-117  45%  591 aa  PYRG1_HUMAN RecName: Full=CTP synthase 1;       
   38::553     e-117  47%  600 aa  PYRG_SCHPO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::533     e-117  42%  533 aa  PYRG_BORBU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   26::538     e-117  45%  591 aa  PYRG1_DANRE RecName: Full=CTP synthase 1;       
    1::533     e-116  42%  533 aa  PYRG_BORAP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::538     e-112  39%  539 aa  PYRG_MYCPU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    2::548     e-112  42%  591 aa  PYG1B_XENLA RecName: Full=CTP synthase 1-B;       
   26::548     e-112  44%  591 aa  PYG1A_XENLA RecName: Full=CTP synthase 1-A;       
   20::556     e-110  43%  579 aa  URA7_YEAST RecName: Full=CTP synthase 1;       
   20::558     e-109  43%  578 aa  URA8_YEAST RecName: Full=CTP synthase 2;       
   20::558     e-109  43%  578 aa  URA8_YEAS7 RecName: Full=CTP synthase 2;       
   27::542     e-108  45%  568 aa  PYRG_NEUCR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::540     4e-99  37%  542 aa  PYRG_UREPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::446     2e-98  46%  447 aa  PYRG1_CRIGR RecName: Full=CTP synthase 1;       
   26::553     3e-97  42%  580 aa  PYRG_GIBZE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   26::530     2e-91  41%  535 aa  PYRG_ENCCU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    1::133     8e-40  60%  133 aa  PYRG_FIBSU RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::97      3e-22  48%   99 aa  PYRG_MYCCC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   55::243     2e-06  30%  254 aa  PUUD_SHISS RecName: Full=Gamma-glutamyl-gamma-aminobutyrate
   55::243     2e-06  30%  254 aa  PUUD_ECOLI RecName: Full=Gamma-glutamyl-gamma-aminobutyrate
   55::243     2e-06  30%  254 aa  PUUD_ECO57 RecName: Full=Gamma-glutamyl-gamma-aminobutyrate
   55::243     1e-05  30%  254 aa  PUUD_SHIFL RecName: Full=Gamma-glutamyl-gamma-aminobutyrate
    3::109     4e-05  41%  232 aa  PURQ_METMA RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::109     5e-05  42%  232 aa  PURQ_METBF RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::100     8e-05  40%  232 aa  PURQ_METAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::89      1e-04  47%  223 aa  PURQ_STAS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::90      1e-04  45%  227 aa  PURQ_BACSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::183     1e-04  29%  208 aa  HIS5_LISIN RecName: Full=Imidazole glycerol phosphate synthase
   11::93      1e-04  45%  227 aa  PURQ_BACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   28::198     2e-04  34%  223 aa  PURQ_COREF RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::87      2e-04  51%  216 aa  HIS5_SYNJA RecName: Full=Imidazole glycerol phosphate synthase
    8::97      2e-04  37%  209 aa  HIS5_BACC2 RecName: Full=Imidazole glycerol phosphate synthase
   39::87      3e-04  51%  218 aa  HIS5_SYNJB RecName: Full=Imidazole glycerol phosphate synthase
   24::89      4e-04  48%  223 aa  PURQ_STAAW RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::89      4e-04  48%  223 aa  PURQ_STAAS RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::89      4e-04  44%  223 aa  PURQ_STAAR RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::89      4e-04  48%  223 aa  PURQ_STAAN RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::89      4e-04  48%  223 aa  PURQ_STAAM RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::89      4e-04  48%  223 aa  PURQ_STAAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::89      4e-04  48%  223 aa  PURQ_STAAB RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::89      4e-04  48%  223 aa  PURQ_STAA8 RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::89      4e-04  48%  223 aa  PURQ_STAA3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::89      5e-04  55%  223 aa  PURQ_STAES RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::89      5e-04  55%  223 aa  PURQ_STAEQ RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::90      5e-04  43%  227 aa  PURQ_BACA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::91      7e-04  45%  228 aa  PURQ_OCEIH RecName: Full=Phosphoribosylformylglycinamidine synthase
   29::90      7e-04  51%  227 aa  PURQ_LYSSC RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::96      7e-04  43%  233 aa  PURQ_FRASC RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::91      7e-04  42%  225 aa  PURQ_CORAM RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::90      7e-04  47%  227 aa  PURQ_BACP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::123     7e-04  32%  525 aa  GUAA_ALTMD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   36::93      9e-04  51%  227 aa  PURQ_BACWK RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::93      9e-04  43%  227 aa  PURQ_BACCN RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::96      9e-04  39%  196 aa  PDXT_BACCN RecName: Full=Glutamine amidotransferase subunit pdxT;  
   37::85      9e-04  44%  212 aa  HIS5_SYMTH RecName: Full=Imidazole glycerol phosphate synthase
    8::83      9e-04  40%  209 aa  HIS5_BACC4 RecName: Full=Imidazole glycerol phosphate synthase
  224::293     9e-04  33%  377 aa  CARA_NEIMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::535

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
PYRG_CLOPS      MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
PYRG_CLOPE      MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
PYRG_CLOP1      MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
