[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB81922.1

[Show Plain Result]


## Summary of Sequence Search
    1::78
    4::76      7e-17  46%   86 aa  VEG_BACSU RecName: Full=Protein veg;
    1::78

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxTLNSIRKSIEDHVGEKVKLRANGGRKKILENEGILESVHPSIFVVRLQKDTQRKVTYSYSDVLTK
VEG_BACSU       -----TLSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSVFVIQLDQDENERVSYSYADILTE


                         .         .         *         .         .         .         .:140
query           TVQLDFxx
VEG_BACSU       TVELTF--