[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB82028.1

[Show Plain Result]


## Summary of Sequence Search
    1::643
    1::643       0.0 100%  643 aa  SYT_CLOPE RecName: Full=Threonyl-tRNA synthetase;       
    1::643       0.0 100%  643 aa  SYT_CLOP1 RecName: Full=Threonyl-tRNA synthetase;       
    1::643       0.0 100%  643 aa  SYT_CLOPS RecName: Full=Threonyl-tRNA synthetase;       
    1::642       0.0  74%  643 aa  SYT_CLOBB RecName: Full=Threonyl-tRNA synthetase;       
    1::642       0.0  74%  643 aa  SYT_CLOBA RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-172  51%  635 aa  SYT_CLOTH RecName: Full=Threonyl-tRNA synthetase;       
    1::623     e-164  48%  639 aa  SYT_CLOD6 RecName: Full=Threonyl-tRNA synthetase;       
    4::641     e-164  46%  643 aa  SYT_ANOFW RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-160  48%  652 aa  SYT_GEOKA RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-160  45%  635 aa  SYT_DESRM RecName: Full=Threonyl-tRNA synthetase;       
    4::625     e-159  46%  643 aa  SYT1_BACSU RecName: Full=Threonyl-tRNA synthetase 1;       
    4::640     e-158  45%  643 aa  SYT_BACA2 RecName: Full=Threonyl-tRNA synthetase;       
    3::642     e-157  44%  645 aa  SYT_ENTFA RecName: Full=Threonyl-tRNA synthetase;       
    4::644     e-156  44%  646 aa  SYT_OCEIH RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-156  44%  637 aa  SYT_CLONN RecName: Full=Threonyl-tRNA synthetase;       
    1::619     e-156  47%  635 aa  SYT_CLOBL RecName: Full=Threonyl-tRNA synthetase;       
    1::619     e-155  47%  635 aa  SYT_CLOBJ RecName: Full=Threonyl-tRNA synthetase;       
    1::619     e-155  47%  635 aa  SYT_CLOBH RecName: Full=Threonyl-tRNA synthetase;       
    1::619     e-155  47%  635 aa  SYT_CLOB1 RecName: Full=Threonyl-tRNA synthetase;       
    1::619     e-155  47%  635 aa  SYT_CLOBM RecName: Full=Threonyl-tRNA synthetase;       
    1::619     e-155  47%  635 aa  SYT_CLOB6 RecName: Full=Threonyl-tRNA synthetase;       
    4::641     e-155  44%  644 aa  SYT_GEOSW RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-154  44%  647 aa  SYT_STACT RecName: Full=Threonyl-tRNA synthetase;       
   13::642     e-154  45%  644 aa  SYT_THETN RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-153  45%  647 aa  SYT_STRA5 RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-153  45%  647 aa  SYT_STRA3 RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-153  45%  647 aa  SYT_STRA1 RecName: Full=Threonyl-tRNA synthetase;       
    1::619     e-153  47%  635 aa  SYT_CLOBK RecName: Full=Threonyl-tRNA synthetase;       
    1::622     e-152  45%  637 aa  SYT_CLOK5 RecName: Full=Threonyl-tRNA synthetase;       
    1::622     e-152  45%  637 aa  SYT_CLOK1 RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-152  43%  640 aa  SYT_LISMO RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-151  43%  647 aa  SYT_STRPJ RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-151  43%  647 aa  SYT_STRGC RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-151  43%  640 aa  SYT_LISIN RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-151  43%  647 aa  SYT_STRZJ RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-151  43%  640 aa  SYT_LISMH RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-151  43%  640 aa  SYT_LISMF RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-151  43%  640 aa  SYT_LISMC RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-151  43%  647 aa  SYT_STRP4 RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-150  43%  647 aa  SYT_STRZT RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-150  43%  647 aa  SYT_STRPI RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-150  43%  647 aa  SYT_STRP7 RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-150  44%  639 aa  SYT_CLOTE RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-150  43%  647 aa  SYT_STRR6 RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-150  43%  647 aa  SYT_STRPN RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-150  43%  647 aa  SYT_STRP2 RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-150  43%  640 aa  SYT_LISW6 RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  43%  645 aa  SYT_STAAB RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  43%  645 aa  SYT_STAS1 RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-150  43%  647 aa  SYT_STRZP RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAAW RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAAT RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAAS RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAAR RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAAE RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAAC RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAA9 RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAA3 RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-150  42%  645 aa  SYT_STAA2 RecName: Full=Threonyl-tRNA synthetase;       
    3::645     e-150  42%  647 aa  SYT_EXISA RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-149  42%  645 aa  SYT_STAA8 RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-149  43%  635 aa  SYT_SYNWW RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-149  42%  645 aa  SYT_STAAN RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-149  42%  645 aa  SYT_STAAM RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-149  42%  645 aa  SYT_STAA1 RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-149  43%  647 aa  SYT_STRSV RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-149  45%  647 aa  SYT_STRPZ RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-149  45%  647 aa  SYT_STRP3 RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-149  43%  648 aa  SYT_STRS7 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-148  41%  634 aa  SYT_FINM2 RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-148  45%  647 aa  SYT_STRPF RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-148  45%  647 aa  SYT_STRPD RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-148  45%  647 aa  SYT_STRPM RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-148  45%  647 aa  SYT_STRPG RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-148  45%  647 aa  SYT_STRPC RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-148  45%  647 aa  SYT_STRPB RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-148  45%  647 aa  SYT_STRP8 RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-148  45%  647 aa  SYT_STRP1 RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-148  45%  637 aa  SYT_CLOAB RecName: Full=Threonyl-tRNA synthetase;       
   11::654     e-148  41%  666 aa  SYT_PROVI RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-147  43%  650 aa  SYT_STRSY RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-147  43%  650 aa  SYT_STRS2 RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-147  44%  647 aa  SYT_STRP6 RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-145  41%  645 aa  SYT_STAEQ RecName: Full=Threonyl-tRNA synthetase;       
   10::657     e-145  39%  659 aa  SYT_CHLT3 RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-145  42%  649 aa  SYT_STRMU RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-145  41%  645 aa  SYT_STAES RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-145  42%  648 aa  SYT_STRU0 RecName: Full=Threonyl-tRNA synthetase;       
   11::658     e-145  40%  659 aa  SYT_CHLPB RecName: Full=Threonyl-tRNA synthetase;       
    4::642     e-144  44%  645 aa  SYT_BACHD RecName: Full=Threonyl-tRNA synthetase;       
   11::656     e-144  40%  657 aa  SYT_PROA2 RecName: Full=Threonyl-tRNA synthetase;       
    1::641     e-144  42%  646 aa  SYT_LACLS RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-143  40%  634 aa  SYT_CARHZ RecName: Full=Threonyl-tRNA synthetase;       
    1::641     e-143  42%  646 aa  SYT_LACLM RecName: Full=Threonyl-tRNA synthetase;       
   11::656     e-142  40%  657 aa  SYT_CHLL2 RecName: Full=Threonyl-tRNA synthetase;       
    1::641     e-142  43%  646 aa  SYT_LACLA RecName: Full=Threonyl-tRNA synthetase;       
   11::657     e-142  40%  657 aa  SYT_CHLCH RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-141  41%  648 aa  SYT_STRTD RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-141  41%  648 aa  SYT_STRT2 RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-141  41%  648 aa  SYT_STRT1 RecName: Full=Threonyl-tRNA synthetase;       
   13::652     e-140  40%  657 aa  SYT_CHLTE RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-140  43%  648 aa  SYT_FLAPJ RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-138  40%  645 aa  SYT_CYTH3 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-137  40%  643 aa  SYT_THISH RecName: Full=Threonyl-tRNA synthetase;       
   10::656     e-137  39%  657 aa  SYT_PELPB RecName: Full=Threonyl-tRNA synthetase;       
    1::644     e-137  41%  646 aa  SYT_BACFR RecName: Full=Threonyl-tRNA synthetase;       
    1::644     e-137  41%  646 aa  SYT_BACFN RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-137  42%  648 aa  SYT_FLAJ1 RecName: Full=Threonyl-tRNA synthetase;       
    1::644     e-137  41%  646 aa  SYT_BACTN RecName: Full=Threonyl-tRNA synthetase;       
    1::642     e-137  38%  642 aa  SYT_ACHLI RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-136  43%  636 aa  SYT_NATTJ RecName: Full=Threonyl-tRNA synthetase;       
    4::642     e-136  41%  656 aa  SYT_LACSS RecName: Full=Threonyl-tRNA synthetase;       
    1::645     e-135  40%  651 aa  SYT_PARD8 RecName: Full=Threonyl-tRNA synthetase;       
   43::626     e-135  45%  627 aa  SYT_GLOVI RecName: Full=Threonyl-tRNA synthetase;       
    5::636     e-135  39%  638 aa  SYT2_BACSU RecName: Full=Threonyl-tRNA synthetase 2;       
    1::644     e-135  42%  646 aa  SYT_BACV8 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-134  40%  640 aa  SYT_POLSQ RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-134  40%  640 aa  SYT_POLNS RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-134  42%  648 aa  SYT_KOSOT RecName: Full=Threonyl-tRNA synthetase;       
    3::633     e-133  41%  640 aa  SYT_THEMA RecName: Full=Threonyl-tRNA synthetase;       
    3::633     e-133  41%  640 aa  SYT_THEP1 RecName: Full=Threonyl-tRNA synthetase;       
    4::646     e-132  41%  652 aa  SYT_LEUMM RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-132  40%  639 aa  SYT_RUBXD RecName: Full=Threonyl-tRNA synthetase;       
    3::653     e-132  41%  659 aa  SYT_THET8 RecName: Full=Threonyl-tRNA synthetase;       
    4::647     e-132  42%  648 aa  SYT_PEDPA RecName: Full=Threonyl-tRNA synthetase;       
    1::641     e-132  39%  650 aa  SYT_BORA1 RecName: Full=Threonyl-tRNA synthetase;       
    3::633     e-132  40%  640 aa  SYT_THESQ RecName: Full=Threonyl-tRNA synthetase;       
    3::626     e-132  41%  638 aa  SYT_PELCD RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-132  41%  654 aa  SYT_LACPL RecName: Full=Threonyl-tRNA synthetase;       
    3::633     e-132  38%  640 aa  SYT_THENN RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-131  41%  640 aa  SYT_PETMO RecName: Full=Threonyl-tRNA synthetase;       
    6::624     e-131  40%  644 aa  SYT_DESVV RecName: Full=Threonyl-tRNA synthetase;       
    6::624     e-131  40%  644 aa  SYT_DESVH RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-131  40%  636 aa  SYT_PELPD RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-131  39%  637 aa  SYT_LEGPH RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-131  38%  635 aa  SYT_METFK RecName: Full=Threonyl-tRNA synthetase;       
   56::626     e-131  42%  644 aa  SYT_DESDG RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-131  39%  641 aa  SYT_ALHEH RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-131  39%  637 aa  SYT_LEGPC RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-130  40%  637 aa  SYT_LEGPL RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-130  39%  637 aa  SYT_LEGPA RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-130  40%  643 aa  SYT_SULSY RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-130  41%  636 aa  SYT_GEOBB RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-130  39%  651 aa  SYT_SYMTH RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-129  38%  640 aa  SYT_HALHL RecName: Full=Threonyl-tRNA synthetase;       
    4::644     e-129  40%  649 aa  SYT_LACS1 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-129  37%  637 aa  SYT_TERTT RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-129  39%  653 aa  SYT_PORGI RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-129  39%  653 aa  SYT_PORG3 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-129  37%  638 aa  SYT_METCA RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-129  40%  636 aa  SYT_GEOSM RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-129  37%  642 aa  SYT_THICR RecName: Full=Threonyl-tRNA synthetase;       
    5::669     e-129  40%  681 aa  SYT_ACIC5 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-128  37%  644 aa  SYT_PSYWF RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-128  38%  635 aa  SYT_NITEU RecName: Full=Threonyl-tRNA synthetase;       
    6::626     e-128  40%  644 aa  SYT_DESVM RecName: Full=Threonyl-tRNA synthetase;       
    4::625     e-128  40%  636 aa  SYT_GEOSL RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-128  38%  635 aa  SYT_RALPJ RecName: Full=Threonyl-tRNA synthetase;       
    4::624     e-128  38%  638 aa  SYT_PROM4 RecName: Full=Threonyl-tRNA synthetase;       
    1::622     e-128  38%  644 aa  SYT_ACIF5 RecName: Full=Threonyl-tRNA synthetase;       
    1::622     e-128  38%  644 aa  SYT_ACIF2 RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-128  38%  648 aa  SYT_MAGSM RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-127  37%  637 aa  SYT_HAHCH RecName: Full=Threonyl-tRNA synthetase;       
    3::639     e-127  40%  657 aa  SYT_LACCB RecName: Full=Threonyl-tRNA synthetase;       
    3::639     e-127  40%  657 aa  SYT_LACC3 RecName: Full=Threonyl-tRNA synthetase;       
    4::646     e-127  41%  647 aa  SYT_LACBA RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-127  39%  635 aa  SYT_METPP RecName: Full=Threonyl-tRNA synthetase;       
    1::641     e-127  38%  649 aa  SYT_BORPE RecName: Full=Threonyl-tRNA synthetase;       
    1::641     e-127  38%  649 aa  SYT_BORPA RecName: Full=Threonyl-tRNA synthetase;       
    1::641     e-127  38%  649 aa  SYT_BORBR RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-126  39%  635 aa  SYT_POLNA RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-126  38%  635 aa  SYT_NITEC RecName: Full=Threonyl-tRNA synthetase;       
   37::624     e-126  40%  642 aa  SYT_LAWIP RecName: Full=Threonyl-tRNA synthetase;       
    1::641     e-126  38%  650 aa  SYT_BORPD RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-126  37%  635 aa  SYT_RALSO RecName: Full=Threonyl-tRNA synthetase;       
    5::644     e-126  38%  644 aa  SYT_LACH4 RecName: Full=Threonyl-tRNA synthetase;       
    1::613     e-126  40%  620 aa  SYT_FUSNN RecName: Full=Threonyl-tRNA synthetase;       
    1::630     e-126  38%  633 aa  SYT_CHRVO RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-126  38%  635 aa  SYT_CUPTR RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-126  37%  633 aa  SYT_STRMK RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-126  37%  634 aa  SYT_XANC5 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-125  38%  635 aa  SYT_RALEJ RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-125  37%  634 aa  SYT_XANOR RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-125  37%  634 aa  SYT_XANOM RecName: Full=Threonyl-tRNA synthetase;       
    3::653     e-125  40%  659 aa  SYT_THET2 RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-125  38%  635 aa  SYT_JANMA RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-125  37%  634 aa  SYT_XANAC RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-125  36%  640 aa  SYT_PSE14 RecName: Full=Threonyl-tRNA synthetase;       
    1::608     e-125  38%  635 aa  SYT_RICCN RecName: Full=Threonyl-tRNA synthetase;       
    1::608     e-125  38%  635 aa  SYT_RICAE RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-125  37%  635 aa  SYT_RALEH RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-125  37%  640 aa  SYT_PSEPF RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-125  37%  637 aa  SYT_NEIMB RecName: Full=Threonyl-tRNA synthetase;       
    3::630     e-124  38%  638 aa  SYT_THELT RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-124  36%  633 aa  SYT_STRM5 RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURTA RecName: Full=Threonyl-tRNA synthetase;       
    3::635     e-124  37%  636 aa  SYT_XANCP RecName: Full=Threonyl-tRNA synthetase;       
    3::635     e-124  37%  636 aa  SYT_XANCB RecName: Full=Threonyl-tRNA synthetase;       
    3::635     e-124  37%  636 aa  SYT_XANC8 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-124  36%  636 aa  SYT_SACD2 RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURPS RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURP6 RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURP1 RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURP0 RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURMS RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURMA RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURM9 RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_BURM7 RecName: Full=Threonyl-tRNA synthetase;       
    1::608     e-124  38%  635 aa  SYT_RICRS RecName: Full=Threonyl-tRNA synthetase;       
    1::630     e-124  37%  635 aa  SYT_RICFE RecName: Full=Threonyl-tRNA synthetase;       
   66::624     e-124  40%  647 aa  SYT_DESDA RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  635 aa  SYT_RICBR RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-124  37%  633 aa  SYT_RICB8 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-124  36%  645 aa  SYT_MARMS RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-124  36%  641 aa  SYT_MARAV RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-124  38%  647 aa  SYT_DESMR RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-124  37%  639 aa  SYT_ACIAC RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-123  36%  644 aa  SYT_PSYCK RecName: Full=Threonyl-tRNA synthetase;       