PYRG_CLOB8      ---STKYVFVTGGVVSALGKGITAASLGRLLKNRGVKISIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_CLOAB      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_CLOK5      ---NTKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTDDGAE
PYRG_CLOCE      ---SVKYIFVTGGVVSGLGKGITAASLGRLLKARGVHVTIQKFDPYINVDPGTMSPYQHGEVFVTEDGAE
PYRG_BACSU      ----TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACA2      ----TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGMSVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_GEOKA      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACAN      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACAC      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACAA      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACCZ      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACC4      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACC1      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACC0      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACHK      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACCQ      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACC7      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACC3      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACC2      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACAH      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACCR      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACWK      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_CLOTH      ---SVKYIFVTGGVVSGLGKGITAASLGRLLKARGLRVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACCN      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACLD      ----TKYIFVTGGVVSSLGKGITASSLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACP2      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGMDVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACSK      -----KYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_BACHD      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGMKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_CARHZ      ----TKFIFVTGGVVSSLGKGITAASLGRLLKSRGLKVAIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_OCEIH      ----TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVFVTQDGAE
PYRG_LISMF      ----TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_LISIN      ----TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_LISMO      ----TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_THETN      -----KYIFVTGGVVSSLGKGITAAXXXXXXXXXXXXVAMQKFDPYINIDPGTMSPYQHGEVFVTEDGAE
PYRG_DESHY      ----TKFIFVTGGVVSSLGKGITASALGCLLKNRGLSVAIQKFDPYINIDPGTMSPYQHGEVFVTDDGAE
PYRG_MOOTA      -----KFIFVTGGVTSSLGKGITAASLGRLLKSRGLKVAIQKFDPYINIDPGTMSPYQHGEVFVTDDGAE
PYRG_NATTJ      ----SKYIFVTGGVASSLGKGISAASIGRLLKNRGLNVTIQKFDPYINIDPGTMSPYQHGEVFVTEDGAE
PYRG_PELTS      -----KFVFVTGGVVSSLGKGITAASLGRLLKSRGLKVAIQKLDPYINVDPGTMSPYQHGEVFVTEDGAE
PYRG_SYNWW      ----TKYIFITGGVVSSLGKGITAASXXXXXXXXXXXVALQKFDPYINVDPGTMSPYQHGEVYVTEDGAE
PYRG_STAAW      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAAT      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAAS      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAAR      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAAN      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAAM      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAAE      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAAC      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAAB      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAA9      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAA3      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAA2      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAA1      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAS1      ----TKFIFVTGGVVSSLGKGITAASLGRLLKDRGLKVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAA8      ----TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAES      ----TKFIFVTGGVVSSLGKGITAASLGRLLKDRGLKVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAEQ      ----TKFIFVTGGVVSSLGKGITAASLGRLLKDRGLKVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STAHJ      ----TKFIFVTGGVVSSLGKGITAASLGRLLKDRGLKVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_STACT      ----TKFIFVTGGVVSSLGKGITAASLGRLLKDRGLSVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_METJA      --KIMKFIFITGGVISSLGKGITAASLGRLLKARGFKVNMIKIDPYLQIDAGTMSPYEHGEVFVTEDGGE
PYRG_STRP8      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_HERA2      ----TKYIFVTGGVASSVGKGITVASLGRLLKSRGISVSIQKLDPYINVDPGTMSPYQHGEVFVTEDGAE
PYRG_STRMU      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_PROM1      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSKGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_ENTFA      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_PROMT      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSKGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_STRR6      ---STKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAE
PYRG_STRPN      ---STKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAE
PYRG_SYNSC      -----KFVFITXXXXXXXXXXXXAASLGRLLKSRGYNVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_STRT2      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_RUBXD      ----TKYIFVTGGVVSSIGKGTSAAALGMLLKSRGYRVVLQKFDPYINVDPGTMNPYQHGEVFVTEDGAE
PYRG_PROM3      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_STRE4      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_PROMM      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_STRT1      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGVE
PYRG_PROM4      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSRGYNVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_SYNS9      -----KFVFITXXXXXXXXXXXXAASLGRLLKSRGYNVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_STRS7      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_SYNPX      -----KFVFITXXXXXXXXXXXXAASLGRLLKSRGYNVSILKLDPYLNVDPGTMSPIQHGEVFVTEDGAE
PYRG_SYNPW      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPYQHGEVFVTEDGAE
PYRG_LACSS      ----TKYVFVTGGVVSSLGKGIVAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVXXXXXX
PYRG_SYNS3      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_ROSCS      -----KYIFVTGGVASSVGKGITVASIGRLLKARGVRVSVQKLDPYINVDPGTMSPYQHGEVFVTEDGAE
PYRG_LACLA      ---STKYIFVTGGGTSSMGKGIVAASLGRLLKNRGLKVTVQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
PYRG_LACLM      ---STKYIFVTGGGTSSMGKGIVAASLGRLLKNRGLKVTVQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
PYRG_SYMTH      -----KFIFITGGVVSGLGKGITAASLGRLIKSRGYRVTALKFDPYLNVDPGTMSPIQHGEVFVTEDGGE
PYRG_ACAM1      ----TKFVFXXXXXXXXXXXXXXAASLGRLLKSRNYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_STRPF      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_CYAP8      ----TKFVFXXXXXXXXXXXXXXAASLGRLLKSRNYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_STRPD      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_STRPC      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_STRPB      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_STRP6      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_STRP3      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_STRP1      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_SYNR3      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSRGYRVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_ROSS1      -----KYIFVTGGVASSVGKGITVASIGRLLKARGVRVSVQKLDPYINVDPGTMSPYQHGEVFVTEDGAE
PYRG_DESAD      ----TKFIFITGGVLSSLGKGLAAASIGALLKARGMTATIQKLDPYINVDPGTMNPFQHGEVYVTDDGAE
PYRG_STRPM      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_STRA5      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_PROMA      -----KFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_STRA3      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_STRA1      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAE
PYRG_CYAA5      ----TKFVFXXXXXXXXXXXXXXAASLGCLFKSRNYSVSILKLDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_PROM2      ----SKFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_GLOVI      ----TKYVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVTILKLDPYINVDPGTMSPFQHGEVFVTNDGAE
PYRG_PROMS      ----SKFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_PROM0      ----SKFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_SYNP6      ----TKFIFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYINVDPGTMSPYQHGEVFVTADGAE
PYRG_SYNAS      ----TKYIFITGGVLSSLGKGLAAASIAAVLECRGLRVTNQKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_PELLD      --KNVKYVFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_LACBA      ----TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLNVTIQKFDPYINVDPGTMNPYQHGEVFVXXXXXX
PYRG_PROM5      ----SKFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_LACS1      ----TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVXXXXXX
PYRG_SYNP2      -----KFIFXXXXXXXXXXXXXXAASLGRLLKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_SYNE7      ----TKFIFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYINVDPGTMSPYQHGEVFVTADGAE
PYRG_DESPS      -TKRTKFIFVTGGVLSSLGKGLAAASIGALLESRGLSITFQKLDPYINVDPGTMNPFQHGEVYVTDDGAE
PYRG_CHLT3      -SKIVKHIFVTGGVVSSLGKGILSASLGALLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_LEPIN      ----TKFIFVTGGVSSSLGKGVTVAALGCLLESRGYTVSLQKMDPYINIDPGTMSPYQHGEVYVTADGAE
PYRG_LEPIC      ----TKFIFVTGGVSSSLGKGVTVAALGCLLESRGYTVSLQKMDPYINIDPGTMSPYQHGEVYVTADGAE
PYRG_CYAP7      ----TKFVFXXXXXXXXXXXXXXAASLGRLFKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_STRGC      ---STKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAE
PYRG_AQUAE      -----KYIFITGGVLSSLGKGITSASIASILEEMGYRVTLQKLDPYLNVDAGTMSPYQHGEVYVTEDGAE
PYRG_THEEB      ----TKYVFXXXXXXXXXXXXXXAASLGRLLKSRQYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_THERP      -----KYVFXXXXXXXXXXXXXXXAAIGRLLKSRGLRVALMKLDPYLNVDPGTMSPYQHGEVFVTEDGAE
PYRG_STRSV      ---STKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAE
PYRG_MICAN      ----SKFVFXXXXXXXXXXXXXXAASLGRLLKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_CHLPD      --KNVKHIFVTGGVISSLGKGILSASLGMLLKSRGLKVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_ANAVT      ----TKFIFXXXXXXXXXXXXXXAASLGRLLKSRDYSVSILKLDPYINIDPGTMSPFQHGEVFVTQDGAE
PYRG_ANASP      ----TKFIFXXXXXXXXXXXXXXAASLGRLLKSRDYSVSILKLDPYINIDPGTMSPFQHGEVFVTQDGAE
PYRG_SYNY3      ----SKFVFXXXXXXXXXXXXXXAASLGRLLKSRHYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_TRIEI      ----TKFVFITXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_PROVI      --KNVKYVFVTGGVVSSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_METMP      -----KYIFVTGGVVSSLGKGITSSSLGRLLKARGLNVNMIKIDPYLQIDAGTMSPFEHGEVFVXXXXXX
PYRG_ACIC5      ---SAKYIFVTGGVVSSLGKGLAAASIGCLLEARGLRVNLMKFDPYLNVDPGTMSPFQHGEVFVTDDGAE
PYRG_LACPL      ----TKYIFXXXXXXXXXXXXXXAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVXXXXXX
PYRG_PELPB      --KNVKHIFVTGGVISSLGKGILSASLGMLLKSRGLKVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_FRASC      ----TKHIFVTGGVASSLGKGLTASSLGRLLKARGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTDDGAE
PYRG_CHLP8      --KNVKHIFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_RHOBA      ----TKHIFVTGGVVSSLGKGLTSASIGMVLERRGLRVRMQKLDPYINVDPGTMSPYQHGEVYVLDDGSE
PYRG_SACEN      -ARTIKHVFVTGGVASSLGKGLTASSLGELLTSRGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_PELCD      ----TKFLFITGGVVSSLGKGLAAASIGALMEARGLRVSMQKMDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_GRAFK      ---DTKYIFVTGGVSSSLGKGIIAASLAKLLQARGFKATIQKLDPYINVDPGTLNPYEHGECYVTEDGAE
PYRG_MYXXD      -SKKTKFIFVTGGVVSSLGKGLASASIGALLENRGLAVTLIKLDPYINVDPGTMSPFQHGEVFVTEDGGE
PYRG_PROM9      ----SKFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_DESVM      ----TKFIFITGGVLSSLGKGLAAASIGALLKARGLKVTIQKLDPYINVDPGTMNPFQHGEVYVTDDGAE
PYRG_SYNJA      -----KFVFITXXXXXXXXXXXXAASLGRLLKSRNYTVSILKLDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_DESDG      ----TKFIFITGGVLSSLGKGLAAASVGALLQARGLKVTIQKLDPYINVDPGTMNPFQHGEVYVTDDGAE
PYRG_CHLL2      --KNVKHIFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_GEOSF      ----TKFIFVTGGVVXXXXXXXXXXXXXXXXXXXXXRVTHQKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_ANADF      --KKTKYLFVTGGVVSSLGKGLAAASIGALLENRGLEVTHLKLDPYINVDPGTMSPFQHGEVYVTDDGAE
PYRG_DESVV      ----TKFIFITGGVLSSLGKGLAAASVGALLKARGLKVTIQKLDPYINVDPGTMNPFQHGEVYVTDDGAE
PYRG_DESVH      ----TKFIFITGGVLSSLGKGLAAASVGALLKARGLKVTIQKLDPYINVDPGTMNPFQHGEVYVTDDGAE
PYRG_SYNJB      ----TKFVFXXXXXXXXXXXXXXAASLGRLLKSRNYTVSILKLDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_THICR      ----TKFIFVTGGVVSSLGKGIAAASLGSLLEARGLKVSMLKMDPYINVDPGTMSPLQHGEVFVTDDGAE
PYRG_HYDS0      ---NSKFIFVTGGVLSSLGKGVASASIGALLEGLGLSITLQKLDPYLNVDPGTMNPYQHGEVFVTEDGAE
PYRG_LACJO      ----TKYIFVTGGVVSSLGKGISASSLGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVYVTDDGTE
PYRG_ACIBL      ---SAKYIFVTGGVVSSLGKGLAAASIGCLLEMRGLKVNMQKFDPYLNVDPGTMSPFQHGEVFVTDDGAE
PYRG_LACDA      ----TKYIFVTGGVVSSLGKGITASSIGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVFVTDDGTE
PYRG_ONYPE      ----TKFIFITGGVVSSLGKGITAASIGQILKNRGLKVSIQKLDPYINIDPGTMSPYQHGEVFVTDDGAE
PYRG_LACAC      ----TKYIFVTGGVVSSLGKGITASSLGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVYVTDDGTE
PYRG_HAHCH      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTILKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_FLAPJ      ----TKYIFVTGGVTSSLGKGIIAASLAKLLQARGYRTTIQKFDPYINVDPGTLNPYEHGECYVTNDGAE
PYRG_THEFY      ---SSKHLFVTGGVASSLGKGLTAXXXXXXXXXXXXXVTMQKLDPYLNVDPGTMNPFQHGEVFVTDDGAE
PYRG_PROMP      ----SKFVFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAE
PYRG_LACDB      ----TKYIFVTGGVVSSLGKGITASSIGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVFVTDDGTE
PYRG_MYCS2      ----TKHLFVTGGVVSSLGKGLTASSLGQLLTARGLQVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_FLAJ1      ----TKYIFVTGGVTSSLGKGIIAASLAKLLQGRGYRTTIQKFDPYINVDPGTLNPYEHGECYVTDDGAE
PYRG_SACD2      ----TRFIFVTGGVVSSLGKGIASASLAAVLEARGLKVTILKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_TREDE      ----SKFIFITGGVVSSLGKGLTAASIGMLLKSRGYSVVNQKFDPYLNVDPGTMNPYQHGEVFVTEDGGE
PYRG_LACH4      ----TKYIFVTGGVVSSLGKGITASSLGRLLKNRGLKVTMQKFDPYINIDPGTMSPYQHGEVYVTEDGTE
PYRG_GEOSL      ----TKFIFVTGGVVXXXXXXXXXXXXXXXXXXXXXRVTMQKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_MYCMM      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_CYAP4      ----TKFVFXXXXXXXXXXXXXXAASLGRLLKSRNYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_CYTH3      ----TKYIFVTGGVTSSLGKGIVAASLAKLLQARGFSVTIQKFDPYLNIDPGTLNPYEHGECYVTDDGAE
PYRG_CHLCH      --KNVKHIFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_SALRD      ----TKYIFVTGGVTSSLGKGIFSASLGRLLSDRGLDVTIQKFDPYINVDPGTMNPYEHGEVYVTNDGAE
PYRG_HALHL      ----TRYLFITGGVVSSLGKGISAASLGTILQARGLSVTLIKLDPYINVDPGTMSPFQHGEVYVTDDGAE
PYRG_BDEBA      -----KFIFVTGGVVSSIGKGLTAASLGALLEGRGHKVTIMKFDPYLNVDPGTMSPLQHGEVYVTEDGAE
PYRG_ALCBS      ----SRFIFVTGGVVSSLGKGITSASLATLLEARGLNVTLIKMDPYINVDPGTMSPYQHGEVFVTEDGAE
PYRG_MYCUA      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_NOCSJ      ----TKHVFVTGGVAXXXXXXXXXXXXXXXXXXXXXXVTMQKLDPYLNVDPGTMNPFQHGEVFVTNDGAE
PYRG_MYCGI      ----TKHLFVTGGVVSSLGKGLTASSLGQLLTARGLQVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_BIFLO      ----TKHIFVTGGVVSSLGKGLTASSLGRLLRSRGIHVLQQKLDPYINVDPGTMNPFQHGEVYVTEDGAE
PYRG_MYCLE      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_MYCLB      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_GEOMG      ----TKFIFVTGGVVXXXXXXXXXXXXXXXXXXXXXRVSMQKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_MYCTU      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_MYCTA      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_MYCBT      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_MYCBP      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_MYCBO      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_DECAR      ----TKYVFVTGGVVSSLGKGIAAASLGAILESRGIKVTHLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_AYWBP      ----TKFIFITGGVVSSLGKGITAASIGQILKNRGLKVSIQKLDPYINVDPGTMSPYQHGEVFVTDDGAE
PYRG_LEIXX      ----TKHIFVTGGVVSSLGKGLTAASLGNLLTARGLRVVMQKLDPYLNVDPGTMNPFQHGEVFVTDDGAE
PYRG_AZOSE      ----TKYVFVTGGVVSSLGKGIAAASLGAILESRGIKVTHLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_ALHEH      ----TRYIFITGGVVSSLGKGITAASLGTILQARGLSVSMTKLDPYINVDPGTMSPFQHGEVYVTDDGAE
PYRG_PELPD      ----TKFIFITGGVVSSIXXXXXXXXXXXXXXXXXXRVTLQKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_AZOSB      ----TKYVFVTGGVVSSLGKGIAAASLGAILESRGIKVTHLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_NOSP7      ----TKFIFXXXXXXXXXXXXXXAASLGRLLKSRGYSVSILKLDPYINIDPGTMSPFQHGEVFVTQDGAE