    1::608     e-123  38%  635 aa  SYT_RICPU RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-123  36%  635 aa  SYT_RICCK RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-123  36%  640 aa  SYT_PSEPK RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-123  37%  635 aa  SYT_RICAH RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-123  36%  640 aa  SYT_PSEMY RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-123  37%  635 aa  SYT_BURCJ RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-123  37%  635 aa  SYT_BURS3 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-123  36%  644 aa  SYT_PSYA2 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-123  36%  640 aa  SYT_PSEP1 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-123  36%  640 aa  SYT_PSEU2 RecName: Full=Threonyl-tRNA synthetase;       
    5::619     e-123  38%  642 aa  SYT_DESAD RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-123  36%  635 aa  SYT_BURXL RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-123  37%  635 aa  SYT_BURCC RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-123  37%  648 aa  SYT_AZOPC RecName: Full=Threonyl-tRNA synthetase;       
   27::601     e-123  41%  603 aa  SYT_SYNY3 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-123  36%  640 aa  SYT_PSEU5 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-123  37%  634 aa  SYT_FRATN RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-123  37%  635 aa  SYT_BURVG RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-123  36%  635 aa  SYT_BURPP RecName: Full=Threonyl-tRNA synthetase;       
    1::630     e-122  38%  636 aa  SYT_DESAH RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  651 aa  SYT_COXBU RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  634 aa  SYT_FRATT RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  634 aa  SYT_FRATM RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  634 aa  SYT_FRAT1 RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-122  37%  635 aa  SYT_BURA4 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  635 aa  SYT_VARPS RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-122  36%  640 aa  SYT_PSEAE RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-122  36%  640 aa  SYT_PSEAB RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-122  36%  640 aa  SYT_PSEA8 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  634 aa  SYT_FRATW RecName: Full=Threonyl-tRNA synthetase;       
    1::623     e-122  37%  635 aa  SYT_FRAP2 RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-122  36%  635 aa  SYT_BURP8 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  36%  640 aa  SYT_PSESM RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-122  36%  640 aa  SYT_PSEA7 RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-122  35%  640 aa  SYT_PROM3 RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  638 aa  SYT_NITMU RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  634 aa  SYT_FRATO RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-122  36%  635 aa  SYT_BURCM RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-122  36%  640 aa  SYT_AZOVD RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  634 aa  SYT_FRATH RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-122  37%  634 aa  SYT_FRATF RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-121  36%  644 aa  SYT_NITOC RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  36%  638 aa  SYT_IDILO RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-121  36%  642 aa  SYT_CELJU RecName: Full=Threonyl-tRNA synthetase;       
   17::721     e-121  41%  743 aa  SYT_RHOBA RecName: Full=Threonyl-tRNA synthetase;       
    4::625     e-121  37%  636 aa  SYT_VESOH RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-121  37%  635 aa  SYT_RICTY RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-121  35%  640 aa  SYT_PROMM RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-120  37%  635 aa  SYT_POLSJ RecName: Full=Threonyl-tRNA synthetase;       
    5::636     e-120  37%  643 aa  SYT_LACJO RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-120  35%  640 aa  SYT_PSEFS RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-120  36%  638 aa  SYT_DECAR RecName: Full=Threonyl-tRNA synthetase;       
    4::623     e-120  36%  643 aa  SYT_PROMA RecName: Full=Threonyl-tRNA synthetase;       
    4::645     e-120  39%  650 aa  SYT_ANADE RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-120  38%  643 aa  SYT_DELAS RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-120  35%  632 aa  SYT_CHRSD RecName: Full=Threonyl-tRNA synthetase;       
    1::608     e-120  38%  635 aa  SYT_RICPR RecName: Full=Threonyl-tRNA synthetase;       
    4::646     e-120  37%  653 aa  SYT_LEUCK RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-120  37%  635 aa  SYT_BURM1 RecName: Full=Threonyl-tRNA synthetase;       
    4::623     e-120  35%  640 aa  SYT_PROM1 RecName: Full=Threonyl-tRNA synthetase;       
    4::623     e-120  35%  641 aa  SYT_PROMT RecName: Full=Threonyl-tRNA synthetase;       
   24::616     e-120  38%  636 aa  SYT_ANAMM RecName: Full=Threonyl-tRNA synthetase;       
   24::616     e-120  38%  636 aa  SYT_ANAMF RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-119  37%  642 aa  SYT_VIBVY RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-119  37%  642 aa  SYT_VIBHB RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  37%  642 aa  SYT_SHESW RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  37%  642 aa  SYT_SHEPC RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  37%  642 aa  SYT_SHEPW RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  37%  642 aa  SYT_SHEB9 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  37%  642 aa  SYT_SHEB8 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  37%  642 aa  SYT_SHEB5 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  37%  642 aa  SYT_SHEB2 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  35%  640 aa  SYT_PSEE4 RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-119  37%  642 aa  SYT_VIBVU RecName: Full=Threonyl-tRNA synthetase;       
   30::603     e-119  40%  607 aa  SYT_SYNP6 RecName: Full=Threonyl-tRNA synthetase;       
   27::600     e-119  40%  604 aa  SYT_SYNE7 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  37%  642 aa  SYT_SHEON RecName: Full=Threonyl-tRNA synthetase;       
    5::636     e-119  38%  643 aa  SYT_LACGA RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-119  38%  638 aa  SYT_AQUAE RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  36%  640 aa  SYT_ACIBY RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  36%  640 aa  SYT_ACIBT RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  36%  640 aa  SYT_ACIBC RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  36%  640 aa  SYT_ACIB3 RecName: Full=Threonyl-tRNA synthetase;       
    5::644     e-119  37%  644 aa  SYT_LACAC RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  36%  640 aa  SYT_ACIB5 RecName: Full=Threonyl-tRNA synthetase;       
    9::580     e-119  39%  580 aa  SYT_UREU1 RecName: Full=Threonyl-tRNA synthetase;       
    4::640     e-119  37%  642 aa  SYT_MYXXD RecName: Full=Threonyl-tRNA synthetase;       
    3::621     e-119  38%  649 aa  SYT_DEIDV RecName: Full=Threonyl-tRNA synthetase;       
   19::578     e-119  40%  582 aa  SYT_DEHE1 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-119  36%  642 aa  SYT_SHEPA RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-119  37%  635 aa  SYT_XYLFA RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-119  37%  642 aa  SYT_VIBPA RecName: Full=Threonyl-tRNA synthetase;       
    5::645     e-119  39%  658 aa  SYT_BRUAB RecName: Full=Threonyl-tRNA synthetase;       
    5::645     e-119  39%  658 aa  SYT_BRUA2 RecName: Full=Threonyl-tRNA synthetase;       
    5::645     e-119  39%  658 aa  SYT_BRUA1 RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-118  36%  635 aa  SYT_XYLFM RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-118  37%  642 aa  SYT_SHESR RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-118  35%  637 aa  SYT_NEIMA RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-118  38%  635 aa  SYT_HERAR RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-118  35%  643 aa  SYT_ACTSZ RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-118  37%  642 aa  SYT_SHESM RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-118  37%  642 aa  SYT_SHESA RecName: Full=Threonyl-tRNA synthetase;       
    1::629     e-118  37%  636 aa  SYT_DESAA RecName: Full=Threonyl-tRNA synthetase;       
   19::578     e-118  40%  582 aa  SYT_DEHSB RecName: Full=Threonyl-tRNA synthetase;       
    5::645     e-118  39%  658 aa  SYT_BRUME RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-118  36%  635 aa  SYT_XYLFT RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-118  36%  635 aa  SYT_XYLF2 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-118  35%  642 aa  SYT_HAES1 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-118  36%  640 aa  SYT_ACIAD RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-118  36%  642 aa  SYT_SHEDO RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-118  35%  640 aa  SYT_PSEPG RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-118  36%  633 aa  SYT_LARHH RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-118  35%  640 aa  SYT_ACIBS RecName: Full=Threonyl-tRNA synthetase;       
    6::645     e-118  39%  661 aa  SYT_RHIME RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-118  35%  637 aa  SYT_NEIM0 RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-118  37%  639 aa  SYT_DIAST RecName: Full=Threonyl-tRNA synthetase;       
    3::621     e-118  38%  649 aa  SYT_DEIRA RecName: Full=Threonyl-tRNA synthetase;       
   19::578     e-118  39%  582 aa  SYT_DEHSC RecName: Full=Threonyl-tRNA synthetase;       
    6::662     e-118  38%  677 aa  SYT_BIFLD RecName: Full=Threonyl-tRNA synthetase;       
    5::644     e-118  38%  662 aa  SYT_AGRRK RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-118  37%  642 aa  SYT_SHEAM RecName: Full=Threonyl-tRNA synthetase;       
    5::622     e-118  39%  661 aa  SYT_RHISN RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-118  35%  642 aa  SYT_HAES2 RecName: Full=Threonyl-tRNA synthetase;       
    5::645     e-118  39%  658 aa  SYT_BRUSU RecName: Full=Threonyl-tRNA synthetase;       
    5::645     e-118  39%  658 aa  SYT_BRUSI RecName: Full=Threonyl-tRNA synthetase;       
    5::645     e-118  39%  658 aa  SYT_BRUC2 RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-118  37%  639 aa  SYT_ACISJ RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-118  35%  640 aa  SYT_PSEPW RecName: Full=Threonyl-tRNA synthetase;       
    1::645     e-117  37%  652 aa  SYT_PARL1 RecName: Full=Threonyl-tRNA synthetase;       
    5::645     e-117  39%  658 aa  SYT_BRUMB RecName: Full=Threonyl-tRNA synthetase;       
    5::646     e-117  40%  658 aa  SYT_RHILO RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-117  36%  638 aa  SYT_PROM2 RecName: Full=Threonyl-tRNA synthetase;       
    1::604     e-117  38%  637 aa  SYT_DESOH RecName: Full=Threonyl-tRNA synthetase;       
    6::662     e-117  38%  677 aa  SYT_BIFLO RecName: Full=Threonyl-tRNA synthetase;       
    5::646     e-117  37%  658 aa  SYT_BARBK RecName: Full=Threonyl-tRNA synthetase;       
    4::572     e-117  39%  580 aa  SYT_UREPA RecName: Full=Threonyl-tRNA synthetase;       
    4::572     e-117  39%  580 aa  SYT_UREP2 RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-117  36%  632 aa  SYT_RUTMC RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-117  35%  643 aa  SYT_MANSM RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-117  35%  643 aa  SYT_PASMU RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-117  36%  642 aa  SYT_TOLAT RecName: Full=Threonyl-tRNA synthetase;       
    5::644     e-117  38%  660 aa  SYT_SINMW RecName: Full=Threonyl-tRNA synthetase;       
    6::662     e-117  38%  677 aa  SYT_BIFLI RecName: Full=Threonyl-tRNA synthetase;       
   25::596     e-117  40%  605 aa  SYT_THEEB RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-117  36%  642 aa  SYT_SHEWM RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-117  36%  642 aa  SYT_SHEFN RecName: Full=Threonyl-tRNA synthetase;       
    1::609     e-117  37%  643 aa  SYT_RHORT RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-117  35%  637 aa  SYT_NEIG1 RecName: Full=Threonyl-tRNA synthetase;       
    7::645     e-116  38%  656 aa  SYT_MESSB RecName: Full=Threonyl-tRNA synthetase;       
    6::557     e-116  39%  581 aa  SYT_BORAP RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-116  37%  642 aa  SYT_SHESH RecName: Full=Threonyl-tRNA synthetase;       
   16::581     e-116  39%  583 aa  SYT_BORHD RecName: Full=Threonyl-tRNA synthetase;       
    4::645     e-116  37%  650 aa  SYT_ANASK RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-116  38%  639 aa  SYT_VEREI RecName: Full=Threonyl-tRNA synthetase;       
    5::643     e-116  37%  658 aa  SYT_BARHE RecName: Full=Threonyl-tRNA synthetase;       
    1::630     e-116  36%  633 aa  SYT_WOLWR RecName: Full=Threonyl-tRNA synthetase;       
    4::645     e-116  37%  650 aa  SYT_ANAD2 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-116  36%  642 aa  SYT_SHIDS RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-116  36%  642 aa  SYT_SHEHH RecName: Full=Threonyl-tRNA synthetase;       
    1::636     e-116  36%  637 aa  SYT_LEPCP RecName: Full=Threonyl-tRNA synthetase;       
    4::621     e-116  36%  640 aa  SYT_HALSA RecName: Full=Threonyl-tRNA synthetase;       
    4::621     e-116  36%  640 aa  SYT_HALS3 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-116  36%  638 aa  SYT_PROMS RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-116  37%  651 aa  SYT_RHOCS RecName: Full=Threonyl-tRNA synthetase;       
    5::643     e-116  38%  661 aa  SYT_RHIL3 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-116  36%  638 aa  SYT_PROM0 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-116  35%  643 aa  SYT_HAEPS RecName: Full=Threonyl-tRNA synthetase;       
    6::643     e-116  37%  656 aa  SYT_BDEBA RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-115  36%  642 aa  SYT_HALWD RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-115  34%  643 aa  SYT_HAEIN RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  36%  638 aa  SYT_ALTMD RecName: Full=Threonyl-tRNA synthetase;       
    5::650     e-115  38%  667 aa  SYT_AGRT5 RecName: Full=Threonyl-tRNA synthetase;       
    1::593     e-115  38%  638 aa  SYT_AZOSB RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-115  35%  643 aa  SYT_HAEI8 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOSE RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOLC RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOHS RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO55 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO24 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_SHISS RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_SHIFL RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_SHIF8 RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-115  37%  638 aa  SYT_LEPIC RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOUT RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOSM RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOLU RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOLI RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOL6 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOL5 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOK1 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECODH RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECOBW RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO81 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO7I RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO45 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO27 RecName: Full=Threonyl-tRNA synthetase;       
    4::645     e-115  37%  658 aa  SYT_RHOPA RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-115  37%  638 aa  SYT_LEPIN RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-115  35%  643 aa  SYT_HAEIG RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO5E RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO57 RecName: Full=Threonyl-tRNA synthetase;       
   16::581     e-115  39%  583 aa  SYT_BORDL RecName: Full=Threonyl-tRNA synthetase;       
    5::643     e-115  37%  658 aa  SYT_BART1 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_SALPK RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_SALPA RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-115  34%  643 aa  SYT_HAEIE RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ECO8A RecName: Full=Threonyl-tRNA synthetase;       
    4::626     e-115  35%  638 aa  SYT_PELUB RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-115  35%  636 aa  SYT_COLP3 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_SALTI RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_SALSV RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_SALA4 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-115  35%  642 aa  SYT_ESCF3 RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-115  39%  633 aa  SYT_EHRCR RecName: Full=Threonyl-tRNA synthetase;       
    6::581     e-115  38%  583 aa  SYT_BORT9 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SHIBS RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SHIB3 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-114  35%  638 aa  SYT_PROM9 RecName: Full=Threonyl-tRNA synthetase;       
    4::629     e-114  38%  642 aa  SYT_HALMA RecName: Full=Threonyl-tRNA synthetase;       
   16::581     e-114  38%  583 aa  SYT_BORRA RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_KLEP3 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_ENT38 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SALTY RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SALHS RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-114  37%  642 aa  SYT_VIBCM RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-114  37%  642 aa  SYT_VIBCH RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SALPB RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SALNS RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SALEP RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SALDC RecName: Full=Threonyl-tRNA synthetase;       
   33::655     e-114  37%  658 aa  SYT_STRCO RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SALG2 RecName: Full=Threonyl-tRNA synthetase;       
    4::633     e-114  38%  642 aa  SYT_NATPD RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-114  37%  642 aa  SYT_VIBC3 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-114  35%  642 aa  SYT_SALCH RecName: Full=Threonyl-tRNA synthetase;       
    6::648     e-114  38%  692 aa  SYT_BIFA0 RecName: Full=Threonyl-tRNA synthetase;       
    5::650     e-113  38%  668 aa  SYT_RHIE6 RecName: Full=Threonyl-tRNA synthetase;       
    4::619     e-113  37%  654 aa  SYT_DINSH RecName: Full=Threonyl-tRNA synthetase;       
    1::637     e-113  36%  637 aa  SYT_THIDA RecName: Full=Threonyl-tRNA synthetase;       
   33::655     e-113  36%  658 aa  SYT_STRAW RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-113  35%  642 aa  SYT_PROMH RecName: Full=Threonyl-tRNA synthetase;       
    1::622     e-113  35%  638 aa  SYT_PROMP RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-113  35%  643 aa  SYT_HAEDU RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-113  36%  641 aa  SYT_AYWBP RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-113  35%  638 aa  SYT_PROM5 RecName: Full=Threonyl-tRNA synthetase;       
    1::618     e-113  38%  633 aa  SYT_EHRRW RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-113  35%  642 aa  SYT_SHELP RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-113  35%  642 aa  SYT_SALPC RecName: Full=Threonyl-tRNA synthetase;       
    5::650     e-113  38%  668 aa  SYT_RHIEC RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-113  36%  645 aa  SYT_GLUOX RecName: Full=Threonyl-tRNA synthetase;       
    1::618     e-113  38%  633 aa  SYT_EHRRG RecName: Full=Threonyl-tRNA synthetase;       
    6::580     e-113  37%  581 aa  SYT_BORBZ RecName: Full=Threonyl-tRNA synthetase;       
    6::580     e-113  37%  581 aa  SYT_BORBU RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-113  36%  639 aa  SYT_LEPBL RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-113  36%  639 aa  SYT_LEPBJ RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-113  38%  642 aa  SYT_AERHH RecName: Full=Threonyl-tRNA synthetase;       
    1::643     e-112  36%  648 aa  SYT_ORITB RecName: Full=Threonyl-tRNA synthetase;       
   35::603     e-112  38%  611 aa  SYT_NAUPA RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-112  35%  640 aa  SYT_ACICJ RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  35%  642 aa  SYT_SERP5 RecName: Full=Threonyl-tRNA synthetase;       
    1::628     e-112  35%  640 aa  SYT_DICNV RecName: Full=Threonyl-tRNA synthetase;       
    1::643     e-112  36%  648 aa  SYT_ORITI RecName: Full=Threonyl-tRNA synthetase;       
    4::607     e-112  37%  648 aa  SYT_SILST RecName: Full=Threonyl-tRNA synthetase;       
    5::650     e-112  37%  666 aa  SYT_AGRVS RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERE8 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_ERWCT RecName: Full=Threonyl-tRNA synthetase;       
   33::655     e-112  36%  658 aa  SYT_STRGG RecName: Full=Threonyl-tRNA synthetase;       
    5::650     e-112  38%  668 aa  SYT_RHILW RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_PECCP RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERPY RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERPS RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERPP RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERPN RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERPG RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERPE RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERPB RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERPA RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-112  34%  642 aa  SYT_YERP3 RecName: Full=Threonyl-tRNA synthetase;       
    4::641     e-112  38%  646 aa  SYT_RHOS4 RecName: Full=Threonyl-tRNA synthetase;       
    1::611     e-112  36%  641 aa  SYT_GLUDA RecName: Full=Threonyl-tRNA synthetase;       
    4::641     e-111  38%  646 aa  SYT_RHOS1 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-111  34%  635 aa  SYT_PSYIN RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-111  36%  633 aa  SYT_EHRCJ RecName: Full=Threonyl-tRNA synthetase;       
    4::641     e-111  38%  646 aa  SYT_RHOSK RecName: Full=Threonyl-tRNA synthetase;       
    1::611     e-111  36%  638 aa  SYT_MAGSA RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-111  38%  642 aa  SYT_AERS4 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-111  34%  643 aa  SYT_ACTPJ RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-111  34%  643 aa  SYT_ACTP7 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-111  34%  643 aa  SYT_ACTP2 RecName: Full=Threonyl-tRNA synthetase;       
   43::643     e-111  38%  658 aa  SYT_BARQU RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-111  39%  657 aa  SYT_HYPNA RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-110  35%  642 aa  SYT_EDWI9 RecName: Full=Threonyl-tRNA synthetase;       
   32::667     e-110  37%  669 aa  SYT_ARTS2 RecName: Full=Threonyl-tRNA synthetase;       
   32::669     e-110  37%  669 aa  SYT_ARTAT RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-110  36%  638 aa  SYT_AZOSE RecName: Full=Threonyl-tRNA synthetase;       
    4::641     e-110  38%  646 aa  SYT_RHOS5 RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-110  34%  642 aa  SYT_PHOLL RecName: Full=Threonyl-tRNA synthetase;       
    1::608     e-110  38%  632 aa  SYT_WOLTR RecName: Full=Threonyl-tRNA synthetase;       
   10::640     e-110  34%  650 aa  SYT_PARUW RecName: Full=Threonyl-tRNA synthetase;       
    3::609     e-110  38%  649 aa  SYT_DEIGD RecName: Full=Threonyl-tRNA synthetase;       
   32::667     e-110  36%  669 aa  SYT_ARTCA RecName: Full=Threonyl-tRNA synthetase;       
    4::619     e-109  37%  648 aa  SYT_ROSDO RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-109  36%  644 aa  SYT_MARMM RecName: Full=Threonyl-tRNA synthetase;       
    9::595     e-109  36%  606 aa  SYT_CAMC1 RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-109  36%  633 aa  SYT_WOLPP RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-108  36%  642 aa  SYT_ERWT9 RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-108  34%  640 aa  SYT_PHYMT RecName: Full=Threonyl-tRNA synthetase;       
   23::682     e-108  35%  694 aa  SYT_COREF RecName: Full=Threonyl-tRNA synthetase;       
   21::591     e-108  38%  603 aa  SYT_CAMLR RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-108  39%  648 aa  SYT_PARDP RecName: Full=Threonyl-tRNA synthetase;       
    1::610     e-107  37%  658 aa  SYT_PHEZH RecName: Full=Threonyl-tRNA synthetase;       
   42::675     e-107  35%  687 aa  SYT_CORDI RecName: Full=Threonyl-tRNA synthetase;       
   16::580     e-107  36%  582 aa  SYT_BORGA RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-107  37%  655 aa  SYT_CAUCR RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-107  37%  655 aa  SYT_CAUCN RecName: Full=Threonyl-tRNA synthetase;       
    1::634     e-107  35%  642 aa  SYT_GRABC RecName: Full=Threonyl-tRNA synthetase;       
    5::630     e-106  37%  659 aa  SYT_ZYMMO RecName: Full=Threonyl-tRNA synthetase;       
    4::607     e-106  37%  648 aa  SYT_SILPO RecName: Full=Threonyl-tRNA synthetase;       
    1::608     e-106  35%  633 aa  SYT_WOLPM RecName: Full=Threonyl-tRNA synthetase;       
    7::656     e-105  34%  659 aa  SYT_THEFY RecName: Full=Threonyl-tRNA synthetase;       
   12::669     e-105  36%  672 aa  SYT_MICLC RecName: Full=Threonyl-tRNA synthetase;       
   43::617     e-105  38%  637 aa  SYT_NEOSM RecName: Full=Threonyl-tRNA synthetase;       
   46::671     e-105  38%  685 aa  SYT_RHOE4 RecName: Full=Threonyl-tRNA synthetase;       
    1::640     e-105  33%  641 aa  SYT_PHYAS RecName: Full=Threonyl-tRNA synthetase;       
   27::593     e-105  35%  602 aa  SYT_CAMJR RecName: Full=Threonyl-tRNA synthetase;       
   27::593     e-105  35%  602 aa  SYT_CAMJ8 RecName: Full=Threonyl-tRNA synthetase;       
    4::666     e-105  34%  668 aa  SYT_NOCSJ RecName: Full=Threonyl-tRNA synthetase;       
   54::677     e-105  36%  691 aa  SYT_MYCUA RecName: Full=Threonyl-tRNA synthetase;       
   39::602     e-105  40%  611 aa  SYT_SYNSC RecName: Full=Threonyl-tRNA synthetase;       
    1::589     e-105  38%  589 aa  SYT_MYCPU RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-105  33%  638 aa  SYT_HAMD5 RecName: Full=Threonyl-tRNA synthetase;       
   27::593     e-105  35%  602 aa  SYT_CAMJJ RecName: Full=Threonyl-tRNA synthetase;       
    9::595     e-105  35%  606 aa  SYT_CAMC5 RecName: Full=Threonyl-tRNA synthetase;       
   54::677     e-104  36%  691 aa  SYT_MYCMM RecName: Full=Threonyl-tRNA synthetase;       
   42::603     e-104  35%  612 aa  SYT_HELPJ RecName: Full=Threonyl-tRNA synthetase;       
   46::670     e-104  36%  684 aa  SYT_MYCPA RecName: Full=Threonyl-tRNA synthetase;       
   42::603     e-104  35%  612 aa  SYT_HELPH RecName: Full=Threonyl-tRNA synthetase;       
   39::585     e-104  38%  611 aa  SYT_SYNS9 RecName: Full=Threonyl-tRNA synthetase;       
   46::670     e-104  36%  684 aa  SYT_MYCA1 RecName: Full=Threonyl-tRNA synthetase;       
   17::597     e-104  35%  609 aa  SYT_CAMHC RecName: Full=Threonyl-tRNA synthetase;       
   83::708     e-104  34%  723 aa  SYTC_HUMAN RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
    5::599     e-104  37%  604 aa  SYT_SULNB RecName: Full=Threonyl-tRNA synthetase;       
   42::603     e-104  35%  612 aa  SYT_HELPY RecName: Full=Threonyl-tRNA synthetase;       
    1::638     e-104  36%  659 aa  SYT_CAUSK RecName: Full=Threonyl-tRNA synthetase;       
   47::670     e-104  36%  684 aa  SYT_MYCS2 RecName: Full=Threonyl-tRNA synthetase;       
   83::708     e-104  34%  723 aa  SYTC_BOVIN RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
   42::603     e-104  35%  612 aa  SYT_HELP2 RecName: Full=Threonyl-tRNA synthetase;       
   50::677     e-104  35%  691 aa  SYT_CORJK RecName: Full=Threonyl-tRNA synthetase;       
   27::593     e-104  35%  602 aa  SYT_CAMJE RecName: Full=Threonyl-tRNA synthetase;       
   82::707     e-104  35%  722 aa  SYTC_MOUSE RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
   16::571     e-104  36%  585 aa  SYT_TREDE RecName: Full=Threonyl-tRNA synthetase;       
   36::625     e-103  35%  635 aa  SYT_CHLAB RecName: Full=Threonyl-tRNA synthetase;       
   27::593     e-103  35%  602 aa  SYT_CAMJD RecName: Full=Threonyl-tRNA synthetase;       
    4::655     e-103  34%  658 aa  SYT_FRASN RecName: Full=Threonyl-tRNA synthetase;       
   39::593     e-103  40%  611 aa  SYT_SYNPX RecName: Full=Threonyl-tRNA synthetase;       
   43::670     e-103  34%  684 aa  SYT_MYCA9 RecName: Full=Threonyl-tRNA synthetase;       
   47::675     e-103  35%  687 aa  SYT_CORA7 RecName: Full=Threonyl-tRNA synthetase;       
    1::622     e-103  38%  635 aa  SYT_CHLMU RecName: Full=Threonyl-tRNA synthetase;       
   36::625     e-103  37%  635 aa  SYT_CHLCV RecName: Full=Threonyl-tRNA synthetase;       
   42::603     e-103  35%  612 aa  SYT_HELPS RecName: Full=Threonyl-tRNA synthetase;       
   55::677     e-103  35%  695 aa  SYTC_RAT RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;      
  161::787     e-103  33%  802 aa  SYTC2_HUMAN RecName: Full=Probable threonyl-tRNA synthetase 2,
  174::799     e-103  33%  814 aa  SYTC2_XENTR RecName: Full=Probable threonyl-tRNA synthetase 2,
    4::635     e-103  33%  642 aa  SYT_SODGM RecName: Full=Threonyl-tRNA synthetase;       
   24::683     e-103  35%  695 aa  SYT_CORGL RecName: Full=Threonyl-tRNA synthetase;       
   75::706     e-103  36%  709 aa  SYTM_ARATH RecName: Full=Threonyl-tRNA synthetase, mitochondrial;  
   42::603     e-102  35%  612 aa  SYT_HELPG RecName: Full=Threonyl-tRNA synthetase;       
   42::603     e-102  35%  612 aa  SYT_HELAH RecName: Full=Threonyl-tRNA synthetase;       
   68::672     e-102  35%  695 aa  SYT_MYCGI RecName: Full=Threonyl-tRNA synthetase;       
    4::650     e-102  36%  664 aa  SYT_NOVAD RecName: Full=Threonyl-tRNA synthetase;       
   39::587     e-101  38%  617 aa  SYT_SYNS3 RecName: Full=Threonyl-tRNA synthetase;       
   46::670     e-101  36%  684 aa  SYT_MYCSS RecName: Full=Threonyl-tRNA synthetase;       
   46::670     e-101  36%  684 aa  SYT_MYCSK RecName: Full=Threonyl-tRNA synthetase;       
   46::670     e-101  36%  684 aa  SYT_MYCSJ RecName: Full=Threonyl-tRNA synthetase;       
   33::687     e-101  35%  695 aa  SYT_LEIXX RecName: Full=Threonyl-tRNA synthetase;       
   33::599     e-101  35%  604 aa  SYT_HELHP RecName: Full=Threonyl-tRNA synthetase;       
   39::593     e-101  39%  610 aa  SYT_SYNPW RecName: Full=Threonyl-tRNA synthetase;       
  170::775     e-101  34%  790 aa  SYTC2_MOUSE RecName: Full=Probable threonyl-tRNA synthetase 2,
   46::671     e-101  36%  685 aa  SYT_RHOSR RecName: Full=Threonyl-tRNA synthetase;       
   36::625     e-101  38%  635 aa  SYT_CHLFF RecName: Full=Threonyl-tRNA synthetase;       
   82::706     e-101  33%  725 aa  SYTC_CAEEL RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
    1::626     e-101  35%  635 aa  SYT_CHLTR RecName: Full=Threonyl-tRNA synthetase;       
    1::626     e-101  35%  635 aa  SYT_CHLTA RecName: Full=Threonyl-tRNA synthetase;       
    1::626     e-100  35%  635 aa  SYT_CHLTB RecName: Full=Threonyl-tRNA synthetase;       
    1::626     e-100  35%  635 aa  SYT_CHLT2 RecName: Full=Threonyl-tRNA synthetase;       
    1::625     e-100  35%  635 aa  SYT_CHLPN RecName: Full=Threonyl-tRNA synthetase;       
    4::657     e-100  35%  672 aa  SYT_ERYLH RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-100  32%  642 aa  SYT_BAUCH RecName: Full=Threonyl-tRNA synthetase;       
   46::674     1e-99  35%  691 aa  SYT_MYCVP RecName: Full=Threonyl-tRNA synthetase;       
   31::654     2e-99  35%  660 aa  SYT_THEVO RecName: Full=Threonyl-tRNA synthetase;       
   46::671     3e-99  37%  685 aa  SYT_RHOOB RecName: Full=Threonyl-tRNA synthetase;       
    4::652     5e-99  35%  667 aa  SYT_SPHAL RecName: Full=Threonyl-tRNA synthetase;       
   54::650     9e-99  35%  692 aa  SYT_MYCTU RecName: Full=Threonyl-tRNA synthetase;       
   54::650     9e-99  35%  692 aa  SYT_MYCTA RecName: Full=Threonyl-tRNA synthetase;       
   54::650     9e-99  35%  692 aa  SYT_MYCBT RecName: Full=Threonyl-tRNA synthetase;       
   54::650     9e-99  35%  692 aa  SYT_MYCBP RecName: Full=Threonyl-tRNA synthetase;       
   54::650     9e-99  35%  692 aa  SYT_MYCBO RecName: Full=Threonyl-tRNA synthetase;       
    4::655     4e-97  33%  660 aa  SYT_THEAC RecName: Full=Threonyl-tRNA synthetase;       
   64::688     2e-96  34%  702 aa  SYT_MYCLE RecName: Full=Threonyl-tRNA synthetase;       
   64::688     2e-96  34%  702 aa  SYT_MYCLB RecName: Full=Threonyl-tRNA synthetase;       
   17::627     5e-96  33%  640 aa  SYT_TROWT RecName: Full=Threonyl-tRNA synthetase;       
   17::627     5e-96  33%  640 aa  SYT_TROW8 RecName: Full=Threonyl-tRNA synthetase;       
   76::674     9e-96  34%  710 aa  SYTC1_DICDI RecName: Full=Probable threonyl-tRNA synthetase 1,
   24::588     2e-95  35%  592 aa  SYT_TREPS RecName: Full=Threonyl-tRNA synthetase;       
   24::588     2e-95  35%  592 aa  SYT_TREPA RecName: Full=Threonyl-tRNA synthetase;       
   17::635     3e-95  32%  636 aa  SYT_WIGBR RecName: Full=Threonyl-tRNA synthetase;       
   75::722     3e-95  33%  734 aa  SYTC_YEAST RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
   39::661     3e-94  34%  684 aa  SYT_PROAC RecName: Full=Threonyl-tRNA synthetase;       
   49::669     7e-94  34%  703 aa  SYTC_SCHPO RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
    4::635     1e-93  32%  642 aa  SYT_BUCAT RecName: Full=Threonyl-tRNA synthetase;       
    4::635     1e-93  32%  642 aa  SYT_BUCAI RecName: Full=Threonyl-tRNA synthetase;       
    4::635     1e-93  32%  642 aa  SYT_BUCA5 RecName: Full=Threonyl-tRNA synthetase;       
    8::635     2e-91  31%  642 aa  SYT_BUCAP RecName: Full=Threonyl-tRNA synthetase;       
   66::709     4e-91  33%  723 aa  SYTM_RAT RecName: Full=Threonyl-tRNA synthetase, mitochondrial;    
   66::713     2e-90  33%  723 aa  SYTM_MOUSE RecName: Full=Threonyl-tRNA synthetase, mitochondrial;  
   61::704     5e-87  32%  718 aa  SYTM_HUMAN RecName: Full=Threonyl-tRNA synthetase, mitochondrial;  
    1::633     1e-83  29%  643 aa  SYT_BUCBP RecName: Full=Threonyl-tRNA synthetase;       
  159::711     2e-83  32%  724 aa  SYTC2_BOVIN RecName: Full=Probable threonyl-tRNA synthetase 2,
  104::531     2e-80  36%  541 aa  SYT_METS5 RecName: Full=Threonyl-tRNA synthetase;       
  120::560     7e-80  38%  564 aa  SYT_MYCGE RecName: Full=Threonyl-tRNA synthetase;       
    7::560     6e-79  33%  564 aa  SYT_MYCPN RecName: Full=Threonyl-tRNA synthetase;       
  103::530     1e-78  37%  540 aa  SYT_SULTO RecName: Full=Threonyl-tRNA synthetase;       
   47::539     5e-78  35%  549 aa  SYT_SULAC RecName: Full=Threonyl-tRNA synthetase;       
  108::535     6e-76  35%  545 aa  SYT_SULSO RecName: Full=Threonyl-tRNA synthetase;       
  108::535     6e-76  35%  545 aa  SYT_SULIY RecName: Full=Threonyl-tRNA synthetase;       
  108::535     6e-76  35%  545 aa  SYT_SULIN RecName: Full=Threonyl-tRNA synthetase;       
  108::535     6e-76  35%  545 aa  SYT_SULIL RecName: Full=Threonyl-tRNA synthetase;       
  108::535     6e-76  35%  545 aa  SYT_SULIA RecName: Full=Threonyl-tRNA synthetase;       
  108::535     1e-75  35%  545 aa  SYT_SULIK RecName: Full=Threonyl-tRNA synthetase;       
  108::535     2e-75  35%  545 aa  SYT_SULIM RecName: Full=Threonyl-tRNA synthetase;       
   44::694     1e-62  30%  698 aa  SYTC2_DICDI RecName: Full=Probable threonyl-tRNA synthetase 2,
   48::438     7e-61  35%  462 aa  SYTM_YEAST RecName: Full=Threonyl-tRNA synthetase, mitochondrial;  
   47::447     2e-60  36%  473 aa  SYTM_SCHPO RecName: Full=Probable threonyl-tRNA synthetase,
  203::595     4e-45  33%  621 aa  SYT_NITMS RecName: Full=Threonyl-tRNA synthetase;       
  233::600     7e-43  33%  626 aa  SYT_PYRKO RecName: Full=Threonyl-tRNA synthetase;       
  233::600     3e-42  33%  626 aa  SYT_THEGJ RecName: Full=Threonyl-tRNA synthetase;       
   43::149     3e-42  37%  458 aa  SYTC_ARATH RecName: Full=Probable threonyl-tRNA synthetase,
  234::601     2e-41  32%  627 aa  SYT_THEON RecName: Full=Threonyl-tRNA synthetase;       
  207::599     1e-40  31%  625 aa  SYT_THESM RecName: Full=Threonyl-tRNA synthetase;       
  232::599     3e-39  32%  625 aa  SYT_PYRFU RecName: Full=Threonyl-tRNA synthetase;       
  216::593     3e-39  31%  635 aa  SYT_METBF RecName: Full=Threonyl-tRNA synthetase;       
  203::587     5e-39  32%  625 aa  SYT_PYRHO RecName: Full=Threonyl-tRNA synthetase;       
  216::593     2e-38  31%  635 aa  SYT_METAC RecName: Full=Threonyl-tRNA synthetase;       
  197::589     3e-38  28%  614 aa  SYT_METST RecName: Full=Threonyl-tRNA synthetase;       
  198::577     3e-38  31%  624 aa  SYT_METKA RecName: Full=Threonyl-tRNA synthetase;       
  222::572     7e-38  34%  619 aa  SYT_ARCFU RecName: Full=Threonyl-tRNA synthetase;       
   11::221     2e-37  35%  227 aa  SYT_PSESY RecName: Full=Threonyl-tRNA synthetase;       
  203::587     1e-36  30%  625 aa  SYT_PYRAB RecName: Full=Threonyl-tRNA synthetase;       