PYRG_METFK      ----TKFVFVTGGVVSSLGKGIAAASLGAILESRGIKVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_COXB1      ----TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_COXBN      ----TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_MYCVP      ----TKHLFVTGGVVSSLGKGLTASSLGQLLTARGLQVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_PYRKO      ----TKFIFVTGGVVSGLGKGITSASIGMLFKARGFRTTNIKIDPYLNYDAGTMNPYQHXXXXXXXXXXX
PYRG_COXBR      ----TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_COXBU      ----TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_COXB2      ----TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_META3      -----KFIFITGGVVSSLGKGITASSIGRLLKARGFKINMVKIDPYLQIDAGTMSPYEHGEVFVXXXXXX
PYRG_GEOLS      ----TKFIFITGGVVXXXXXXXXXXXXXXXXXXXXXRVTMQKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_THET2      -----KYVFITGGVVSSLGKGILTSSLGALLRARGYRVTAIKIDPYVNVDAGTMRPYEHGEVFVTADGAE
PYRG_THEGJ      ----TKFIFVTGGVVSGLGKGITSASLGMLMKARGFRTTNIKIDPYLNYDAGTMNPYQHXXXXXXXXXXX
PYRG_THET8      -----KYVFITGGVVSSLGKGILTSSLGALLRARGYRVTAIKIDPYVNVDAGTMRPYEHGEVFVTADGAE
PYRG_ANADE      --KKTKYLFVTXXXXXXXXXXXXAASIGALLENRGLEVQHLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_ANAD2      --KKTKYLFVTXXXXXXXXXXXXAASIGALLENRGLEVQHLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_NEIM0      ----TKFIFVTGGVVSSLGKGXXXXXXXXXLESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_VIBHB      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_FRAP2      MNPNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_RHOSR      ----TKHIFVSGGVASSLGKGLTASSLGQLLTARGMRVTMQKLDPYLNVDPGTMNPFQHGEVFVTDDGAE
PYRG_MARAV      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTILKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_CORGL      ----TKHIFVTGGVVSSLGKGLTAASLGQLLIARGLSVTMQKLDPYLNVDPGTMNPFEHGEVFVTEDGAE
PYRG_CORGB      ----TKHIFVTGGVVSSLGKGLTAASLGQLLIARGLSVTMQKLDPYLNVDPGTMNPFEHGEVFVTEDGAE
PYRG_ANASK      --KKTKYLFVTXXXXXXXXXXXXAASIGALLENRGLEVQHLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_VIBPA      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_LAWIP      ----TKFIFITXXXXXXXXXXXXXXXXXXXXXXRGMTVTIQKLDPYINIDPGTMNPYQHGEVYVTDDGAE
PYRG_ACIC1      --QQTKHLFVTGGVASSLGKGLTASSLGNLLKARGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTDDGAE
PYRG_RHOOB      ----TKHIFVSGGVASSLGKGLTASSLGQLLTARGMRVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_VIBVY      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_VIBVU      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_PSYIN      ----TKYIFVTGGVVSSLGKGIAAGSLAAILEARGLDVTILKLDPYINVDPGTMSPIQHGEVFVTDDGAE
PYRG_GEOUR      ----TKFIFVTGGVVSSIXXXXXXXXXXXXXXXXXXRVTHQKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_THEON      -----KFIFVTGGVVSGLGKGITSASLGMLMKARGFKTTNIKIDPYLNYDAGTMNPYQHXXXXXXXXXXX
PYRG_NEIMB      ----TKFIFVTGGVVSSLGKGXXXXXXXXXLESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_NEIG2      ----TKFIFVTGGVVSSLGKGXXXXXXXXXLESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_NEIG1      ----TKFIFVTGGVVSSLGKGXXXXXXXXXLESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_PROA2      --KNVKHIFVTGGVVXXXXXXXXXXXXXXXXXXXXXXVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_STRGG      -STTTKHIFVTGGVASSLGKGLTASSLGALLKARGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTNDGAE
PYRG_NITMU      ----TKYVFVTGGVVSSLGKGIAAASLAAILETRGIKVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_CHLSY      ----------------------------RLLKSRGLSVSVMKLDPYLNVDPGTMSPYQHGEVFVTADGAE
PYRG_CHLAA      ----------------------------RLLKSRGLSVSVMKLDPYLNVDPGTMSPYQHGEVFVTADGAE
PYRG_NITEC      ----TKFVFVTGGVVSSLGKGIAAASLAALLETRGIRVTILKLDPYINVDPGTMNPFQHGEVFVTDDGAE
PYRG_GRABC      ----TRFVFITGGVVSSLGKGIASAALGALLQARGYSVRLRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_FRATW      MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_FRATT      MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_FRATN      MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_FRAT1      MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_VIBCM      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_VIBCH      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_VIBC3      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_ACTP2      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_FRATO      MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_FRATH      MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_FRATF      MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_ACTPJ      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_ACTP7      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_NITEU      ----TKFVFVTGGVVSSLGKGIAAASLAALLETRGIRVTILKLDPYINVDPGTMNPFQHGEVFVTDDGAE
PYRG_PROAC      ----SKHVFVTGGVVSSLGKGLTASSLGSLLKARGLKVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_SHESR      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_PSEF5      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_PSYWF      ----TKFIFVTGGVVSSLGKGITAASLAAVLEARGLKVTMTKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_VIBFM      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SHESW      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SHEPC      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_FRATM      MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAE
PYRG_DICNV      ----TQYIFITGGVVSSLGKGISAASLGAILEARGLRITMIKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_PSE14      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_CHLAD      ----------------------------RLLKSRGFSVSVMKLDPYLNVDPGTMSPYQHGEVFVTADGAE