  215::588     1e-36  34%  634 aa  SYT_METMA RecName: Full=Threonyl-tRNA synthetase;       
  212::592     1e-36  29%  635 aa  SYT_METBU RecName: Full=Threonyl-tRNA synthetase;       
  217::618     4e-36  29%  641 aa  SYT_UNCMA RecName: Full=Threonyl-tRNA synthetase;       
  195::584     4e-36  29%  605 aa  SYT_METTH RecName: Full=Threonyl-tRNA synthetase;       
  197::596     5e-36  30%  615 aa  SYT_CENSY RecName: Full=Threonyl-tRNA synthetase;       
   31::344     1e-35  35%  471 aa  SYT1_AERPE RecName: Full=Probable threonyl-tRNA synthetase 1;      
  202::581     4e-35  30%  619 aa  SYT_METTP RecName: Full=Threonyl-tRNA synthetase;       
  278::592     8e-34  30%  614 aa  SYT_STAMF RecName: Full=Threonyl-tRNA synthetase;       
  196::584     4e-32  29%  608 aa  SYT_METS3 RecName: Full=Threonyl-tRNA synthetase;       
  223::571     4e-32  30%  614 aa  SYT_METB6 RecName: Full=Threonyl-tRNA synthetase;       
  233::584     4e-31  31%  630 aa  SYT_META3 RecName: Full=Threonyl-tRNA synthetase;       
  273::586     7e-30  30%  608 aa  SYT_THEPD RecName: Full=Threonyl-tRNA synthetase;       
  220::593     7e-30  28%  611 aa  SYT_METMJ RecName: Full=Threonyl-tRNA synthetase;       
  225::575     9e-30  31%  622 aa  SYT_METMP RecName: Full=Threonyl-tRNA synthetase;       
  301::608     6e-29  28%  633 aa  SYT_NANEQ RecName: Full=Threonyl-tRNA synthetase;       
  225::575     6e-29  30%  622 aa  SYT_METM5 RecName: Full=Threonyl-tRNA synthetase;       
  225::575     2e-28  30%  622 aa  SYT_METM6 RecName: Full=Threonyl-tRNA synthetase;       
  225::575     2e-28  30%  622 aa  SYT_METM7 RecName: Full=Threonyl-tRNA synthetase;       
  252::571     3e-28  31%  608 aa  SYT_PYRAR RecName: Full=Threonyl-tRNA synthetase;       
  274::582     6e-28  30%  607 aa  SYT_PYRCJ RecName: Full=Threonyl-tRNA synthetase;       
  219::566     6e-28  29%  609 aa  SYT_METPE RecName: Full=Threonyl-tRNA synthetase;       
  280::595     6e-28  29%  625 aa  SYT_HYPBU RecName: Full=Threonyl-tRNA synthetase;       
  198::601     1e-27  28%  620 aa  SYT_METJA RecName: Full=Threonyl-tRNA synthetase;       
  265::588     3e-27  32%  613 aa  SYT_CALMQ RecName: Full=Threonyl-tRNA synthetase;       
  261::577     7e-27  29%  609 aa  SYT_PYRIL RecName: Full=Threonyl-tRNA synthetase;       
  275::571     9e-27  32%  608 aa  SYT_PYRAE RecName: Full=Threonyl-tRNA synthetase;       
  276::556     3e-23  30%  609 aa  SYT_THENV RecName: Full=Threonyl-tRNA synthetase;       
  225::606     2e-22  28%  622 aa  SYT_METVS RecName: Full=Threonyl-tRNA synthetase;       
  281::567     2e-22  30%  610 aa  SYT_METHJ RecName: Full=Threonyl-tRNA synthetase;       
   38::554     1e-15  30%  574 aa  SYP_DESDA RecName: Full=Prolyl-tRNA synthetase;       
   38::438     6e-15  27%  451 aa  SYP_ROSDO RecName: Full=Prolyl-tRNA synthetase;       
   38::409     1e-14  24%  425 aa  SYP_ANAMM RecName: Full=Prolyl-tRNA synthetase;       
   33::190     7e-14  29%  573 aa  SYP_RALEJ RecName: Full=Prolyl-tRNA synthetase;       
  140::388     9e-14  28%  431 aa  SYS_LEPCP RecName: Full=Seryl-tRNA synthetase;       
  140::381     9e-14  27%  423 aa  SYS_LACLA RecName: Full=Seryl-tRNA synthetase;       
  140::381     1e-13  27%  423 aa  SYS_LACLS RecName: Full=Seryl-tRNA synthetase;       
  140::381     1e-13  27%  423 aa  SYS_LACLM RecName: Full=Seryl-tRNA synthetase;       
  138::413     1e-13  25%  417 aa  SYS_CAMHC RecName: Full=Seryl-tRNA synthetase;       
   33::190     4e-13  27%  573 aa  SYP_RALME RecName: Full=Prolyl-tRNA synthetase;       
   33::573     4e-13  27%  573 aa  SYP_RALEH RecName: Full=Prolyl-tRNA synthetase;       
   33::190     4e-13  28%  573 aa  SYP_CUPTR RecName: Full=Prolyl-tRNA synthetase;       
   33::547     6e-13  32%  567 aa  SYP_FUSNN RecName: Full=Prolyl-tRNA synthetase;       
   26::382     7e-13  25%  469 aa  SYP_METS3 RecName: Full=Prolyl-tRNA synthetase;       
   40::388     1e-12  24%  488 aa  SYP_PYRAR RecName: Full=Prolyl-tRNA synthetase;       
   38::444     2e-12  27%  451 aa  SYP_SILST RecName: Full=Prolyl-tRNA synthetase;       
   37::439     2e-12  25%  440 aa  SYP_RHILW RecName: Full=Prolyl-tRNA synthetase;       
  140::380     2e-12  26%  425 aa  SYS_LACS1 RecName: Full=Seryl-tRNA synthetase;       
   39::387     2e-12  25%  487 aa  SYP_THENV RecName: Full=Prolyl-tRNA synthetase;       
   34::559     2e-12  29%  564 aa  SYP_SULSY RecName: Full=Prolyl-tRNA synthetase;       
   38::436     2e-12  26%  440 aa  SYP_GRABC RecName: Full=Prolyl-tRNA synthetase;       
  134::409     3e-12  24%  411 aa  SYS_CAMLR RecName: Full=Seryl-tRNA synthetase;       
   37::439     3e-12  25%  440 aa  SYP_RHIL3 RecName: Full=Prolyl-tRNA synthetase;       
   37::439     3e-12  25%  440 aa  SYP_RHIEC RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-12  29%  577 aa  SYP_JANMA RecName: Full=Prolyl-tRNA synthetase;       
   38::435     3e-12  25%  438 aa  SYP_GLUOX RecName: Full=Prolyl-tRNA synthetase;       
   38::190     3e-12  28%  576 aa  SYP_BORPD RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-12  31%  576 aa  SYP_BORA1 RecName: Full=Prolyl-tRNA synthetase;       
   33::161     5e-12  29%  574 aa  SYP_RALPJ RecName: Full=Prolyl-tRNA synthetase;       
   40::388     6e-12  24%  488 aa  SYP_PYRIL RecName: Full=Prolyl-tRNA synthetase;       
   35::190     6e-12  26%  571 aa  SYP_PSYIN RecName: Full=Prolyl-tRNA synthetase;       
   33::161     6e-12  29%  577 aa  SYP_HERAR RecName: Full=Prolyl-tRNA synthetase;       
  156::441     8e-12  26%  441 aa  SYS_THEVO RecName: Full=Seryl-tRNA synthetase;       
  140::319     8e-12  26%  427 aa  SYS_CHLT3 RecName: Full=Seryl-tRNA synthetase;       
   38::437     8e-12  25%  441 aa  SYP_BARQU RecName: Full=Prolyl-tRNA synthetase;       
  140::379     1e-11  26%  424 aa  SYS_STRZT RecName: Full=Seryl-tRNA synthetase;       
  140::379     1e-11  26%  424 aa  SYS_STRZJ RecName: Full=Seryl-tRNA synthetase;       
  140::379     1e-11  26%  424 aa  SYS_STRR6 RecName: Full=Seryl-tRNA synthetase;       
  140::379     1e-11  26%  424 aa  SYS_STRPN RecName: Full=Seryl-tRNA synthetase;       
  140::379     1e-11  26%  424 aa  SYS_STRPI RecName: Full=Seryl-tRNA synthetase;       
  140::379     1e-11  26%  424 aa  SYS_STRP4 RecName: Full=Seryl-tRNA synthetase;       
  140::379     1e-11  26%  424 aa  SYS_STRP2 RecName: Full=Seryl-tRNA synthetase;       
  138::382     1e-11  25%  427 aa  SYS_LACCB RecName: Full=Seryl-tRNA synthetase;       
  138::382     1e-11  25%  427 aa  SYS_LACC3 RecName: Full=Seryl-tRNA synthetase;       
   37::439     1e-11  25%  440 aa  SYP_RHIE6 RecName: Full=Prolyl-tRNA synthetase;       
   33::161     1e-11  30%  574 aa  SYP_RALSO RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-11  28%  577 aa  SYP_THENN RecName: Full=Prolyl-tRNA synthetase;       
   37::381     1e-11  24%  474 aa  SYP_AYWBP RecName: Full=Prolyl-tRNA synthetase;       
  140::379     2e-11  26%  424 aa  SYS_STRZP RecName: Full=Seryl-tRNA synthetase;       
  140::379     2e-11  26%  424 aa  SYS_STRPJ RecName: Full=Seryl-tRNA synthetase;       
  140::379     2e-11  26%  424 aa  SYS_STRP7 RecName: Full=Seryl-tRNA synthetase;       
   35::190     2e-11  27%  577 aa  SYP_THEP1 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-11  27%  577 aa  SYP_THEMA RecName: Full=Prolyl-tRNA synthetase;       
   35::262     2e-11  24%  581 aa  SYP_BLOFL RecName: Full=Prolyl-tRNA synthetase;       
  149::389     2e-11  24%  436 aa  SYS_LEUCK RecName: Full=Seryl-tRNA synthetase;       
  143::319     2e-11  26%  427 aa  SYS_CHLPB RecName: Full=Seryl-tRNA synthetase;       
   38::434     2e-11  25%  443 aa  SYP_ZYMMO RecName: Full=Prolyl-tRNA synthetase;       
   40::388     2e-11  24%  488 aa  SYP_PYRAE RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-11  31%  581 aa  SYP_AZOSB RecName: Full=Prolyl-tRNA synthetase;       
  140::379     3e-11  26%  425 aa  SYS_STRTD RecName: Full=Seryl-tRNA synthetase;       
   38::190     3e-11  28%  577 aa  SYP_THESQ RecName: Full=Prolyl-tRNA synthetase;       
   33::193     3e-11  26%  600 aa  SYP_PROM4 RecName: Full=Prolyl-tRNA synthetase;       
   33::177     3e-11  28%  565 aa  SYP_HYDS0 RecName: Full=Prolyl-tRNA synthetase;       
   35::577     3e-11  27%  579 aa  SYP_HAMD5 RecName: Full=Prolyl-tRNA synthetase;       
  140::379     4e-11  26%  425 aa  SYS_STRU0 RecName: Full=Seryl-tRNA synthetase;       
   38::161     4e-11  27%  450 aa  SYP_PARDP RecName: Full=Prolyl-tRNA synthetase;       
   38::436     4e-11  26%  444 aa  SYP_MARMM RecName: Full=Prolyl-tRNA synthetase;       
   38::193     4e-11  28%  568 aa  SYP_CHRVO RecName: Full=Prolyl-tRNA synthetase;       
   35::563     4e-11  29%  572 aa  SYP_ALTMD RecName: Full=Prolyl-tRNA synthetase;       
   38::558     5e-11  28%  563 aa  SYP_PERMH RecName: Full=Prolyl-tRNA synthetase;       
   35::194     5e-11  29%  604 aa  SYP_NOSP7 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-11  30%  583 aa  SYP_AZOSE RecName: Full=Prolyl-tRNA synthetase;       
  140::379     7e-11  26%  425 aa  SYS_STRPZ RecName: Full=Seryl-tRNA synthetase;       
  140::379     7e-11  26%  425 aa  SYS_STRPD RecName: Full=Seryl-tRNA synthetase;       
  140::373     7e-11  25%  423 aa  SYS_LACBA RecName: Full=Seryl-tRNA synthetase;       
   35::353     7e-11  23%  573 aa  SYP_LACF3 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     7e-11  29%  576 aa  SYP_BORPE RecName: Full=Prolyl-tRNA synthetase;       
   38::161     7e-11  29%  576 aa  SYP_BORPA RecName: Full=Prolyl-tRNA synthetase;       
   38::161     7e-11  29%  576 aa  SYP_BORBR RecName: Full=Prolyl-tRNA synthetase;       
  140::379     9e-11  26%  425 aa  SYS_STRPM RecName: Full=Seryl-tRNA synthetase;       
  140::379     9e-11  26%  425 aa  SYS_STRPF RecName: Full=Seryl-tRNA synthetase;       
  140::379     9e-11  26%  425 aa  SYS_STRPC RecName: Full=Seryl-tRNA synthetase;       
  140::379     9e-11  26%  425 aa  SYS_STRPB RecName: Full=Seryl-tRNA synthetase;       
  140::379     9e-11  26%  425 aa  SYS_STRP8 RecName: Full=Seryl-tRNA synthetase;       
  140::379     9e-11  26%  425 aa  SYS_STRP6 RecName: Full=Seryl-tRNA synthetase;       
  140::379     9e-11  26%  425 aa  SYS_STRP3 RecName: Full=Seryl-tRNA synthetase;       
  140::379     9e-11  26%  425 aa  SYS_STRP1 RecName: Full=Seryl-tRNA synthetase;       
   35::190     9e-11  26%  567 aa  SYP_STRMK RecName: Full=Prolyl-tRNA synthetase;       
   35::571     9e-11  29%  571 aa  SYP_PSEA6 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     9e-11  26%  577 aa  SYP_LACRJ RecName: Full=Prolyl-tRNA synthetase;       
   35::190     9e-11  26%  577 aa  SYP_LACRD RecName: Full=Prolyl-tRNA synthetase;       
   35::570     9e-11  25%  572 aa  SYP_ENT38 RecName: Full=Prolyl-tRNA synthetase;       
   38::424     9e-11  24%  426 aa  SYP_ANAPZ RecName: Full=Prolyl-tRNA synthetase;       
  140::379     1e-10  26%  425 aa  SYS_STRSV RecName: Full=Seryl-tRNA synthetase;       
  140::379     1e-10  26%  425 aa  SYS_STRGC RecName: Full=Seryl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERPY RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERPS RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERPP RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERPN RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERPG RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERPE RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERPB RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERPA RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERP3 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     1e-10  26%  572 aa  SYP_YERE8 RecName: Full=Prolyl-tRNA synthetase;       
   38::438     1e-10  26%  464 aa  SYP_SILPO RecName: Full=Prolyl-tRNA synthetase;       
  141::349     2e-10  28%  422 aa  SYS_MYCAP RecName: Full=Seryl-tRNA synthetase;       
   35::564     2e-10  26%  572 aa  SYP_PHOLL RecName: Full=Prolyl-tRNA synthetase;       
   38::191     2e-10  28%  570 aa  SYP_NEIMB RecName: Full=Prolyl-tRNA synthetase;       
   25::360     2e-10  24%  469 aa  SYP_METST RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-10  29%  586 aa  SYP_LEPBP RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-10  29%  586 aa  SYP_LEPBA RecName: Full=Prolyl-tRNA synthetase;       
   38::190     2e-10  25%  576 aa  SYP_DECAR RecName: Full=Prolyl-tRNA synthetase;       
   35::194     2e-10  29%  600 aa  SYP_CYAP7 RecName: Full=Prolyl-tRNA synthetase;       
   35::201     2e-10  25%  557 aa  SYP_BAUCH RecName: Full=Prolyl-tRNA synthetase;       
  140::379     2e-10  26%  426 aa  SYS_STRMU RecName: Full=Seryl-tRNA synthetase;       
   35::570     2e-10  26%  572 aa  SYP_KLEP3 RecName: Full=Prolyl-tRNA synthetase;       
   35::553     2e-10  27%  572 aa  SYP_HAEIG RecName: Full=Prolyl-tRNA synthetase;       
   35::553     2e-10  27%  572 aa  SYP_HAEIE RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-10  24%  574 aa  SYP_FERNB RecName: Full=Prolyl-tRNA synthetase;       
   33::190     2e-10  25%  565 aa  SYP_CAMLR RecName: Full=Prolyl-tRNA synthetase;       
  137::385     3e-10  25%  431 aa  SYS_BURXL RecName: Full=Seryl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SHISS RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SHIFL RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SHIF8 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SHIDS RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SHIBS RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SHIB3 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-10  27%  445 aa  SYP_RHOSK RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-10  27%  445 aa  SYP_RHOS4 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-10  27%  445 aa  SYP_RHOS1 RecName: Full=Prolyl-tRNA synthetase;       
   36::194     3e-10  27%  600 aa  SYP_PROM0 RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-10  29%  568 aa  SYP_NITEU RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_KLEP7 RecName: Full=Prolyl-tRNA synthetase;       
   38::190     3e-10  28%  567 aa  SYP_GEOKA RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  25%  572 aa  SYP_ERWCT RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  25%  572 aa  SYP_ENTS8 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECOSE RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECOLU RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECOLI RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECOLC RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECOHS RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECODH RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECOBW RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECO8A RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECO5E RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECO57 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECO55 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_ECO24 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-10  27%  445 aa  SYP_DINSH RecName: Full=Prolyl-tRNA synthetase;       
   33::190     3e-10  26%  569 aa  SYP_CAMHC RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  26%  578 aa  SYP_BURTA RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  26%  578 aa  SYP_BURPS RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  26%  578 aa  SYP_BURP6 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  26%  578 aa  SYP_BURP1 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  26%  578 aa  SYP_BURP0 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  26%  578 aa  SYP_BURMS RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  26%  578 aa  SYP_BURM9 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  26%  578 aa  SYP_BURM7 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  25%  571 aa  SYP_ACIBS RecName: Full=Prolyl-tRNA synthetase;       
  148::368     3e-10  24%  435 aa  SYS_LEUMM RecName: Full=Seryl-tRNA synthetase;       
  159::350     3e-10  26%  428 aa  SYS_CHLMU RecName: Full=Seryl-tRNA synthetase;       
  137::385     3e-10  26%  433 aa  SYS_BURTA RecName: Full=Seryl-tRNA synthetase;       
   35::190     3e-10  26%  567 aa  SYP_STRM5 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALTY RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALTI RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALSV RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALPK RecName: Full=Prolyl-tRNA synthetase;       
   35::168     3e-10  25%  572 aa  SYP_SALPC RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALPB RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALPA RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALNS RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALHS RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALG2 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALEP RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALDC RecName: Full=Prolyl-tRNA synthetase;       
   35::168     3e-10  25%  572 aa  SYP_SALCH RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALAR RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_SALA4 RecName: Full=Prolyl-tRNA synthetase;       
   36::165     3e-10  30%  600 aa  SYP_PROMS RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  26%  572 aa  SYP_PECCP RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-10  27%  441 aa  SYP_OLICO RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-10  31%  570 aa  SYP_NEIMF RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-10  31%  570 aa  SYP_NEIMA RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-10  33%  570 aa  SYP_NEIG1 RecName: Full=Prolyl-tRNA synthetase;       
   35::172     3e-10  27%  616 aa  SYP_LACLS RecName: Full=Prolyl-tRNA synthetase;       
   35::172     3e-10  27%  616 aa  SYP_LACLM RecName: Full=Prolyl-tRNA synthetase;       
   35::191     3e-10  24%  568 aa  SYP_HALHL RecName: Full=Prolyl-tRNA synthetase;       
   38::175     3e-10  29%  567 aa  SYP_GEOSW RecName: Full=Prolyl-tRNA synthetase;       
   35::554     3e-10  26%  572 aa  SYP_EDWI9 RecName: Full=Prolyl-tRNA synthetase;       
   33::190     3e-10  24%  558 aa  SYP_COPPD RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  27%  572 aa  SYP_CITK8 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-10  25%  569 aa  SYP_BACHD RecName: Full=Prolyl-tRNA synthetase;       
  140::379     4e-10  24%  425 aa  SYS_STRA5 RecName: Full=Seryl-tRNA synthetase;       
  140::379     4e-10  24%  425 aa  SYS_STRA3 RecName: Full=Seryl-tRNA synthetase;       
  140::379     4e-10  24%  425 aa  SYS_STRA1 RecName: Full=Seryl-tRNA synthetase;       
  142::322     4e-10  27%  430 aa  SYS_PELLD RecName: Full=Seryl-tRNA synthetase;       
  138::380     4e-10  23%  435 aa  SYS_LACRJ RecName: Full=Seryl-tRNA synthetase;       
  138::380     4e-10  23%  435 aa  SYS_LACRD RecName: Full=Seryl-tRNA synthetase;       
  138::383     4e-10  24%  424 aa  SYS_ELUMP RecName: Full=Seryl-tRNA synthetase;       
   35::161     4e-10  26%  574 aa  SYP_TOLAT RecName: Full=Prolyl-tRNA synthetase;       
   35::190     4e-10  25%  561 aa  SYP_THEAB RecName: Full=Prolyl-tRNA synthetase;       
   38::563     4e-10  29%  570 aa  SYP_SYNWW RecName: Full=Prolyl-tRNA synthetase;       
   35::164     4e-10  31%  593 aa  SYP_SYNPX RecName: Full=Prolyl-tRNA synthetase;       
   38::161     4e-10  27%  445 aa  SYP_RHOS5 RecName: Full=Prolyl-tRNA synthetase;       
   33::193     4e-10  28%  603 aa  SYP_PROMA RecName: Full=Prolyl-tRNA synthetase;       
   35::190     4e-10  21%  582 aa  SYP_PETMO RecName: Full=Prolyl-tRNA synthetase;       
   38::571     4e-10  29%  571 aa  SYP_PELCD RecName: Full=Prolyl-tRNA synthetase;       
   33::161     4e-10  29%  568 aa  SYP_NITEC RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ESCF3 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECOUT RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECOSM RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECOL6 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECOL5 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECOK1 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECO81 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECO7I RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECO45 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     4e-10  27%  572 aa  SYP_ECO27 RecName: Full=Prolyl-tRNA synthetase;       
   35::189     4e-10  26%  578 aa  SYP_BURMA RecName: Full=Prolyl-tRNA synthetase;       
   38::437     4e-10  22%  440 aa  SYP_AGRT5 RecName: Full=Prolyl-tRNA synthetase;       
  136::380     6e-10  23%  435 aa  SYS_LACH4 RecName: Full=Seryl-tRNA synthetase;       
  136::380     6e-10  23%  435 aa  SYS_LACAC RecName: Full=Seryl-tRNA synthetase;       
  140::376     6e-10  26%  414 aa  SYS_CAMC5 RecName: Full=Seryl-tRNA synthetase;       
  136::359     6e-10  26%  423 aa  SYS1_LACPL RecName: Full=Seryl-tRNA synthetase 1;       
   33::161     6e-10  27%  581 aa  SYP_VEREI RecName: Full=Prolyl-tRNA synthetase;       
   38::161     6e-10  28%  437 aa  SYP_SPHWW RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-10  26%  572 aa  SYP_PSYCK RecName: Full=Prolyl-tRNA synthetase;       
   35::190     6e-10  24%  571 aa  SYP_PROMH RecName: Full=Prolyl-tRNA synthetase;       
   38::164     6e-10  30%  596 aa  SYP_PROM1 RecName: Full=Prolyl-tRNA synthetase;       
   33::190     6e-10  26%  573 aa  SYP_METFK RecName: Full=Prolyl-tRNA synthetase;       
   38::190     6e-10  27%  581 aa  SYP_KOSOT RecName: Full=Prolyl-tRNA synthetase;       
   38::161     6e-10  27%  445 aa  SYP_CAUSK RecName: Full=Prolyl-tRNA synthetase;       
  140::379     8e-10  26%  425 aa  SYS_STRPG RecName: Full=Seryl-tRNA synthetase;       
   35::571     8e-10  27%  574 aa  SYP_SODGM RecName: Full=Prolyl-tRNA synthetase;       
   35::161     8e-10  26%  572 aa  SYP_PSYA2 RecName: Full=Prolyl-tRNA synthetase;       
   38::164     8e-10  30%  596 aa  SYP_PROMT RecName: Full=Prolyl-tRNA synthetase;       
   40::163     8e-10  27%  608 aa  SYP_MICLC RecName: Full=Prolyl-tRNA synthetase;       
   33::161     8e-10  28%  581 aa  SYP_METPP RecName: Full=Prolyl-tRNA synthetase;       
   35::175     8e-10  26%  616 aa  SYP_LACLA RecName: Full=Prolyl-tRNA synthetase;       
   35::563     8e-10  27%  567 aa  SYP_IDILO RecName: Full=Prolyl-tRNA synthetase;       
   38::558     8e-10  30%  575 aa  SYP_DESVM RecName: Full=Prolyl-tRNA synthetase;       
   33::174     8e-10  27%  566 aa  SYP_CAMC1 RecName: Full=Prolyl-tRNA synthetase;       
   38::438     8e-10  26%  439 aa  SYP_BRAJA RecName: Full=Prolyl-tRNA synthetase;       
   38::190     8e-10  24%  565 aa  SYP_BACP2 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     8e-10  25%  571 aa  SYP_ACIBY RecName: Full=Prolyl-tRNA synthetase;       
   35::190     8e-10  25%  571 aa  SYP_ACIBT RecName: Full=Prolyl-tRNA synthetase;       
   35::190     8e-10  25%  571 aa  SYP_ACIBC RecName: Full=Prolyl-tRNA synthetase;       
   35::190     8e-10  25%  571 aa  SYP_ACIB5 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     8e-10  25%  571 aa  SYP_ACIB3 RecName: Full=Prolyl-tRNA synthetase;       
  162::376     1e-09  25%  425 aa  SYS_METLZ RecName: Full=Seryl-tRNA synthetase;       
  137::363     1e-09  25%  432 aa  SYS_METFK RecName: Full=Seryl-tRNA synthetase;       
   38::161     1e-09  29%  560 aa  SYP_VESOH RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-09  28%  616 aa  SYP_STRSV RecName: Full=Prolyl-tRNA synthetase;       
   35::577     1e-09  25%  580 aa  SYP_POLSQ RecName: Full=Prolyl-tRNA synthetase;       
   38::554     1e-09  30%  573 aa  SYP_MOOTA RecName: Full=Prolyl-tRNA synthetase;       
   35::269     1e-09  26%  571 aa  SYP_MANSM RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-09  28%  577 aa  SYP_HELPY RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-09  28%  577 aa  SYP_HELPS RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-09  28%  577 aa  SYP_HELPH RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-09  28%  577 aa  SYP_HELPG RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-09  28%  577 aa  SYP_HELP2 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     1e-09  27%  443 aa  SYP_CAUCR RecName: Full=Prolyl-tRNA synthetase;       
   38::161     1e-09  27%  443 aa  SYP_CAUCN RecName: Full=Prolyl-tRNA synthetase;       
   35::560     1e-09  27%  578 aa  SYP_BURM1 RecName: Full=Prolyl-tRNA synthetase;       
   38::551     1e-09  28%  566 aa  SYP_BACWK RecName: Full=Prolyl-tRNA synthetase;       
   35::194     1e-09  28%  604 aa  SYP_ANAVT RecName: Full=Prolyl-tRNA synthetase;       
   35::194     1e-09  28%  604 aa  SYP_ANASP RecName: Full=Prolyl-tRNA synthetase;       
   38::435     1e-09  23%  437 aa  SYP_ACICJ RecName: Full=Prolyl-tRNA synthetase;       
  143::319     1e-09  25%  431 aa  SYS_PROA2 RecName: Full=Seryl-tRNA synthetase;       
  134::376     1e-09  24%  419 aa  SYS_COREF RecName: Full=Seryl-tRNA synthetase;       
  137::385     1e-09  25%  431 aa  SYS_BURPP RecName: Full=Seryl-tRNA synthetase;       
   33::161     1e-09  27%  581 aa  SYP_VARPS RecName: Full=Prolyl-tRNA synthetase;       
   38::437     1e-09  25%  438 aa  SYP_RHOPT RecName: Full=Prolyl-tRNA synthetase;       
   36::165     1e-09  29%  600 aa  SYP_PROM2 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-09  28%  576 aa  SYP_HELPJ RecName: Full=Prolyl-tRNA synthetase;       
   38::175     1e-09  29%  567 aa  SYP_GEOTN RecName: Full=Prolyl-tRNA synthetase;       
   40::163     1e-09  27%  590 aa  SYP_CLAMS RecName: Full=Prolyl-tRNA synthetase;       
   40::163     1e-09  27%  590 aa  SYP_CLAM3 RecName: Full=Prolyl-tRNA synthetase;       
   34::191     1e-09  23%  569 aa  SYP_CAMJJ RecName: Full=Prolyl-tRNA synthetase;       
  136::376     2e-09  29%  417 aa  SYS_TROWT RecName: Full=Seryl-tRNA synthetase;       
  136::376     2e-09  29%  417 aa  SYS_TROW8 RecName: Full=Seryl-tRNA synthetase;       
  134::376     2e-09  24%  411 aa  SYS_CAMJD RecName: Full=Seryl-tRNA synthetase;       
   35::190     2e-09  24%  564 aa  SYP_XANC5 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-09  24%  564 aa  SYP_XANAC RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-09  28%  559 aa  SYP_RUTMC RecName: Full=Prolyl-tRNA synthetase;       
   38::437     2e-09  25%  438 aa  SYP_RHOPA RecName: Full=Prolyl-tRNA synthetase;       
   35::405     2e-09  28%  493 aa  SYP_PARD8 RecName: Full=Prolyl-tRNA synthetase;       
   37::381     2e-09  24%  474 aa  SYP_ONYPE RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-09  26%  565 aa  SYP_LACH4 RecName: Full=Prolyl-tRNA synthetase;       
   37::192     2e-09  25%  596 aa  SYP_CORJK RecName: Full=Prolyl-tRNA synthetase;       
   34::191     2e-09  23%  569 aa  SYP_CAMJR RecName: Full=Prolyl-tRNA synthetase;       
   34::191     2e-09  23%  569 aa  SYP_CAMJE RecName: Full=Prolyl-tRNA synthetase;       
   34::191     2e-09  23%  569 aa  SYP_CAMJD RecName: Full=Prolyl-tRNA synthetase;       
   35::566     2e-09  28%  572 aa  SYP_CALS8 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-09  26%  578 aa  SYP_BURXL RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-09  24%  581 aa  SYP_BLOPB RecName: Full=Prolyl-tRNA synthetase;       
   34::553     2e-09  26%  571 aa  SYP_ACTSZ RecName: Full=Prolyl-tRNA synthetase;       
  117::417     2e-09  25%  441 aa  SYS_THEAC RecName: Full=Seryl-tRNA synthetase;       
  170::379     2e-09  26%  425 aa  SYS_STREM RecName: Full=Seryl-tRNA synthetase;       
  171::372     2e-09  24%  429 aa  SYS_ENCCU RecName: Full=Seryl-tRNA synthetase;       
  134::376     2e-09  24%  411 aa  SYS_CAMJJ RecName: Full=Seryl-tRNA synthetase;       
  136::401     2e-09  24%  414 aa  SYS_CAMC1 RecName: Full=Seryl-tRNA synthetase;       
   35::164     2e-09  29%  603 aa  SYP_SYNY3 RecName: Full=Prolyl-tRNA synthetase;       
   35::164     2e-09  31%  593 aa  SYP_SYNSC RecName: Full=Prolyl-tRNA synthetase;       
   35::164     2e-09  31%  598 aa  SYP_SYNS3 RecName: Full=Prolyl-tRNA synthetase;       
   38::565     2e-09  27%  569 aa  SYP_SHELP RecName: Full=Prolyl-tRNA synthetase;       
   38::562     2e-09  27%  571 aa  SYP_SHEFN RecName: Full=Prolyl-tRNA synthetase;       
   38::563     2e-09  25%  572 aa  SYP_SHEAM RecName: Full=Prolyl-tRNA synthetase;       
   38::437     2e-09  25%  439 aa  SYP_RHOPS RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-09  25%  576 aa  SYP_PSYWF RecName: Full=Prolyl-tRNA synthetase;       
   35::556     2e-09  27%  574 aa  SYP_PSEHT RecName: Full=Prolyl-tRNA synthetase;       
   43::161     2e-09  26%  580 aa  SYP_POLNS RecName: Full=Prolyl-tRNA synthetase;       
   41::376     2e-09  26%  482 aa  SYP_METTH RecName: Full=Prolyl-tRNA synthetase;       
   38::190     2e-09  24%  577 aa  SYP_MARAV RecName: Full=Prolyl-tRNA synthetase;       
   33::157     2e-09  29%  581 aa  SYP_LEPCP RecName: Full=Prolyl-tRNA synthetase;       
   33::421     2e-09  22%  424 aa  SYP_EHRCJ RecName: Full=Prolyl-tRNA synthetase;       
   33::161     2e-09  26%  581 aa  SYP_DELAS RecName: Full=Prolyl-tRNA synthetase;       
   33::190     2e-09  23%  568 aa  SYP_CAMJ8 RecName: Full=Prolyl-tRNA synthetase;       
   33::161     2e-09  26%  567 aa  SYP_CAMC5 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-09  26%  578 aa  SYP_BURP8 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-09  27%  441 aa  SYP_BART1 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-09  27%  441 aa  SYP_BARBK RecName: Full=Prolyl-tRNA synthetase;       
   38::551     2e-09  29%  566 aa  SYP_BACCQ RecName: Full=Prolyl-tRNA synthetase;       
   38::551     2e-09  29%  566 aa  SYP_BACC7 RecName: Full=Prolyl-tRNA synthetase;       
   38::551     2e-09  29%  566 aa  SYP_BACC4 RecName: Full=Prolyl-tRNA synthetase;       
   38::551     2e-09  29%  566 aa  SYP_BACC3 RecName: Full=Prolyl-tRNA synthetase;       
   38::551     2e-09  29%  566 aa  SYP_BACC0 RecName: Full=Prolyl-tRNA synthetase;       
   38::551     2e-09  29%  566 aa  SYP_BACAC RecName: Full=Prolyl-tRNA synthetase;       
   38::551     2e-09  29%  566 aa  SYP_BACAA RecName: Full=Prolyl-tRNA synthetase;       
   35::194     2e-09  29%  600 aa  SYP_ACAM1 RecName: Full=Prolyl-tRNA synthetase;       
   38::551     2e-09  29%  566 aa  SYP1_BACHK RecName: Full=Prolyl-tRNA synthetase 1;       
   38::551     2e-09  29%  566 aa  SYP1_BACCZ RecName: Full=Prolyl-tRNA synthetase 1;       
   38::551     2e-09  29%  566 aa  SYP1_BACCR RecName: Full=Prolyl-tRNA synthetase 1;       
   38::551     2e-09  29%  566 aa  SYP1_BACC1 RecName: Full=Prolyl-tRNA synthetase 1;       
   38::551     2e-09  29%  566 aa  SYP1_BACAN RecName: Full=Prolyl-tRNA synthetase 1;       
   38::551     2e-09  29%  566 aa  SYP1_BACAH RecName: Full=Prolyl-tRNA synthetase 1;       
  134::376     3e-09  24%  411 aa  SYS_CAMJE RecName: Full=Seryl-tRNA synthetase;       
   37::191     3e-09  24%  568 aa  SYP_SULNB RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-09  24%  572 aa  SYP_SERP5 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     3e-09  26%  575 aa  SYP_SACD2 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-09  27%  439 aa  SYP_PARL1 RecName: Full=Prolyl-tRNA synthetase;       
   35::194     3e-09  26%  603 aa  SYP_MICAN RecName: Full=Prolyl-tRNA synthetase;       
   35::569     3e-09  25%  569 aa  SYP_LEGPL RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-09  23%  569 aa  SYP_LEGPH RecName: Full=Prolyl-tRNA synthetase;       
   35::569     3e-09  25%  569 aa  SYP_LEGPC RecName: Full=Prolyl-tRNA synthetase;       
   35::569     3e-09  25%  569 aa  SYP_LEGPA RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-09  26%  577 aa  SYP_HELAH RecName: Full=Prolyl-tRNA synthetase;       
   38::553     3e-09  28%  571 aa  SYP_HAEDU RecName: Full=Prolyl-tRNA synthetase;       
   35::571     3e-09  25%  572 aa  SYP_ERWT9 RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-09  27%  581 aa  SYP_DIAST RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-09  26%  578 aa  SYP_BURPP RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-09  25%  578 aa  SYP_BURCJ RecName: Full=Prolyl-tRNA synthetase;       
   38::551     3e-09  29%  566 aa  SYP_BACC2 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-09  24%  571 aa  SYP_AZOVD RecName: Full=Prolyl-tRNA synthetase;       
   35::565     3e-09  26%  574 aa  SYP_AERS4 RecName: Full=Prolyl-tRNA synthetase;       
   35::565     3e-09  26%  574 aa  SYP_AERHH RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-09  27%  581 aa  SYP_ACISJ RecName: Full=Prolyl-tRNA synthetase;       
  137::384     4e-09  26%  428 aa  SYS_SHEAM RecName: Full=Seryl-tRNA synthetase;       
  151::361     4e-09  28%  439 aa  SYS_OENOB RecName: Full=Seryl-tRNA synthetase;       
  135::376     4e-09  26%  421 aa  SYS_LEIXX RecName: Full=Seryl-tRNA synthetase;       
  144::369     4e-09  28%  445 aa  SYS_AZOC5 RecName: Full=Seryl-tRNA synthetase;       
   35::161     4e-09  27%  618 aa  SYP_STRU0 RecName: Full=Prolyl-tRNA synthetase;       
   38::412     4e-09  23%  432 aa  SYP_RICBR RecName: Full=Prolyl-tRNA synthetase;       
   38::412     4e-09  23%  432 aa  SYP_RICB8 RecName: Full=Prolyl-tRNA synthetase;       
   33::161     4e-09  26%  580 aa  SYP_RHOFD RecName: Full=Prolyl-tRNA synthetase;       
   35::190     4e-09  23%  571 aa  SYP_PSEAE RecName: Full=Prolyl-tRNA synthetase;       
   35::190     4e-09  23%  571 aa  SYP_PSEAB RecName: Full=Prolyl-tRNA synthetase;       
   35::190     4e-09  23%  571 aa  SYP_PSEA8 RecName: Full=Prolyl-tRNA synthetase;       
   45::192     4e-09  26%  590 aa  SYP_LEIXX RecName: Full=Prolyl-tRNA synthetase;       
   40::163     4e-09  25%  586 aa  SYP_KINRD RecName: Full=Prolyl-tRNA synthetase;       
   41::183     4e-09  33%  589 aa  SYP_GLOVI RecName: Full=Prolyl-tRNA synthetase;       
   37::192     4e-09  24%  566 aa  SYP_COXBU RecName: Full=Prolyl-tRNA synthetase;       
   35::190     4e-09  24%  564 aa  SYP_COXBR RecName: Full=Prolyl-tRNA synthetase;       
   35::190     4e-09  24%  564 aa  SYP_COXBN RecName: Full=Prolyl-tRNA synthetase;       
   34::566     4e-09  27%  569 aa  SYP_COLP3 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     4e-09  28%  578 aa  SYP_BURCM RecName: Full=Prolyl-tRNA synthetase;       
   35::161     4e-09  28%  578 aa  SYP_BURCH RecName: Full=Prolyl-tRNA synthetase;       
   35::161     4e-09  28%  578 aa  SYP_BURCC RecName: Full=Prolyl-tRNA synthetase;       
   35::161     4e-09  28%  578 aa  SYP_BURCA RecName: Full=Prolyl-tRNA synthetase;       
   35::161     4e-09  28%  578 aa  SYP_BURA4 RecName: Full=Prolyl-tRNA synthetase;       
  141::382     5e-09  25%  417 aa  SYS_SULSY RecName: Full=Seryl-tRNA synthetase;       
  139::388     5e-09  26%  435 aa  SYS_PARL1 RecName: Full=Seryl-tRNA synthetase;       
  142::420     5e-09  25%  431 aa  SYS_CHLPD RecName: Full=Seryl-tRNA synthetase;       
  142::419     5e-09  22%  426 aa  SYS_CHLCH RecName: Full=Seryl-tRNA synthetase;       
  137::385     5e-09  25%  433 aa  SYS_BURPS RecName: Full=Seryl-tRNA synthetase;       
  137::385     5e-09  25%  433 aa  SYS_BURP6 RecName: Full=Seryl-tRNA synthetase;       
  137::385     5e-09  25%  433 aa  SYS_BURP1 RecName: Full=Seryl-tRNA synthetase;       
  137::385     5e-09  25%  433 aa  SYS_BURP0 RecName: Full=Seryl-tRNA synthetase;       
  137::385     5e-09  25%  433 aa  SYS_BURMS RecName: Full=Seryl-tRNA synthetase;       
  137::385     5e-09  25%  433 aa  SYS_BURMA RecName: Full=Seryl-tRNA synthetase;       
  137::385     5e-09  25%  433 aa  SYS_BURM9 RecName: Full=Seryl-tRNA synthetase;       
  137::385     5e-09  25%  433 aa  SYS_BURM7 RecName: Full=Seryl-tRNA synthetase;       
   35::161     5e-09  25%  618 aa  SYP_STRP8 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-09  25%  618 aa  SYP_STRP3 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     5e-09  25%  439 aa  SYP_RHOPB RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-09  26%  571 aa  SYP_PSEU5 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-09  25%  571 aa  SYP_PSEA7 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-09  28%  569 aa  SYP_NITMU RecName: Full=Prolyl-tRNA synthetase;       
   38::161     5e-09  26%  439 aa  SYP_NITHX RecName: Full=Prolyl-tRNA synthetase;       
   38::190     5e-09  28%  441 aa  SYP_METPB RecName: Full=Prolyl-tRNA synthetase;       
   35::543     5e-09  31%  570 aa  SYP_CLOTE RecName: Full=Prolyl-tRNA synthetase;       
   35::553     5e-09  27%  571 aa  SYP_ACTPJ RecName: Full=Prolyl-tRNA synthetase;       
  170::379     6e-09  26%  425 aa  SYS_STRS7 RecName: Full=Seryl-tRNA synthetase;       
  170::379     6e-09  25%  425 aa  SYS_STRE4 RecName: Full=Seryl-tRNA synthetase;       
  170::405     6e-09  26%  435 aa  SYS_LACDB RecName: Full=Seryl-tRNA synthetase;       
  170::405     6e-09  26%  435 aa  SYS_LACDA RecName: Full=Seryl-tRNA synthetase;       
  144::384     6e-09  24%  425 aa  SYS_DESPS RecName: Full=Seryl-tRNA synthetase;       
  138::361     6e-09  27%  425 aa  SYS_DESOH RecName: Full=Seryl-tRNA synthetase;       
   35::386     6e-09  23%  472 aa  SYP_UREU1 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     6e-09  27%  573 aa  SYP_THETN RecName: Full=Prolyl-tRNA synthetase;       
   35::190     6e-09  23%  564 aa  SYP_THEM4 RecName: Full=Prolyl-tRNA synthetase;       
   35::599     6e-09  30%  602 aa  SYP_THEEB RecName: Full=Prolyl-tRNA synthetase;       