PYRG_PSEFS      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_VIBSL      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SHEB9      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SHEB8      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SHEB5      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_MYCPA      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLYVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_MYCA1      ----TKHLFVSGGVASSLGKGLTASSLGQLLTARGLYVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_SHESA      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SHESM      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_CORK4      ----TKFVFVTGGVASSLGKGLTASSLGQLLTARGLKVTMQKLDPYLNVDPGTMNPFQHGEVFVTDDGAE
PYRG_SHEB2      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_PSEU2      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_PSEPW      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_PSEPK      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_PSEP1      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_PYRHO      ----TKFIFVTGGVVSGLGKGITSASIGLLMKARGYKTTNIKIDPYINYDAGTMNPYQHXXXXXXXXXXX
PYRG_PSESM      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_PSEPF      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_HAEPS      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXEARGLDVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_PSYA2      ----TKFIFVTGGVVSSLGKGITAASLAAVLEARGVNVTMTKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_PARUW      ----TKYIFITGGVCSSLGKGLTSAAIGLLLEKKGLRVSMLKLDPYLNVDPGTMSPFQHGEVYVTDDGAE
PYRG_CHLTE      --KNVKHIFVTGGVXXXXXXXXXXXXXXXXXXXXXXXVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_BUCAT      MTKN--YIFITGGVVSSLGKGIAAASLGAILKARNLNITIIKLDPYINVDPGTISPIQHGEVFVTEDGAE
PYRG_SHEPA      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_PSYCK      ----TKFIFVTGGVVSSLGKGITAASLAAVLEARGVNVTMTKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_PSEPG      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_PYRFU      ----TKYIFVTGGVVSGLGKGITSASIGLLMKARGYKTTNIKIDPYINYDAGTMNPYQHXXXXXXXXXXX
PYRG_LEGPL      ----TKYIFITGGVVXXXXXXXXXXXXXXXXXXXXLRVTLIKLDPYINVDPGTMSPFQHGEVFVTNDGAE
PYRG_ARCFU      -----KYIVVTGGVMSGLGKGITAASIGRLFVDMGYRVIPIKIDPYINIDAGTMNPFQHGEVYVLKDGTE
PYRG_AERHH      ----TKYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLDVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_VIBF1      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_TOLAT      ----TKYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMLKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_PSEAE      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKITMLKLDPYINVDPGTMSPFQHGEVFVTQDGAE
PYRG_PSEAB      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKITMLKLDPYINVDPGTMSPFQHGEVFVTQDGAE
PYRG_PSEA8      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKITMLKLDPYINVDPGTMSPFQHGEVFVTQDGAE
PYRG_PSEA7      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKITMLKLDPYINVDPGTMSPFQHGEVFVTQDGAE
PYRG_SHEDO      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_LEGPH      ----TKYIFITGGVVXXXXXXXXXXXXXXXXXXXXLRVTLIKLDPYINVDPGTMSPFQHGEVFVTNDGAE
PYRG_LEGPC      ----TKYIFITGGVVXXXXXXXXXXXXXXXXXXXXLRVTLIKLDPYINVDPGTMSPFQHGEVFVTNDGAE
PYRG_LEGPA      ----TKYIFITGGVVXXXXXXXXXXXXXXXXXXXXLRVTLIKLDPYINVDPGTMSPFQHGEVFVTNDGAE
PYRG_BUCA5      MTKN--YIFITGGVVSSLGKGIAAASLGAILKARNLNITIIKLDPYINVDPGTISPIQHGEVFVTEDGAE
PYRG_SHEON      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SHEWM      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINLDPGTMSPTQHGEVFVTEDGAE
PYRG_PYRAB      ----TKFIFVTGGVVSGLGKGITSASIGLLMKARGYKTTNIKIDPYINYDAGTMNPYQHXXXXXXXXXXX
PYRG_SHEFN      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_BUCAP      MTKN--YIFITGGVVSSLGKGIAAASLGAVLEARNLKITIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_BUCAI      MTKN--YIFITGGVVSSLGKGIAAASLGAILKARNLNITIIKLDPYINVDPGTISPIQHGEVFVTEDGAE
PYRG_SHEAM      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SALNS      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_AERS4      ----TKYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLDVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SALTY      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALTI      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALSV      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALPC      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALPB      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALHS      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALG2      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALEP      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALDC      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALCH      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ACICJ      ----TRYVFITGGVVSSLGKGIASASLGALLQARGYSVRLRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_ACIBC      ----THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_SALPK      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALPA      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SALA4      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_LARHH      ----TKFIFVTGGVVSSLGKGXXXXXXXXXLESRGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_HAEDU      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_PSEE4      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_METCA      ----TKYIFITGGVVXXXXXXXXXXXXXXXXEARGLKVTLTKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_DEHSC      ------------------------ASLGNILKSRGLSVSVQKLDPYLNVDPGTMSPYQHGEVFVTQDGAE
PYRG_DEHSB      ------------------------ASLGNILKSRGLSVSVQKLDPYLNVDPGTMSPYQHGEVFVTQDGAE