   36::431     6e-09  21%  435 aa  SYP_SULDN RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRPZ RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRPM RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRPG RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRPF RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRPD RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRPC RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRPB RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRP6 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  25%  618 aa  SYP_STRP1 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  26%  616 aa  SYP_STRGC RecName: Full=Prolyl-tRNA synthetase;       
   38::265     6e-09  22%  566 aa  SYP_STAS1 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     6e-09  25%  439 aa  SYP_RHOP5 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     6e-09  25%  439 aa  SYP_RHOP2 RecName: Full=Prolyl-tRNA synthetase;       
   36::165     6e-09  28%  600 aa  SYP_PROM5 RecName: Full=Prolyl-tRNA synthetase;       
   38::557     6e-09  27%  576 aa  SYP_LEPIN RecName: Full=Prolyl-tRNA synthetase;       
   38::557     6e-09  27%  576 aa  SYP_LEPIC RecName: Full=Prolyl-tRNA synthetase;       
   35::190     6e-09  26%  565 aa  SYP_LACAC RecName: Full=Prolyl-tRNA synthetase;       
   38::557     6e-09  29%  574 aa  SYP_DESVV RecName: Full=Prolyl-tRNA synthetase;       
   38::557     6e-09  29%  574 aa  SYP_DESVH RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  26%  573 aa  SYP_CHRSD RecName: Full=Prolyl-tRNA synthetase;       
   35::161     6e-09  28%  578 aa  SYP_BURS3 RecName: Full=Prolyl-tRNA synthetase;       
  138::373     8e-09  28%  426 aa  SYS_XANCP RecName: Full=Seryl-tRNA synthetase;       
  138::373     8e-09  28%  426 aa  SYS_XANCB RecName: Full=Seryl-tRNA synthetase;       
  138::373     8e-09  28%  426 aa  SYS_XANC8 RecName: Full=Seryl-tRNA synthetase;       
  147::398     8e-09  26%  444 aa  SYS_POLNA RecName: Full=Seryl-tRNA synthetase;       
  142::319     8e-09  23%  431 aa  SYS_PELPB RecName: Full=Seryl-tRNA synthetase;       
  140::382     8e-09  23%  424 aa  SYS_LACSS RecName: Full=Seryl-tRNA synthetase;       
  142::285     8e-09  27%  427 aa  SYS_CHLL2 RecName: Full=Seryl-tRNA synthetase;       
  134::376     8e-09  24%  411 aa  SYS_CAMJ8 RecName: Full=Seryl-tRNA synthetase;       
   35::190     8e-09  23%  564 aa  SYP_XANOR RecName: Full=Prolyl-tRNA synthetase;       
   35::190     8e-09  23%  564 aa  SYP_XANOP RecName: Full=Prolyl-tRNA synthetase;       
   35::190     8e-09  23%  564 aa  SYP_XANOM RecName: Full=Prolyl-tRNA synthetase;       
   38::161     8e-09  29%  570 aa  SYP_THEPX RecName: Full=Prolyl-tRNA synthetase;       
   35::303     8e-09  28%  482 aa  SYP_THEPD RecName: Full=Prolyl-tRNA synthetase;       
   38::161     8e-09  29%  570 aa  SYP_THEP3 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     8e-09  25%  616 aa  SYP_STRMU RecName: Full=Prolyl-tRNA synthetase;       
   38::220     8e-09  23%  566 aa  SYP_STAHJ RecName: Full=Prolyl-tRNA synthetase;       
   33::161     8e-09  26%  580 aa  SYP_POLSJ RecName: Full=Prolyl-tRNA synthetase;       
   35::553     8e-09  28%  571 aa  SYP_PASMU RecName: Full=Prolyl-tRNA synthetase;       
   37::163     8e-09  26%  582 aa  SYP_MYCUA RecName: Full=Prolyl-tRNA synthetase;       
   35::190     8e-09  25%  572 aa  SYP_CLOTH RecName: Full=Prolyl-tRNA synthetase;       
   38::161     8e-09  25%  444 aa  SYP_BRASO RecName: Full=Prolyl-tRNA synthetase;       
   35::161     8e-09  28%  572 aa  SYP_ANATD RecName: Full=Prolyl-tRNA synthetase;       
   39::393     8e-09  25%  480 aa  SYP_ALKOO RecName: Full=Prolyl-tRNA synthetase;       
  138::384     1e-08  28%  426 aa  SYS_XANC5 RecName: Full=Seryl-tRNA synthetase;       
  138::384     1e-08  28%  426 aa  SYS_XANAC RecName: Full=Seryl-tRNA synthetase;       
  179::356     1e-08  25%  425 aa  SYS_METB6 RecName: Full=Seryl-tRNA synthetase;       
  142::365     1e-08  24%  427 aa  SYS_CHLP8 RecName: Full=Seryl-tRNA synthetase;       
  137::385     1e-08  24%  430 aa  SYS_AZOSB RecName: Full=Seryl-tRNA synthetase;       
   35::161     1e-08  24%  564 aa  SYP_XANCP RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  24%  564 aa  SYP_XANCB RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  24%  564 aa  SYP_XANC8 RecName: Full=Prolyl-tRNA synthetase;       
   34::566     1e-08  27%  595 aa  SYP_TREDE RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  27%  574 aa  SYP_THISH RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  26%  578 aa  SYP_SYNAS RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRZT RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRZP RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRZJ RecName: Full=Prolyl-tRNA synthetase;       
   35::184     1e-08  25%  618 aa  SYP_STRS7 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRR6 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRPS RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRPN RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRPJ RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRPI RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRP7 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRP4 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  26%  617 aa  SYP_STRP2 RecName: Full=Prolyl-tRNA synthetase;       
   35::184     1e-08  25%  618 aa  SYP_STRE4 RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAB RecName: Full=Prolyl-tRNA synthetase;       
   38::562     1e-08  25%  569 aa  SYP_SHEWM RecName: Full=Prolyl-tRNA synthetase;       
   38::191     1e-08  23%  570 aa  SYP_SHEON RecName: Full=Prolyl-tRNA synthetase;       
  242::384     1e-08  28%  478 aa  SYP_OCEIH RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  24%  574 aa  SYP_MARMS RecName: Full=Prolyl-tRNA synthetase;       
   35::174     1e-08  27%  565 aa  SYP_LACDB RecName: Full=Prolyl-tRNA synthetase;       
   35::174     1e-08  27%  565 aa  SYP_LACDA RecName: Full=Prolyl-tRNA synthetase;       
  394::563     1e-08  31%  569 aa  SYP_DESRM RecName: Full=Prolyl-tRNA synthetase;       
   38::557     1e-08  30%  575 aa  SYP_DESMR RecName: Full=Prolyl-tRNA synthetase;       
   37::383     1e-08  24%  481 aa  SYP_CALMQ RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  28%  578 aa  SYP_BURVG RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-08  25%  581 aa  SYP_BREBN RecName: Full=Prolyl-tRNA synthetase;       
   38::161     1e-08  25%  444 aa  SYP_BRASB RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-08  24%  570 aa  SYP_ACIAD RecName: Full=Prolyl-tRNA synthetase;       
   33::161     1e-08  26%  581 aa  SYP_ACIAC RecName: Full=Prolyl-tRNA synthetase;       
  137::355     1e-08  23%  428 aa  SYS_PSYCK RecName: Full=Seryl-tRNA synthetase;       
  142::365     1e-08  24%  427 aa  SYS_CHLTE RecName: Full=Seryl-tRNA synthetase;       
  168::410     1e-08  24%  412 aa  SYS_ARCB4 RecName: Full=Seryl-tRNA synthetase;       
  144::397     1e-08  25%  439 aa  SYS_ACIAC RecName: Full=Seryl-tRNA synthetase;       
  140::380     1e-08  23%  425 aa  SYS2_LACPL RecName: Full=Seryl-tRNA synthetase 2;       
   35::161     1e-08  24%  574 aa  SYP_TERTT RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  25%  620 aa  SYP_STRTD RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  25%  617 aa  SYP_STRA5 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  25%  617 aa  SYP_STRA3 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-08  25%  617 aa  SYP_STRA1 RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAW RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAT RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAS RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAR RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAN RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAM RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAE RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAAC RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAA9 RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAA8 RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAA3 RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAA2 RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  567 aa  SYP_STAA1 RecName: Full=Prolyl-tRNA synthetase;       
   38::569     1e-08  27%  571 aa  SYP_SHESW RecName: Full=Prolyl-tRNA synthetase;       
   38::569     1e-08  27%  571 aa  SYP_SHEPC RecName: Full=Prolyl-tRNA synthetase;       
   37::282     1e-08  24%  585 aa  SYP_NOCFA RecName: Full=Prolyl-tRNA synthetase;       
   38::161     1e-08  28%  575 aa  SYP_LAWIP RecName: Full=Prolyl-tRNA synthetase;       
   35::563     1e-08  25%  578 aa  SYP_BRAHW RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-08  24%  566 aa  SYP_BACCN RecName: Full=Prolyl-tRNA synthetase;       
   35::405     1e-08  25%  493 aa  SYP_AZOPC RecName: Full=Prolyl-tRNA synthetase;       
   38::164     1e-08  29%  575 aa  SYP_ANADF RecName: Full=Prolyl-tRNA synthetase;       
  137::376     2e-08  25%  428 aa  SYS_SHEDO RecName: Full=Seryl-tRNA synthetase;       
  146::399     2e-08  25%  442 aa  SYS_DIAST RecName: Full=Seryl-tRNA synthetase;       
  135::377     2e-08  26%  426 aa  SYS_CLAMS RecName: Full=Seryl-tRNA synthetase;       
  137::361     2e-08  26%  432 aa  SYS_BURP8 RecName: Full=Seryl-tRNA synthetase;       
  137::361     2e-08  25%  433 aa  SYS_BURCJ RecName: Full=Seryl-tRNA synthetase;       
  137::361     2e-08  25%  433 aa  SYS_BURCH RecName: Full=Seryl-tRNA synthetase;       
  137::361     2e-08  25%  433 aa  SYS_BURCC RecName: Full=Seryl-tRNA synthetase;       
  145::381     2e-08  29%  449 aa  SYS_BORA1 RecName: Full=Seryl-tRNA synthetase;       
  146::399     2e-08  25%  442 aa  SYS_ACISJ RecName: Full=Seryl-tRNA synthetase;       
   35::374     2e-08  23%  472 aa  SYP_UREPA RecName: Full=Prolyl-tRNA synthetase;       
   35::374     2e-08  23%  472 aa  SYP_UREP2 RecName: Full=Prolyl-tRNA synthetase;       
  241::385     2e-08  28%  488 aa  SYP_SYMTH RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-08  25%  620 aa  SYP_STRT2 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-08  25%  620 aa  SYP_STRT1 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  26%  570 aa  SYP_SHESR RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  26%  570 aa  SYP_SHESM RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  26%  570 aa  SYP_SHESA RecName: Full=Prolyl-tRNA synthetase;       
   36::161     2e-08  26%  442 aa  SYP_RHILO RecName: Full=Prolyl-tRNA synthetase;       
   40::163     2e-08  25%  589 aa  SYP_NOCSJ RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  25%  439 aa  SYP_NITWN RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  441 aa  SYP_METEP RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  441 aa  SYP_METC4 RecName: Full=Prolyl-tRNA synthetase;       
   38::555     2e-08  29%  573 aa  SYP_GEOSM RecName: Full=Prolyl-tRNA synthetase;       
   38::555     2e-08  29%  573 aa  SYP_GEOBB RecName: Full=Prolyl-tRNA synthetase;       
   33::161     2e-08  24%  424 aa  SYP_EHRCR RecName: Full=Prolyl-tRNA synthetase;       
   38::561     2e-08  28%  580 aa  SYP_DESAD RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  570 aa  SYP_CLOPS RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  570 aa  SYP_CLOPE RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  570 aa  SYP_CLOP1 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  28%  572 aa  SYP_BUCAT RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  28%  572 aa  SYP_BUCA5 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  442 aa  SYP_BRUME RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  442 aa  SYP_BRUMB RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  442 aa  SYP_BRUAB RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  442 aa  SYP_BRUA2 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  442 aa  SYP_BRUA1 RecName: Full=Prolyl-tRNA synthetase;       
   38::164     2e-08  29%  574 aa  SYP_ANASK RecName: Full=Prolyl-tRNA synthetase;       
   38::164     2e-08  29%  574 aa  SYP_ANAD2 RecName: Full=Prolyl-tRNA synthetase;       
  141::352     2e-08  27%  434 aa  SYS_RHOPS RecName: Full=Seryl-tRNA synthetase;       
  140::382     2e-08  24%  426 aa  SYS_PEDPA RecName: Full=Seryl-tRNA synthetase;       
  134::376     2e-08  24%  418 aa  SYS_MYCA9 RecName: Full=Seryl-tRNA synthetase;       
  134::376     2e-08  24%  411 aa  SYS_CAMJR RecName: Full=Seryl-tRNA synthetase;       
  139::331     2e-08  28%  442 aa  SYS_BRASB RecName: Full=Seryl-tRNA synthetase;       
   35::164     2e-08  29%  601 aa  SYP_TRIEI RecName: Full=Prolyl-tRNA synthetase;       
   38::562     2e-08  26%  570 aa  SYP_SHEPA RecName: Full=Prolyl-tRNA synthetase;       
   38::563     2e-08  27%  571 aa  SYP_SHEDO RecName: Full=Prolyl-tRNA synthetase;       
   38::441     2e-08  24%  442 aa  SYP_OCHA4 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  27%  441 aa  SYP_METRJ RecName: Full=Prolyl-tRNA synthetase;       
   35::574     2e-08  26%  576 aa  SYP_MAGSM RecName: Full=Prolyl-tRNA synthetase;       
   36::161     2e-08  24%  439 aa  SYP_HYPNA RecName: Full=Prolyl-tRNA synthetase;       
   35::553     2e-08  26%  571 aa  SYP_HAES2 RecName: Full=Prolyl-tRNA synthetase;       
   35::553     2e-08  26%  571 aa  SYP_HAES1 RecName: Full=Prolyl-tRNA synthetase;       
   43::548     2e-08  29%  570 aa  SYP_GEOSF RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-08  26%  441 aa  SYP_BARHE RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-08  27%  572 aa  SYP_ALCBS RecName: Full=Prolyl-tRNA synthetase;       
   35::553     2e-08  26%  571 aa  SYP_ACTP7 RecName: Full=Prolyl-tRNA synthetase;       
   35::553     2e-08  26%  571 aa  SYP_ACTP2 RecName: Full=Prolyl-tRNA synthetase;       
  137::359     3e-08  26%  432 aa  SYS_TOLAT RecName: Full=Seryl-tRNA synthetase;       
  142::296     3e-08  27%  425 aa  SYS_SYNR3 RecName: Full=Seryl-tRNA synthetase;       
  135::370     3e-08  26%  418 aa  SYS_RHOSR RecName: Full=Seryl-tRNA synthetase;       
  139::352     3e-08  27%  434 aa  SYS_RHOPT RecName: Full=Seryl-tRNA synthetase;       
  139::352     3e-08  27%  434 aa  SYS_RHOPA RecName: Full=Seryl-tRNA synthetase;       
  142::322     3e-08  27%  430 aa  SYS_PROVI RecName: Full=Seryl-tRNA synthetase;       
  138::398     3e-08  24%  432 aa  SYS_LACF3 RecName: Full=Seryl-tRNA synthetase;       
   38::163     3e-08  28%  601 aa  SYP_TROW8 RecName: Full=Prolyl-tRNA synthetase;       
   16::380     3e-08  24%  480 aa  SYP_PYRAB RecName: Full=Prolyl-tRNA synthetase;       
   35::161     3e-08  25%  571 aa  SYP_PSEU2 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     3e-08  25%  571 aa  SYP_PSE14 RecName: Full=Prolyl-tRNA synthetase;       
   33::193     3e-08  22%  581 aa  SYP_POLNA RecName: Full=Prolyl-tRNA synthetase;       
   38::159     3e-08  26%  570 aa  SYP_PELTS RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-08  29%  576 aa  SYP_PELPD RecName: Full=Prolyl-tRNA synthetase;       
   37::163     3e-08  26%  582 aa  SYP_MYCTU RecName: Full=Prolyl-tRNA synthetase;       
   37::163     3e-08  26%  582 aa  SYP_MYCBP RecName: Full=Prolyl-tRNA synthetase;       
   37::163     3e-08  26%  582 aa  SYP_MYCBO RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-08  27%  443 aa  SYP_METNO RecName: Full=Prolyl-tRNA synthetase;       
   34::161     3e-08  27%  568 aa  SYP_HALOH RecName: Full=Prolyl-tRNA synthetase;       
   38::190     3e-08  24%  576 aa  SYP_FINM2 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     3e-08  26%  439 aa  SYP_BEII9 RecName: Full=Prolyl-tRNA synthetase;       
  246::369     4e-08  32%  419 aa  SYS_MYCVP RecName: Full=Seryl-tRNA synthetase;       
  142::395     4e-08  25%  438 aa  SYS_DELAS RecName: Full=Seryl-tRNA synthetase;       
  135::377     4e-08  26%  426 aa  SYS_CLAM3 RecName: Full=Seryl-tRNA synthetase;       
  138::314     4e-08  25%  414 aa  SYS_CAMFF RecName: Full=Seryl-tRNA synthetase;       
   38::569     4e-08  27%  571 aa  SYP_SHEB9 RecName: Full=Prolyl-tRNA synthetase;       
   38::569     4e-08  27%  571 aa  SYP_SHEB8 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     4e-08  25%  571 aa  SYP_SHEB5 RecName: Full=Prolyl-tRNA synthetase;       
   38::569     4e-08  27%  571 aa  SYP_SHEB2 RecName: Full=Prolyl-tRNA synthetase;       
   38::412     4e-08  23%  427 aa  SYP_RICFE RecName: Full=Prolyl-tRNA synthetase;       
   35::161     4e-08  29%  576 aa  SYP_GEOLS RecName: Full=Prolyl-tRNA synthetase;       
   35::161     4e-08  24%  426 aa  SYP_EHRRW RecName: Full=Prolyl-tRNA synthetase;       
   35::161     4e-08  24%  426 aa  SYP_EHRRG RecName: Full=Prolyl-tRNA synthetase;       
   37::201     4e-08  23%  592 aa  SYP_CORU7 RecName: Full=Prolyl-tRNA synthetase;       
   36::166     4e-08  26%  597 aa  SYP_BIFLO RecName: Full=Prolyl-tRNA synthetase;       
   38::561     4e-08  28%  564 aa  SYP_BACA2 RecName: Full=Prolyl-tRNA synthetase;       
   38::164     4e-08  29%  575 aa  SYP1_ANADE RecName: Full=Prolyl-tRNA synthetase 1;       
   81::257     4e-08  27%  333 aa  RM39_DROME RecName: Full=39S ribosomal protein L39, mitochondrial; 
  135::370     5e-08  25%  418 aa  SYS_RHOOB RecName: Full=Seryl-tRNA synthetase;       
  142::372     5e-08  26%  425 aa  SYS_CLOPS RecName: Full=Seryl-tRNA synthetase;       
  142::372     5e-08  26%  425 aa  SYS_CLOPE RecName: Full=Seryl-tRNA synthetase;       
  142::372     5e-08  26%  425 aa  SYS_CLOP1 RecName: Full=Seryl-tRNA synthetase;       
  137::292     5e-08  30%  423 aa  SYS_CHLSY RecName: Full=Seryl-tRNA synthetase;       
  137::292     5e-08  30%  423 aa  SYS_CHLAA RecName: Full=Seryl-tRNA synthetase;       
  138::355     5e-08  24%  428 aa  SYS_BIFA0 RecName: Full=Seryl-tRNA synthetase;       
   35::190     5e-08  24%  575 aa  SYP_THELT RecName: Full=Prolyl-tRNA synthetase;       
   43::193     5e-08  27%  594 aa  SYP_SYNPW RecName: Full=Prolyl-tRNA synthetase;       
   38::562     5e-08  27%  570 aa  SYP_SHEHH RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-08  25%  571 aa  SYP_PSESM RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-08  24%  571 aa  SYP_PSEMY RecName: Full=Prolyl-tRNA synthetase;       
   38::161     5e-08  24%  439 aa  SYP_PHEZH RecName: Full=Prolyl-tRNA synthetase;       
   38::161     5e-08  27%  444 aa  SYP_METS4 RecName: Full=Prolyl-tRNA synthetase;       
   38::172     5e-08  24%  574 aa  SYP_HAHCH RecName: Full=Prolyl-tRNA synthetase;       
   38::557     5e-08  28%  574 aa  SYP_DESDG RecName: Full=Prolyl-tRNA synthetase;       
   38::161     5e-08  27%  442 aa  SYP_BRUSI RecName: Full=Prolyl-tRNA synthetase;       
   38::161     5e-08  27%  442 aa  SYP_BRUO2 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     5e-08  27%  442 aa  SYP_BRUC2 RecName: Full=Prolyl-tRNA synthetase;       
  142::352     7e-08  26%  425 aa  SYS_SYNS9 RecName: Full=Seryl-tRNA synthetase;       
  141::346     7e-08  26%  425 aa  SYS_PROM2 RecName: Full=Seryl-tRNA synthetase;       
  139::374     7e-08  24%  427 aa  SYS_DESAH RecName: Full=Seryl-tRNA synthetase;       
  128::305     7e-08  27%  413 aa  SYS_DEHE1 RecName: Full=Seryl-tRNA synthetase;       
  137::292     7e-08  30%  426 aa  SYS_CHLAD RecName: Full=Seryl-tRNA synthetase;       
  137::361     7e-08  25%  433 aa  SYS_BURM1 RecName: Full=Seryl-tRNA synthetase;       
  137::361     7e-08  25%  433 aa  SYS_BURCE RecName: Full=Seryl-tRNA synthetase;       
   35::161     7e-08  24%  564 aa  SYP_XYLFA RecName: Full=Prolyl-tRNA synthetase;       
   33::161     7e-08  23%  425 aa  SYP_WOLTR RecName: Full=Prolyl-tRNA synthetase;       
   33::190     7e-08  24%  570 aa  SYP_WOLSU RecName: Full=Prolyl-tRNA synthetase;       
   33::161     7e-08  23%  422 aa  SYP_WOLPM RecName: Full=Prolyl-tRNA synthetase;       
   38::163     7e-08  28%  613 aa  SYP_TROWT RecName: Full=Prolyl-tRNA synthetase;       
   21::271     7e-08  25%  483 aa  SYP_SULAC RecName: Full=Prolyl-tRNA synthetase;       
   47::172     7e-08  26%  567 aa  SYP_STRGG RecName: Full=Prolyl-tRNA synthetase;       
   38::161     7e-08  26%  442 aa  SYP_SINMW RecName: Full=Prolyl-tRNA synthetase;       
   38::161     7e-08  26%  442 aa  SYP_RHIME RecName: Full=Prolyl-tRNA synthetase;       
   38::414     7e-08  21%  444 aa  SYP_PELUB RecName: Full=Prolyl-tRNA synthetase;       
   38::161     7e-08  27%  583 aa  SYP_METCA RecName: Full=Prolyl-tRNA synthetase;       
   35::553     7e-08  28%  571 aa  SYP_HAEPS RecName: Full=Prolyl-tRNA synthetase;       
   35::161     7e-08  28%  570 aa  SYP_CLOAB RecName: Full=Prolyl-tRNA synthetase;       
  137::413     9e-08  24%  425 aa  SYS_ZYMMO RecName: Full=Seryl-tRNA synthetase;       
  182::367     9e-08  26%  424 aa  SYS_METST RecName: Full=Seryl-tRNA synthetase;       
  179::356     9e-08  28%  425 aa  SYS_METHJ RecName: Full=Seryl-tRNA synthetase;       
  171::382     9e-08  25%  417 aa  SYS_LEPBL RecName: Full=Seryl-tRNA synthetase;       
  171::382     9e-08  25%  417 aa  SYS_LEPBJ RecName: Full=Seryl-tRNA synthetase;       
  134::369     9e-08  24%  419 aa  SYS_CORDI RecName: Full=Seryl-tRNA synthetase;       
  141::331     9e-08  28%  442 aa  SYS_BRASO RecName: Full=Seryl-tRNA synthetase;       
  143::388     9e-08  24%  431 aa  SYS_BDEBA RecName: Full=Seryl-tRNA synthetase;       
   35::161     9e-08  24%  564 aa  SYP_XYLFT RecName: Full=Prolyl-tRNA synthetase;       
   35::161     9e-08  24%  564 aa  SYP_XYLFM RecName: Full=Prolyl-tRNA synthetase;       
   35::161     9e-08  24%  564 aa  SYP_XYLF2 RecName: Full=Prolyl-tRNA synthetase;       
   33::161     9e-08  23%  422 aa  SYP_WOLWR RecName: Full=Prolyl-tRNA synthetase;       
   35::164     9e-08  31%  600 aa  SYP_SYNR3 RecName: Full=Prolyl-tRNA synthetase;       
   40::388     9e-08  26%  487 aa  SYP_PYRCJ RecName: Full=Prolyl-tRNA synthetase;       
  109::384     9e-08  26%  478 aa  SYP_METBU RecName: Full=Prolyl-tRNA synthetase;       
   33::561     9e-08  26%  571 aa  SYP_LACS1 RecName: Full=Prolyl-tRNA synthetase;       
   38::161     9e-08  25%  452 aa  SYP_JANSC RecName: Full=Prolyl-tRNA synthetase;       
   35::553     9e-08  26%  572 aa  SYP_HAEIN RecName: Full=Prolyl-tRNA synthetase;       
   35::553     9e-08  27%  572 aa  SYP_HAEI8 RecName: Full=Prolyl-tRNA synthetase;       
   35::564     9e-08  30%  570 aa  SYP_DESPS RecName: Full=Prolyl-tRNA synthetase;       
   38::161     9e-08  27%  440 aa  SYP_AZOC5 RecName: Full=Prolyl-tRNA synthetase;       
   33::161     9e-08  26%  570 aa  SYP_AQUAE RecName: Full=Prolyl-tRNA synthetase;       
   37::163     9e-08  24%  583 aa  SYP_ACIC1 RecName: Full=Prolyl-tRNA synthetase;       
 1257::1601    9e-08  26% 1714 aa  SYEP_DROME RecName: Full=Bifunctional aminoacyl-tRNA
  140::415     1e-07  24%  425 aa  SYS_WOLPM RecName: Full=Seryl-tRNA synthetase;       
  139::360     1e-07  27%  424 aa  SYS_SOLUE RecName: Full=Seryl-tRNA synthetase;       
  246::376     1e-07  29%  419 aa  SYS_MYCTU RecName: Full=Seryl-tRNA synthetase;       
  246::376     1e-07  29%  419 aa  SYS_MYCTA RecName: Full=Seryl-tRNA synthetase;       
  246::376     1e-07  33%  417 aa  SYS_MYCS2 RecName: Full=Seryl-tRNA synthetase;       
  246::376     1e-07  29%  419 aa  SYS_MYCBT RecName: Full=Seryl-tRNA synthetase;       
  246::376     1e-07  29%  419 aa  SYS_MYCBP RecName: Full=Seryl-tRNA synthetase;       
  246::376     1e-07  29%  419 aa  SYS_MYCBO RecName: Full=Seryl-tRNA synthetase;       
  137::361     1e-07  26%  433 aa  SYS_BURS3 RecName: Full=Seryl-tRNA synthetase;       
  148::408     1e-07  27%  451 aa  SYS_BORPE RecName: Full=Seryl-tRNA synthetase;       
  148::408     1e-07  27%  451 aa  SYS_BORPA RecName: Full=Seryl-tRNA synthetase;       
  148::408     1e-07  27%  451 aa  SYS_BORBR RecName: Full=Seryl-tRNA synthetase;       
  138::315     1e-07  26%  426 aa  SYS_AKKM8 RecName: Full=Seryl-tRNA synthetase;       
   48::194     1e-07  27%  593 aa  SYP_SYNS9 RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-07  22%  567 aa  SYP_STAES RecName: Full=Prolyl-tRNA synthetase;       
   38::190     1e-07  22%  567 aa  SYP_STAEQ RecName: Full=Prolyl-tRNA synthetase;       
   37::191     1e-07  25%  585 aa  SYP_PROAC RecName: Full=Prolyl-tRNA synthetase;       
   38::161     1e-07  26%  440 aa  SYP_METSB RecName: Full=Prolyl-tRNA synthetase;       
   33::546     1e-07  28%  568 aa  SYP_MACCJ RecName: Full=Prolyl-tRNA synthetase;       
   43::561     1e-07  30%  575 aa  SYP_HELMI RecName: Full=Prolyl-tRNA synthetase;       
   35::176     1e-07  29%  598 aa  SYP_CYAP8 RecName: Full=Prolyl-tRNA synthetase;       
   21::161     1e-07  27%  570 aa  SYP_CLOBB RecName: Full=Prolyl-tRNA synthetase;       
   21::161     1e-07  27%  570 aa  SYP_CLOBA RecName: Full=Prolyl-tRNA synthetase;       
   32::385     1e-07  24%  481 aa  SYP_CHLPD RecName: Full=Prolyl-tRNA synthetase;       
  246::411     2e-07  27%  421 aa  SYS_NITMS RecName: Full=Seryl-tRNA synthetase;       
  162::371     2e-07  27%  425 aa  SYS_METMJ RecName: Full=Seryl-tRNA synthetase;       
  171::382     2e-07  25%  417 aa  SYS_LEPIN RecName: Full=Seryl-tRNA synthetase;       
  171::382     2e-07  25%  417 aa  SYS_LEPIC RecName: Full=Seryl-tRNA synthetase;       
  138::361     2e-07  24%  423 aa  SYS2_ENTFA RecName: Full=Seryl-tRNA synthetase 2;       
   44::226     2e-07  23%  567 aa  SYP_STRCO RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-07  24%  571 aa  SYP_PSEPW RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-07  24%  571 aa  SYP_PSEPK RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-07  24%  571 aa  SYP_PSEPG RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-07  24%  571 aa  SYP_PSEPF RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-07  24%  571 aa  SYP_PSEP1 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     2e-07  24%  571 aa  SYP_PSEE4 RecName: Full=Prolyl-tRNA synthetase;       
   35::164     2e-07  28%  599 aa  SYP_PROMM RecName: Full=Prolyl-tRNA synthetase;       
   35::164     2e-07  28%  599 aa  SYP_PROM3 RecName: Full=Prolyl-tRNA synthetase;       
   38::561     2e-07  27%  568 aa  SYP_LYSSC RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-07  23%  572 aa  SYP_ENTFA RecName: Full=Prolyl-tRNA synthetase;       
   38::568     2e-07  28%  569 aa  SYP_DEHE1 RecName: Full=Prolyl-tRNA synthetase;       
   32::385     2e-07  26%  481 aa  SYP_CHLL2 RecName: Full=Prolyl-tRNA synthetase;       
   35::190     2e-07  25%  567 aa  SYP_CAMFF RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-07  27%  572 aa  SYP_BUCAI RecName: Full=Prolyl-tRNA synthetase;       
  137::355     2e-07  22%  427 aa  SYS_PSYA2 RecName: Full=Seryl-tRNA synthetase;       
  141::380     2e-07  23%  425 aa  SYS_PROMA RecName: Full=Seryl-tRNA synthetase;       
  136::348     2e-07  28%  422 aa  SYS_PELPD RecName: Full=Seryl-tRNA synthetase;       
  145::380     2e-07  24%  426 aa  SYS_NOSP7 RecName: Full=Seryl-tRNA synthetase;       
  246::376     2e-07  28%  422 aa  SYS_CORGL RecName: Full=Seryl-tRNA synthetase;       
  139::360     2e-07  24%  436 aa  SYS_BEII9 RecName: Full=Seryl-tRNA synthetase;       
  137::368     2e-07  24%  423 aa  SYS_ACIAD RecName: Full=Seryl-tRNA synthetase;       
   35::570     2e-07  25%  571 aa  SYP_VIBVY RecName: Full=Prolyl-tRNA synthetase;       
   35::570     2e-07  25%  571 aa  SYP_VIBVU RecName: Full=Prolyl-tRNA synthetase;       
   35::570     2e-07  25%  571 aa  SYP_VIBHB RecName: Full=Prolyl-tRNA synthetase;       
   35::571     2e-07  24%  571 aa  SYP_VIBCM RecName: Full=Prolyl-tRNA synthetase;       
   35::571     2e-07  24%  571 aa  SYP_VIBCH RecName: Full=Prolyl-tRNA synthetase;       
   35::571     2e-07  24%  571 aa  SYP_VIBC3 RecName: Full=Prolyl-tRNA synthetase;       
   16::202     2e-07  26%  480 aa  SYP_PYRHO RecName: Full=Prolyl-tRNA synthetase;       
   36::165     2e-07  27%  600 aa  SYP_PROMP RecName: Full=Prolyl-tRNA synthetase;       
   33::190     2e-07  24%  574 aa  SYP_NAUPA RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-07  25%  584 aa  SYP_MYCSS RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-07  25%  584 aa  SYP_MYCSK RecName: Full=Prolyl-tRNA synthetase;       
  424::560     2e-07  33%  570 aa  SYP_GEOSL RecName: Full=Prolyl-tRNA synthetase;       
   38::560     2e-07  30%  570 aa  SYP_GEOMG RecName: Full=Prolyl-tRNA synthetase;       
   38::568     2e-07  28%  569 aa  SYP_DEHSC RecName: Full=Prolyl-tRNA synthetase;       
   40::192     2e-07  22%  585 aa  SYP_CORDI RecName: Full=Prolyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAES RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAEQ RecName: Full=Glycyl-tRNA synthetase;       
  163::461     2e-07  30%  463 aa  SYG_STACT RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAW RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAT RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAS RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAR RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAN RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAM RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAE RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAC RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAAB RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAA9 RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAA8 RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAA3 RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAA2 RecName: Full=Glycyl-tRNA synthetase;       
  163::452     2e-07  30%  463 aa  SYG_STAA1 RecName: Full=Glycyl-tRNA synthetase;       
  142::382     3e-07  23%  425 aa  SYS_THENN RecName: Full=Seryl-tRNA synthetase;       
  148::401     3e-07  24%  452 aa  SYS_RHOFD RecName: Full=Seryl-tRNA synthetase;       
  137::321     3e-07  23%  439 aa  SYS_OLICO RecName: Full=Seryl-tRNA synthetase;       
  246::376     3e-07  29%  419 aa  SYS_MYCMM RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-07  26%  430 aa  SYS_ENT38 RecName: Full=Seryl-tRNA synthetase;       
  137::361     3e-07  25%  433 aa  SYS_BURVG RecName: Full=Seryl-tRNA synthetase;       
   35::190     3e-07  23%  571 aa  SYP_VIBSL RecName: Full=Prolyl-tRNA synthetase;       
   35::179     3e-07  28%  569 aa  SYP_UNCTG RecName: Full=Prolyl-tRNA synthetase;       
   38::190     3e-07  24%  572 aa  SYP_THICR RecName: Full=Prolyl-tRNA synthetase;       
   34::364     3e-07  23%  480 aa  SYP_SOLUE RecName: Full=Prolyl-tRNA synthetase;       
   35::571     3e-07  26%  571 aa  SYP_PHOPR RecName: Full=Prolyl-tRNA synthetase;       
   33::190     3e-07  23%  588 aa  SYP_HELHP RecName: Full=Prolyl-tRNA synthetase;       
   38::568     3e-07  28%  569 aa  SYP_DEHSB RecName: Full=Prolyl-tRNA synthetase;       
   32::374     3e-07  25%  481 aa  SYP_CHLPB RecName: Full=Prolyl-tRNA synthetase;       
   36::166     3e-07  25%  599 aa  SYP_BIFA0 RecName: Full=Prolyl-tRNA synthetase;       
   47::172     3e-07  25%  564 aa  SYP1_STRAW RecName: Full=Prolyl-tRNA synthetase 1;       
  138::426     4e-07  27%  426 aa  SYS_XYLFA RecName: Full=Seryl-tRNA synthetase;       
  147::400     4e-07  25%  443 aa  SYS_VARPS RecName: Full=Seryl-tRNA synthetase;       
  137::350     4e-07  22%  415 aa  SYS_HELPJ RecName: Full=Seryl-tRNA synthetase;       
   35::161     4e-07  24%  571 aa  SYP_PSEF5 RecName: Full=Prolyl-tRNA synthetase;       
   40::192     4e-07  23%  606 aa  SYP_KOCRD RecName: Full=Prolyl-tRNA synthetase;       
   38::159     4e-07  27%  566 aa  SYP_DESAP RecName: Full=Prolyl-tRNA synthetase;       
   38::161     4e-07  26%  442 aa  SYP_BRUSU RecName: Full=Prolyl-tRNA synthetase;       
   38::548     4e-07  26%  564 aa  SYP_BACSU RecName: Full=Prolyl-tRNA synthetase;       
  163::452     4e-07  29%  463 aa  SYG_STAS1 RecName: Full=Glycyl-tRNA synthetase;       
  163::462     4e-07  29%  463 aa  SYG_STAHJ RecName: Full=Glycyl-tRNA synthetase;       
  141::361     5e-07  24%  425 aa  SYS_PROMS RecName: Full=Seryl-tRNA synthetase;       
  137::380     5e-07  25%  422 aa  SYS_PELTS RecName: Full=Seryl-tRNA synthetase;       
  137::350     5e-07  22%  415 aa  SYS_HELPY RecName: Full=Seryl-tRNA synthetase;       
  137::373     5e-07  24%  421 aa  SYS_FUSNN RecName: Full=Seryl-tRNA synthetase;       
  138::361     5e-07  24%  423 aa  SYS1_ENTFA RecName: Full=Seryl-tRNA synthetase 1;       
   38::161     5e-07  26%  440 aa  SYP_XANP2 RecName: Full=Prolyl-tRNA synthetase;       
   38::314     5e-07  22%  571 aa  SYP_THEYD RecName: Full=Prolyl-tRNA synthetase;       
   35::164     5e-07  27%  600 aa  SYP_SYNP6 RecName: Full=Prolyl-tRNA synthetase;       
   35::164     5e-07  27%  600 aa  SYP_SYNE7 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-07  23%  620 aa  SYP_STRSY RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-07  23%  620 aa  SYP_STRS2 RecName: Full=Prolyl-tRNA synthetase;       
   16::202     5e-07  26%  479 aa  SYP_PYRFU RecName: Full=Prolyl-tRNA synthetase;       
   38::567     5e-07  26%  574 aa  SYP_NITOC RecName: Full=Prolyl-tRNA synthetase;       
    9::211     5e-07  24%  537 aa  SYP_NANEQ RecName: Full=Prolyl-tRNA synthetase;       
   37::163     5e-07  24%  582 aa  SYP_MYCPA RecName: Full=Prolyl-tRNA synthetase;       
   37::163     5e-07  24%  582 aa  SYP_MYCA1 RecName: Full=Prolyl-tRNA synthetase;       
  104::376     5e-07  29%  491 aa  SYP_HALLT RecName: Full=Prolyl-tRNA synthetase;       
   42::387     5e-07  23%  497 aa  SYP_DEIGD RecName: Full=Prolyl-tRNA synthetase;       
   37::163     5e-07  24%  588 aa  SYP_CORGL RecName: Full=Prolyl-tRNA synthetase;       
   37::163     5e-07  24%  588 aa  SYP_CORGB RecName: Full=Prolyl-tRNA synthetase;       
   37::250     5e-07  24%  589 aa  SYP_CORA7 RecName: Full=Prolyl-tRNA synthetase;       
   21::161     5e-07  26%  570 aa  SYP_CLOB8 RecName: Full=Prolyl-tRNA synthetase;       
   40::163     5e-07  23%  603 aa  SYP_ARTS2 RecName: Full=Prolyl-tRNA synthetase;       
   35::161     5e-07  23%  571 aa  SYP_ALISL RecName: Full=Prolyl-tRNA synthetase;       
  138::396     6e-07  27%  449 aa  SYS_XANOM RecName: Full=Seryl-tRNA synthetase;       
  137::350     6e-07  22%  415 aa  SYS_HELPS RecName: Full=Seryl-tRNA synthetase;       
  138::384     6e-07  26%  426 aa  SYS_CLONN RecName: Full=Seryl-tRNA synthetase;       
   35::566     6e-07  26%  571 aa  SYP_VIBPA RecName: Full=Prolyl-tRNA synthetase;       
   29::361     6e-07  24%  466 aa  SYP_PICTO RecName: Full=Prolyl-tRNA synthetase;       
   37::163     6e-07  24%  585 aa  SYP_MYCVP RecName: Full=Prolyl-tRNA synthetase;       
   35::364     6e-07  22%  474 aa  SYP_MYCCT RecName: Full=Prolyl-tRNA synthetase;       
  241::383     6e-07  26%  479 aa  SYP_EUBE2 RecName: Full=Prolyl-tRNA synthetase;       
   43::173     6e-07  23%  573 aa  SYP_ELUMP RecName: Full=Prolyl-tRNA synthetase;       
   37::192     6e-07  23%  588 aa  SYP_COREF RecName: Full=Prolyl-tRNA synthetase;       
  216::371     8e-07  27%  688 aa  YHI0_YEAST RecName: Full=Putative prolyl-tRNA synthetase YHR020W;  
  142::395     8e-07  24%  438 aa  SYS_VEREI RecName: Full=Seryl-tRNA synthetase;       
  165::385     8e-07  24%  414 aa  SYS_SULNB RecName: Full=Seryl-tRNA synthetase;       
  206::416     8e-07  26%  444 aa  SYS_PICTO RecName: Full=Seryl-tRNA synthetase;       
  246::376     8e-07  31%  417 aa  SYS_MYCSS RecName: Full=Seryl-tRNA synthetase;       
  246::376     8e-07  31%  417 aa  SYS_MYCSK RecName: Full=Seryl-tRNA synthetase;       
  246::376     8e-07  31%  417 aa  SYS_MYCSJ RecName: Full=Seryl-tRNA synthetase;       
  171::350     8e-07  24%  415 aa  SYS_HELPG RecName: Full=Seryl-tRNA synthetase;       
  144::351     8e-07  25%  460 aa  SYS_HALWD RecName: Full=Seryl-tRNA synthetase;       
  136::414     8e-07  25%  427 aa  SYS_EHRRW RecName: Full=Seryl-tRNA synthetase;       
  138::380     8e-07  24%  423 aa  SYS_CORK4 RecName: Full=Seryl-tRNA synthetase;       
  137::361     8e-07  24%  433 aa  SYS_BURCM RecName: Full=Seryl-tRNA synthetase;       
  213::379     8e-07  24%  460 aa  SYS_AERPE RecName: Full=Seryl-tRNA synthetase;       
  191::370     8e-07  26%  451 aa  SYSC_DICDI RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
   35::161     8e-07  24%  571 aa  SYP_VIBFM RecName: Full=Prolyl-tRNA synthetase;       
   35::161     8e-07  24%  571 aa  SYP_VIBF1 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     8e-07  29%  580 aa  SYP_MYCA9 RecName: Full=Prolyl-tRNA synthetase;       
   38::558     8e-07  27%  568 aa  SYP_ALHEH RecName: Full=Prolyl-tRNA synthetase;       
  171::415     1e-06  23%  418 aa  SYS_UREPA RecName: Full=Seryl-tRNA synthetase;       
  171::415     1e-06  23%  418 aa  SYS_UREP2 RecName: Full=Seryl-tRNA synthetase;       
  246::376     1e-06  28%  419 aa  SYS_MYCUA RecName: Full=Seryl-tRNA synthetase;       
  145::354     1e-06  24%  427 aa  SYS_MICAN RecName: Full=Seryl-tRNA synthetase;       
  156::350     1e-06  24%  428 aa  SYS_CHLTR RecName: Full=Seryl-tRNA synthetase;       
  156::350     1e-06  24%  428 aa  SYS_CHLTA RecName: Full=Seryl-tRNA synthetase;       
  135::376     1e-06  30%  432 aa  SYS_BUCBP RecName: Full=Seryl-tRNA synthetase;       
  137::368     1e-06  24%  423 aa  SYS_ACIBC RecName: Full=Seryl-tRNA synthetase;       
  137::368     1e-06  24%  423 aa  SYS_ACIB5 RecName: Full=Seryl-tRNA synthetase;       
  137::368     1e-06  24%  423 aa  SYS_ACIB3 RecName: Full=Seryl-tRNA synthetase;       