PYRG_CITK8      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ACIBY      ----THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_ACIBT      ----THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_ACIBS      ----THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_ACIB5      ----THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_ACIB3      ----THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_SHEHH      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_NITOC      ----TKFIFVTGGVVSSLGKGITSASLGALLEARGLAVTLVKLDPYINVDPGTMSPYQHGEVFVTGDGAE
PYRG_MESSB      -----RYVFITGGVVSSLGKGIASAALGALLQARGYRVRLRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_ZYMMO      -----RFIFITGGVVSSLGKGLMAASLAALLQERGFRVRIRKFDPYLNVDPGTMSPYQHGEVYVTDDGAE
PYRG_CORJK      ---STKYIFVTGGVASSLGKGLTAAXXXXXXXXXXXXVTMQKLDPYLNVDPGTMNPFEHGEVFVTEDGAE
PYRG_ALISL      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_CHLPB      --KNVKHIFVTGGVVXXXXXXXXXXXXXXXXXXXXXXVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAE
PYRG_THIDA      ----TKYVFVTGGVVXXXXXXXXXXXXXXXXXXXXXRVTLLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_PSEU5      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_ALTMD      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLTVTMLKLDPYINVDPGTMSPIQHGEVFVTDDGAE
PYRG_SALAR      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_KLEP3      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_THISH      ----TRYVFITGGVVXXXXXXXXXXXXXXXXEARGLKVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_KLEP7      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SHELP      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINLDPGTMSPTQHGEVFVTEDGAE
PYRG_PSEA6      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTMLKLDPYINVDPGTMSPIQHGEVFVTDDGAE
PYRG_CAMJ8      --KQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPGTMSPFEHGEVFVTDDGAE
PYRG_BAUCH      ----TNYIFVTGGVVSSLGKGIAVASLAAILEARGLKVTIMKLDPYINVDPGTISPIQHGEVFVTEDGAE
PYRG_TROWT      -----KHIFITGGVVSSIGKGLTAASLGSLLTMRGLKVFIKKLDPYLNVDPGTMNPLQHGEVFITEDGAE
PYRG_TROW8      -----KHIFITGGVVSSIGKGLTAASLGSLLTMRGLKVFIKKLDPYLNVDPGTMNPLQHGEVFITEDGAE
PYRG_PHYAS      ----SKFIFITGGVVSSLGKGITAASIGNILKNRGFKVSIQKLDPYINIDPGTMSPYQHGEVFVTNDGAE
PYRG_CAMJR      --KQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPGTMSPFEHGEVFVTDDGAE
PYRG_CAMJJ      --KQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPGTMSPFEHGEVFVTDDGAE
PYRG_PSEMY      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_SHESH      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_MANSM      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTMMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_ERWT9      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTIMKLDPYINVDPGTMSPTQHGEVFVTDDGAE
PYRG_CHRVO      ----TKYIFVTGGVVSSLGKGXXXXXXXXXLESRGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_CAMJD      --KQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKASILKADPYINVDPGTMSPFEHGEVFVTDDGAE
PYRG_DEHE1      ------------------------ASLGNILKSRGLSVSVQKLDPYLNVDPGTMSPYQHGEVFVTQDGAE
PYRG_BRUA1      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_NEIMF      ----TKFIFVTGGVVSSLGKGXXXXXXXXXLESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_HAEI8      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_BRUSI      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_BRUME      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_NEIMA      ----TKFIFVTGGVVSSLGKGXXXXXXXXXLESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_CAMJE      --KQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPGTMSPFEHGEVFVTDDGAE
PYRG_BRUO2      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_BRUMB      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_BRUAB      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_BRUA2      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_PROMH      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTMMKLDPYINVDPGTMSPIQHGEVFVTDDGAE
PYRG_HAEIG      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_HAEIE      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_HAEIN      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_PHOPR      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SERP5      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ENT38      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTMMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_YERE8      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_SHISS      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SHIFL      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SHIF8      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SHIDS      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SHIBS      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_SHIB3      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ESCF3      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOUT      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOSM      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOSE      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOLU      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOLI      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOLC      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOL6      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOL5      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOK1      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOHS      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECODH      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECOBW      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO8A      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO81      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO7I      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO5E      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO57      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO55      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO45      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO24      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ECO27      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_DESDA      ----TKFIFVTXXXXXXXXXXXXXXXXXXXXQTRGLSVTIQKLDPYINVDPGTMNPFQHGEVFVTDDGAE
PYRG_PECCP      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_BRUSU      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTISPYQHGEVFVTDDGAE
PYRG_BRUC2      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTISPYQHGEVFVTDDGAE
PYRG_YERPY      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_YERPS      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_YERPP      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_YERPN      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_YERPG      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_YERPE      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_YERPB      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_YERPA      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_YERP3      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_OCHA4      -----RYVFITGGVVSSLGKGIXXXXXXXXXXXRGYRVRIRKLDPYLNVDPGTMSPYQHGEVFVTDDGAE
PYRG_MYCMS      -----KFIFVTGGVVSGLGKGITASSIGALLKASGLKVFMQKFDPYLNVDPGTMSPYQHGEVFVTKDGGE
PYRG_NOVAD      -----RYIFITGGVVXXXXXXXXXXXXXXXXXXXXFRVRIRKFDPYLNVDPGTMSPYQHGEVYVTDDGAE
PYRG_EDWI9      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVSMMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_ERWCT      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAE
PYRG_METBU      -----KYIIVTGGVMSGLGKGITTASVGRNLKNKGYKVTAIKIDPYINIDAGTMSPYQHGEVYVLKDGGE
PYRG_ACIAD      ----THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_MYCCT      -----KFIFVTGGVVSGLGKGITASSIGALLKASGLKVFMQKFDPYLNVDPGTMSPYQHGEVFVTKDGGE
PYRG_COLP3      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMLKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_PASMU      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLKVTMLKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_METTH      -----------------------AASIGRILRSYGLSVTAIKIDPYLNWDSGTLNPYQHGEVFVTDDGME
PYRG_NOCFA      ----TKHIFVSGGVASSLGKGLTASSLGQLLTARGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_GLUOX      ----TRFVFITGGVVSSLGKGIXXXXXXXXXXXRGYKVRMRKLDPYLNVDPGTMSPYQHGEVFITDDGAE
PYRG_STRCO      -SSTTKHIFVTGGVASSLGKGLTASSLGMLLKARGLRVVMQKLDPYLNVDPGTMNPFQHGEVFVTNDGAE
PYRG_NATPD      -SMGNKFIFVTGGVMSGLGKGITAASTGRLLANAGFDVTAVKIDPYLNVDAGTMNPYQHGEVYVLKDGGE
PYRG_MARMM      -----RYIFITGGVVSSLGKGLASAAIGALLQARGYKVRLRKLDPYLNVDPGTMSPYQHGECYVTDDGAE
PYRG_MAGSA      ----TRFIFITGGVVXXXXXXXXXXXXXXXXXXRGFKVRLRKLDPYLNVDPGTMSPYQHGEVYVTDDGAE
PYRG_AZOVD      ----TRYIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTLLKLDPYINVDPGTMSPFQHGEVFVTHDGAE
PYRG_STRAW      -STTTKHIFVTGGVASSLGKGLTASSLGMLLKARGLRVVMQKLDPYLNVDPGTMNPFQHGEVFVTNDGAE
PYRG_MYCSS      ---------------------------------RGLQVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_MYCSK      ---------------------------------RGLQVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_MYCSJ      ---------------------------------RGLQVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAE
PYRG_RHOPT      -----RYIFITGGVVXXXXXXXXXXXXXXXXXXRGYKVRLRKLDPYLNLDPGTMSPYQHGEVFVTDDGAE
PYRG_RHOPA      -----RYIFITGGVVXXXXXXXXXXXXXXXXXXRGYKVRLRKLDPYLNLDPGTMSPYQHGEVFVTDDGAE
PYRG_HYPNA      -----RYIFITGGVVSSLGKGIASASLGALLQSRGYRVRLRKLDPYLNVDPGTMSPRQHGEVYVTDDGAE
PYRG_HALMA      -----KFIFVTGGVMSGLGKGITAASTGRLLKNAGFDVTAVKIDPYLNVDAGTMNPFQHGEVYVLKDGGE
PYRG_ACTSZ      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXXNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAE
PYRG_SULTO      ----TKYIIITGGVLSSVGKGTVAASIGLLLKNRGYKITMVKVDPYLNVDAGTMNPYMHGEVFVTDDGAE
PYRG_RHORT      ----TRFIFITGGVVXXXXXXXXXXXXXXXXXXRGYKVRLRKLDPYLNVDPGTMSPTQHGEVFVTDDGAE
PYRG_BURA4      ----TKYVFVTGGVVXXXXXXXXXXXXXXXXESRGLKVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_ERYLH      -----RYIFITGGVVSSLGKGLMAASLGALLQARGYKVRIRKFDPYLNVDPGTMSPYQHGEVYVTDDGAE
PYRG_BURM1      ----TKYVFVTGGVVXXXXXXXXXXXXXXXXESRGLKVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_BRAJA      -----RYIFITGGVVXXXXXXXXXXXXXXXXXXRGYKVRLRKLDPYLNLDPGTMSPYQHGEVFVTDDGAE
PYRG_BURVG      ----TKYVFVTGGVVXXXXXXXXXXXXXXXXESRGLKVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_BACFR      ----TKYIFVTGGVAXXXXXXXXXXXXXXXXQARGYKVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHE
PYRG_BACFN      ----TKYIFVTGGVAXXXXXXXXXXXXXXXXQARGYKVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHE
PYRG_XYLFA      ----TPLIFVTGGVVXXXXXXXXXXXXXXXXEARGLKVTMVKLDPYINVDPGTMSPFQHGEVYVTDDGAE
PYRG_NITHX      -----RYIFITGGVVXXXXXXXXXXXXXXXXXXRGYKVRLRKLDPYLNLDPGTMSPYQHGEVFVTDDGAE
PYRG_DELAS      ----TKFVFVTGGVVXXXXXXXXXXXXXXXXESRGLKVTLIKLDPYINVDPGTMSPFQHGEVFVTDDGAE
PYRG_CHLFF      -----KCIFLTGGVVSSLGKGLTAASLALLLERQSLKVSMLKLDPYLNVDPGTMNPYEHGEVYVTNDGIE
PYRG_BURS3      ----TKYVFVTGGVVXXXXXXXXXXXXXXXXESRGLKVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAE
PYRG_SODGM      ----TNYIFVTGGVVXXXXXXXXXXXXXXXXXXXXLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAE
PYRG_POLNA      ----TKFVFVTGGVVSSLGKGIASGALAAILESRGLKVTLIKLDPYINVDPGTMSPLQHGEVFVTDDGAE
PYRG_BLOPB      ------YIFVTGGVVSSLGKGIATASLAAVLEARGLSVTIIKLDPYINMDPGTISPVQHGEVFI