  202::444     1e-06  24%  462 aa  SYSC_CANAL RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
  138::360     1e-06  27%  425 aa  SYS1_STRAW RecName: Full=Seryl-tRNA synthetase 1;       
   39::374     1e-06  24%  483 aa  SYP_NATTJ RecName: Full=Prolyl-tRNA synthetase;       
   36::161     1e-06  25%  442 aa  SYP_MESSB RecName: Full=Prolyl-tRNA synthetase;       
   35::175     1e-06  24%  568 aa  SYP_LISIN RecName: Full=Prolyl-tRNA synthetase;       
  428::564     1e-06  32%  575 aa  SYP_DESHY RecName: Full=Prolyl-tRNA synthetase;       
  428::564     1e-06  32%  575 aa  SYP_DESHD RecName: Full=Prolyl-tRNA synthetase;       
   38::159     1e-06  25%  569 aa  SYP_CARHZ RecName: Full=Prolyl-tRNA synthetase;       
  141::362     1e-06  23%  424 aa  SYS_THEYD RecName: Full=Seryl-tRNA synthetase;       
  146::355     1e-06  25%  427 aa  SYS_SYNP2 RecName: Full=Seryl-tRNA synthetase;       
  136::373     1e-06  26%  426 aa  SYS_STRMK RecName: Full=Seryl-tRNA synthetase;       
  136::373     1e-06  26%  426 aa  SYS_STRM5 RecName: Full=Seryl-tRNA synthetase;       
  137::377     1e-06  24%  428 aa  SYS_SHEHH RecName: Full=Seryl-tRNA synthetase;       
  136::292     1e-06  31%  424 aa  SYS_RUBXD RecName: Full=Seryl-tRNA synthetase;       
  247::377     1e-06  30%  420 aa  SYS_NOCFA RecName: Full=Seryl-tRNA synthetase;       
  138::314     1e-06  23%  414 aa  SYS_NITSB RecName: Full=Seryl-tRNA synthetase;       
  246::350     1e-06  31%  425 aa  SYS_MYCPA RecName: Full=Seryl-tRNA synthetase;       
  139::350     1e-06  23%  421 aa  SYS_MYCMO RecName: Full=Seryl-tRNA synthetase;       
  246::350     1e-06  31%  425 aa  SYS_MYCA1 RecName: Full=Seryl-tRNA synthetase;       
  139::381     1e-06  22%  421 aa  SYS_HYDS0 RecName: Full=Seryl-tRNA synthetase;       
  156::350     1e-06  24%  428 aa  SYS_CHLTB RecName: Full=Seryl-tRNA synthetase;       
  156::350     1e-06  24%  428 aa  SYS_CHLT2 RecName: Full=Seryl-tRNA synthetase;       
  186::355     1e-06  24%  418 aa  SYS_CENSY RecName: Full=Seryl-tRNA synthetase;       
   43::161     1e-06  24%  435 aa  SYP_RHORT RecName: Full=Prolyl-tRNA synthetase;       
   44::196     1e-06  25%  499 aa  SYP_DEIRA RecName: Full=Prolyl-tRNA synthetase;       
   74::192     1e-06  26%  581 aa  SYP1_RHOSR RecName: Full=Prolyl-tRNA synthetase 1;       
  163::451     1e-06  30%  462 aa  SYG_MACCJ RecName: Full=Glycyl-tRNA synthetase;       
  142::382     2e-06  23%  425 aa  SYS_THEP1 RecName: Full=Seryl-tRNA synthetase;       
  141::352     2e-06  25%  426 aa  SYS_PROMT RecName: Full=Seryl-tRNA synthetase;       
  139::370     2e-06  27%  426 aa  SYS_NOVAD RecName: Full=Seryl-tRNA synthetase;       
  140::351     2e-06  26%  416 aa  SYS_NAUPA RecName: Full=Seryl-tRNA synthetase;       
  140::359     2e-06  26%  437 aa  SYS_METNO RecName: Full=Seryl-tRNA synthetase;       
  138::357     2e-06  23%  423 aa  SYS_METBF RecName: Full=Seryl-tRNA synthetase;       
  138::356     2e-06  23%  436 aa  SYS_LACJO RecName: Full=Seryl-tRNA synthetase;       
  137::355     2e-06  25%  430 aa  SYS_IDILO RecName: Full=Seryl-tRNA synthetase;       
  137::362     2e-06  25%  431 aa  SYS_HERAR RecName: Full=Seryl-tRNA synthetase;       
   50::163     2e-06  30%  584 aa  SYP_SALAI RecName: Full=Prolyl-tRNA synthetase;       
   74::192     2e-06  25%  581 aa  SYP_RHOOB RecName: Full=Prolyl-tRNA synthetase;       
   35::172     2e-06  21%  571 aa  SYP_PEDPA RecName: Full=Prolyl-tRNA synthetase;       
   99::371     2e-06  29%  482 aa  SYP_NATPD RecName: Full=Prolyl-tRNA synthetase;       
  130::438     2e-06  27%  445 aa  SYG_BORHD RecName: Full=Glycyl-tRNA synthetase;       
  138::426     2e-06  27%  426 aa  SYS_XYLFM RecName: Full=Seryl-tRNA synthetase;       
  162::356     2e-06  23%  425 aa  SYS_UNCMA RecName: Full=Seryl-tRNA synthetase;       
  209::376     2e-06  27%  457 aa  SYS_SULSO RecName: Full=Seryl-tRNA synthetase;       
  212::379     2e-06  24%  459 aa  SYS_STAMF RecName: Full=Seryl-tRNA synthetase;       
  137::344     2e-06  28%  424 aa  SYS_ROSS1 RecName: Full=Seryl-tRNA synthetase;       
  141::346     2e-06  25%  425 aa  SYS_PROM0 RecName: Full=Seryl-tRNA synthetase;       
  137::350     2e-06  22%  415 aa  SYS_HELP2 RecName: Full=Seryl-tRNA synthetase;       
  137::386     2e-06  26%  430 aa  SYS_ENTS8 RecName: Full=Seryl-tRNA synthetase;       
  128::311     2e-06  30%  413 aa  SYS_DEHSC RecName: Full=Seryl-tRNA synthetase;       
  128::311     2e-06  30%  413 aa  SYS_DEHSB RecName: Full=Seryl-tRNA synthetase;       
  142::363     2e-06  25%  425 aa  SYS_CLOBB RecName: Full=Seryl-tRNA synthetase;       
  142::363     2e-06  25%  425 aa  SYS_CLOBA RecName: Full=Seryl-tRNA synthetase;       
  137::381     2e-06  22%  426 aa  SYS_CHLFF RecName: Full=Seryl-tRNA synthetase;       
  137::361     2e-06  24%  433 aa  SYS_BURA4 RecName: Full=Seryl-tRNA synthetase;       
  141::333     2e-06  28%  443 aa  SYS_BRAJA RecName: Full=Seryl-tRNA synthetase;       
   45::163     2e-06  24%  582 aa  SYP_THEFY RecName: Full=Prolyl-tRNA synthetase;       
   38::161     2e-06  25%  572 aa  SYP_DICNV RecName: Full=Prolyl-tRNA synthetase;       
   40::163     2e-06  23%  603 aa  SYP_ARTAT RecName: Full=Prolyl-tRNA synthetase;       
  158::449     2e-06  25%  460 aa  SYG_GEOKA RecName: Full=Glycyl-tRNA synthetase;       
  142::295     3e-06  27%  425 aa  SYS_SYNPX RecName: Full=Seryl-tRNA synthetase;       
  135::355     3e-06  23%  428 aa  SYS_PSYWF RecName: Full=Seryl-tRNA synthetase;       
  138::349     3e-06  27%  426 aa  SYS_PHEZH RecName: Full=Seryl-tRNA synthetase;       
  244::374     3e-06  27%  417 aa  SYS_MYCLE RecName: Full=Seryl-tRNA synthetase;       
  244::374     3e-06  27%  417 aa  SYS_MYCLB RecName: Full=Seryl-tRNA synthetase;       
  191::350     3e-06  27%  425 aa  SYS_MARMM RecName: Full=Seryl-tRNA synthetase;       
  138::356     3e-06  22%  436 aa  SYS_LACGA RecName: Full=Seryl-tRNA synthetase;       
  137::344     3e-06  28%  422 aa  SYS_HERA2 RecName: Full=Seryl-tRNA synthetase;       
  172::363     3e-06  24%  426 aa  SYS_CLOB6 RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-06  26%  430 aa  SYS_CITK8 RecName: Full=Seryl-tRNA synthetase;       
  159::416     3e-06  23%  426 aa  SYS_CHLCV RecName: Full=Seryl-tRNA synthetase;       
  136::352     3e-06  26%  426 aa  SYS_ARTCA RecName: Full=Seryl-tRNA synthetase;       
  138::390     3e-06  26%  435 aa  SYS_ACTPJ RecName: Full=Seryl-tRNA synthetase;       
  138::390     3e-06  26%  435 aa  SYS_ACTP7 RecName: Full=Seryl-tRNA synthetase;       
  138::390     3e-06  26%  435 aa  SYS_ACTP2 RecName: Full=Seryl-tRNA synthetase;       
   35::161     3e-06  23%  569 aa  SYP_NITSB RecName: Full=Prolyl-tRNA synthetase;       
   38::561     3e-06  28%  576 aa  SYP_LEPBL RecName: Full=Prolyl-tRNA synthetase;       
   38::561     3e-06  28%  576 aa  SYP_LEPBJ RecName: Full=Prolyl-tRNA synthetase;       
   38::190     3e-06  21%  575 aa  SYP_LACC3 RecName: Full=Prolyl-tRNA synthetase;       
   32::176     3e-06  22%  579 aa  SYP_CHLMU RecName: Full=Prolyl-tRNA synthetase;       
   36::190     3e-06  26%  568 aa  SYP_ARCB4 RecName: Full=Prolyl-tRNA synthetase;       
  138::426     4e-06  27%  426 aa  SYS_XYLFT RecName: Full=Seryl-tRNA synthetase;       
  138::426     4e-06  27%  426 aa  SYS_XYLF2 RecName: Full=Seryl-tRNA synthetase;       
  138::349     4e-06  26%  425 aa  SYS_WOLTR RecName: Full=Seryl-tRNA synthetase;       
  144::359     4e-06  23%  425 aa  SYS_TRIEI RecName: Full=Seryl-tRNA synthetase;       
  172::348     4e-06  25%  421 aa  SYS_THET8 RecName: Full=Seryl-tRNA synthetase;       
  162::382     4e-06  24%  425 aa  SYS_THEMA RecName: Full=Seryl-tRNA synthetase;       
  142::352     4e-06  25%  425 aa  SYS_SYNSC RecName: Full=Seryl-tRNA synthetase;       
  141::299     4e-06  26%  425 aa  SYS_SYNS3 RecName: Full=Seryl-tRNA synthetase;       
  137::350     4e-06  25%  427 aa  SYS_SINMW RecName: Full=Seryl-tRNA synthetase;       
  136::414     4e-06  24%  425 aa  SYS_EHRRG RecName: Full=Seryl-tRNA synthetase;       
  145::381     4e-06  28%  448 aa  SYS_BORPD RecName: Full=Seryl-tRNA synthetase;       
  170::382     4e-06  26%  425 aa  SYS_BACLD RecName: Full=Seryl-tRNA synthetase;       
  145::380     4e-06  27%  426 aa  SYS_ANAVT RecName: Full=Seryl-tRNA synthetase;       
  145::380     4e-06  27%  426 aa  SYS_ANASP RecName: Full=Seryl-tRNA synthetase;       
   21::271     4e-06  24%  483 aa  SYP_SULTO RecName: Full=Prolyl-tRNA synthetase;       
   72::175     4e-06  30%  568 aa  SYP_LISMO RecName: Full=Prolyl-tRNA synthetase;       
   72::175     4e-06  30%  568 aa  SYP_LISMH RecName: Full=Prolyl-tRNA synthetase;       
   72::175     4e-06  30%  568 aa  SYP_LISMF RecName: Full=Prolyl-tRNA synthetase;       
   72::175     4e-06  30%  568 aa  SYP_LISMC RecName: Full=Prolyl-tRNA synthetase;       
  171::380     5e-06  23%  418 aa  SYS_UREU1 RecName: Full=Seryl-tRNA synthetase;       
  172::348     5e-06  25%  421 aa  SYS_THET2 RecName: Full=Seryl-tRNA synthetase;       
  208::379     5e-06  23%  460 aa  SYS_HYPBU RecName: Full=Seryl-tRNA synthetase;       
  171::350     5e-06  23%  415 aa  SYS_HELAH RecName: Full=Seryl-tRNA synthetase;       
  184::292     5e-06  28%  425 aa  SYS_DEIRA RecName: Full=Seryl-tRNA synthetase;       
  139::361     5e-06  22%  425 aa  SYS_AQUAE RecName: Full=Seryl-tRNA synthetase;       
  202::446     5e-06  23%  462 aa  SYSC_YEAST RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
   71::374     5e-06  26%  474 aa  SYP_UNCMA RecName: Full=Prolyl-tRNA synthetase;       
   37::364     5e-06  23%  474 aa  SYP_PHYAS RecName: Full=Prolyl-tRNA synthetase;       
   35::164     5e-06  27%  613 aa  SYP_CYAP4 RecName: Full=Prolyl-tRNA synthetase;       
   43::536     5e-06  26%  571 aa  SYP1_CLOD6 RecName: Full=Prolyl-tRNA synthetase 1;       
  142::352     7e-06  24%  426 aa  SYS_THEAB RecName: Full=Seryl-tRNA synthetase;       
  141::352     7e-06  24%  426 aa  SYS_PROM1 RecName: Full=Seryl-tRNA synthetase;       
  137::370     7e-06  25%  427 aa  SYS_NITOC RecName: Full=Seryl-tRNA synthetase;       
  138::353     7e-06  28%  427 aa  SYS_MICLC RecName: Full=Seryl-tRNA synthetase;       
  138::357     7e-06  24%  422 aa  SYS_METMA RecName: Full=Seryl-tRNA synthetase;       
  137::386     7e-06  25%  430 aa  SYS_KLEP7 RecName: Full=Seryl-tRNA synthetase;       
  172::359     7e-06  25%  426 aa  SYS_CLOTE RecName: Full=Seryl-tRNA synthetase;       
  137::382     7e-06  22%  427 aa  SYS_BUCAT RecName: Full=Seryl-tRNA synthetase;       
  137::382     7e-06  22%  427 aa  SYS_BUCAI RecName: Full=Seryl-tRNA synthetase;       
  137::382     7e-06  22%  427 aa  SYS_BUCA5 RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACHK RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACCZ RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACCR RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACCQ RecName: Full=Seryl-tRNA synthetase;       
  138::369     7e-06  26%  424 aa  SYS_BACCN RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACC7 RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACC4 RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACC3 RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACC2 RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACC0 RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACAN RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACAH RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACAC RecName: Full=Seryl-tRNA synthetase;       
  138::382     7e-06  26%  424 aa  SYS_BACAA RecName: Full=Seryl-tRNA synthetase;       
   32::185     7e-06  24%  481 aa  SYP_PELLD RecName: Full=Prolyl-tRNA synthetase;       
   32::185     7e-06  23%  481 aa  SYP_CHLTE RecName: Full=Prolyl-tRNA synthetase;       
  160::447     7e-06  28%  458 aa  SYG_BACHK RecName: Full=Glycyl-tRNA synthetase;       
  160::447     7e-06  28%  458 aa  SYG_BACCZ RecName: Full=Glycyl-tRNA synthetase;       
  160::447     7e-06  28%  458 aa  SYG_BACC1 RecName: Full=Glycyl-tRNA synthetase;       
  160::447     7e-06  28%  458 aa  SYG_BACAN RecName: Full=Glycyl-tRNA synthetase;       
  555::687     7e-06  28%  886 aa  SYA_PROM2 RecName: Full=Alanyl-tRNA synthetase;       
  247::376     9e-06  33%  425 aa  SYS_RICTY RecName: Full=Seryl-tRNA synthetase;       
  247::376     9e-06  33%  425 aa  SYS_RICPR RecName: Full=Seryl-tRNA synthetase;       
  137::350     9e-06  25%  427 aa  SYS_RHIME RecName: Full=Seryl-tRNA synthetase;       
  142::360     9e-06  23%  424 aa  SYS_PROMP RecName: Full=Seryl-tRNA synthetase;       
  139::350     9e-06  25%  428 aa  SYS_METEP RecName: Full=Seryl-tRNA synthetase;       
  139::350     9e-06  25%  428 aa  SYS_METC4 RecName: Full=Seryl-tRNA synthetase;       
  137::386     9e-06  25%  430 aa  SYS_KLEP3 RecName: Full=Seryl-tRNA synthetase;       
  137::350     9e-06  21%  415 aa  SYS_HELPH RecName: Full=Seryl-tRNA synthetase;       
  143::350     9e-06  24%  460 aa  SYS_HALSA RecName: Full=Seryl-tRNA synthetase;       
  143::350     9e-06  24%  460 aa  SYS_HALS3 RecName: Full=Seryl-tRNA synthetase;       
  137::386     9e-06  26%  430 aa  SYS_EDWI9 RecName: Full=Seryl-tRNA synthetase;       
  185::292     9e-06  28%  437 aa  SYS_DEIGD RecName: Full=Seryl-tRNA synthetase;       
  172::363     9e-06  24%  426 aa  SYS_CLOBM RecName: Full=Seryl-tRNA synthetase;       
  172::363     9e-06  24%  426 aa  SYS_CLOBH RecName: Full=Seryl-tRNA synthetase;       
  172::363     9e-06  24%  426 aa  SYS_CLOB1 RecName: Full=Seryl-tRNA synthetase;       
  143::421     9e-06  28%  474 aa  SYS_CAUSK RecName: Full=Seryl-tRNA synthetase;       
  139::352     9e-06  24%  426 aa  SYS_BRAHW RecName: Full=Seryl-tRNA synthetase;       
  138::382     9e-06  26%  424 aa  SYS_BACC1 RecName: Full=Seryl-tRNA synthetase;       
  192::364     9e-06  23%  450 aa  SYSC_SCHPO RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
   33::159     9e-06  24%  617 aa  SYP_TREPS RecName: Full=Prolyl-tRNA synthetase;       
   33::159     9e-06  24%  617 aa  SYP_TREPA RecName: Full=Prolyl-tRNA synthetase;       
   47::168     9e-06  30%  609 aa  SYP_SYNJA RecName: Full=Prolyl-tRNA synthetase;       
   32::174     9e-06  28%  480 aa  SYP_ROSS1 RecName: Full=Prolyl-tRNA synthetase;       
   35::179     9e-06  23%  474 aa  SYP_MYCGA RecName: Full=Prolyl-tRNA synthetase;       
   37::274     9e-06  28%  480 aa  SYP_METAC RecName: Full=Prolyl-tRNA synthetase;       
    8::389     9e-06  23%  492 aa  SYP_GRAFK RecName: Full=Prolyl-tRNA synthetase;       
   32::192     9e-06  20%  577 aa  SYP_CHLAB RecName: Full=Prolyl-tRNA synthetase;       
   33::164     9e-06  29%  476 aa  SYP_CENSY RecName: Full=Prolyl-tRNA synthetase;       
   86::264     9e-06  23%  336 aa  RM39_MOUSE RecName: Full=39S ribosomal protein L39, mitochondrial; 
  140::415     1e-05  23%  426 aa  SYS_WOLPP RecName: Full=Seryl-tRNA synthetase;       
  162::382     1e-05  22%  425 aa  SYS_THESQ RecName: Full=Seryl-tRNA synthetase;       
  138::360     1e-05  25%  425 aa  SYS_STRGG RecName: Full=Seryl-tRNA synthetase;       
  137::377     1e-05  23%  428 aa  SYS_SHEPA RecName: Full=Seryl-tRNA synthetase;       
  137::344     1e-05  27%  424 aa  SYS_ROSCS RecName: Full=Seryl-tRNA synthetase;       
  142::344     1e-05  25%  425 aa  SYS_PROM3 RecName: Full=Seryl-tRNA synthetase;       
  138::366     1e-05  24%  423 aa  SYS_PHYMT RecName: Full=Seryl-tRNA synthetase;       
  179::330     1e-05  28%  455 aa  SYS_METS5 RecName: Full=Seryl-tRNA synthetase;       
  136::355     1e-05  24%  422 aa  SYS_GEOSL RecName: Full=Seryl-tRNA synthetase;       
  190::343     1e-05  28%  418 aa  SYS_COPPD RecName: Full=Seryl-tRNA synthetase;       
  153::356     1e-05  24%  428 aa  SYS_CELJU RecName: Full=Seryl-tRNA synthetase;       
  138::380     1e-05  23%  426 aa  SYS_ALKMQ RecName: Full=Seryl-tRNA synthetase;       
   34::200     1e-05  27%  510 aa  SYP_SPHEL RecName: Full=Prolyl-tRNA synthetase;       
   35::161     1e-05  30%  595 aa  SYP_SALTO RecName: Full=Prolyl-tRNA synthetase;       
   73::165     1e-05  29%  600 aa  SYP_PROM9 RecName: Full=Prolyl-tRNA synthetase;       
   72::190     1e-05  27%  565 aa  SYP_LACJO RecName: Full=Prolyl-tRNA synthetase;       
   38::161     1e-05  23%  570 aa  SYP_ALKMQ RecName: Full=Prolyl-tRNA synthetase;       
  136::377     1e-05  25%  424 aa  SYS_RHOCS RecName: Full=Seryl-tRNA synthetase;       
  137::413     1e-05  24%  427 aa  SYS_RHISN RecName: Full=Seryl-tRNA synthetase;       
  139::350     1e-05  25%  428 aa  SYS_METPB RecName: Full=Seryl-tRNA synthetase;       
  170::361     1e-05  26%  426 aa  SYS_LYSSC RecName: Full=Seryl-tRNA synthetase;       
  202::379     1e-05  26%  458 aa  SYS_IGNH4 RecName: Full=Seryl-tRNA synthetase;       
  146::366     1e-05  26%  429 aa  SYS_GLOVI RecName: Full=Seryl-tRNA synthetase;       
  172::350     1e-05  26%  425 aa  SYS_BARQU RecName: Full=Seryl-tRNA synthetase;       
   34::204     1e-05  25%  481 aa  SYP_SULIY RecName: Full=Prolyl-tRNA synthetase;       
   34::204     1e-05  25%  481 aa  SYP_SULIN RecName: Full=Prolyl-tRNA synthetase;       
   34::204     1e-05  25%  481 aa  SYP_SULIM RecName: Full=Prolyl-tRNA synthetase;       
   34::204     1e-05  25%  481 aa  SYP_SULIL RecName: Full=Prolyl-tRNA synthetase;       
   34::204     1e-05  25%  481 aa  SYP_SULIA RecName: Full=Prolyl-tRNA synthetase;       
   32::174     1e-05  28%  480 aa  SYP_ROSCS RecName: Full=Prolyl-tRNA synthetase;       
   32::185     1e-05  24%  481 aa  SYP_PROVI RecName: Full=Prolyl-tRNA synthetase;       
   35::190     1e-05  21%  572 aa  SYP_LEUMM RecName: Full=Prolyl-tRNA synthetase;       
  236::590     2e-05  25%  716 aa  YHY6_SCHPO RecName: Full=Putative prolyl-tRNA synthetase C19C7.06; 
  142::344     2e-05  25%  425 aa  SYS_PROMM RecName: Full=Seryl-tRNA synthetase;       
  138::357     2e-05  25%  435 aa  SYS_METS4 RecName: Full=Seryl-tRNA synthetase;       
  137::358     2e-05  26%  424 aa  SYS_DESRM RecName: Full=Seryl-tRNA synthetase;       
  172::363     2e-05  23%  426 aa  SYS_CLOBL RecName: Full=Seryl-tRNA synthetase;       
  172::363     2e-05  23%  426 aa  SYS_CLOBK RecName: Full=Seryl-tRNA synthetase;       
  137::386     2e-05  26%  430 aa  SYS_BAUCH RecName: Full=Seryl-tRNA synthetase;       
   47::168     2e-05  29%  609 aa  SYP_SYNJB RecName: Full=Prolyl-tRNA synthetase;       
   34::204     2e-05  25%  481 aa  SYP_SULSO RecName: Full=Prolyl-tRNA synthetase;       
   36::159     2e-05  24%  605 aa  SYP_BIFAA RecName: Full=Prolyl-tRNA synthetase;       
  555::687     2e-05  24%  886 aa  SYA_PROMS RecName: Full=Alanyl-tRNA synthetase;       
  136::362     3e-05  22%  428 aa  SYS_WOLSU RecName: Full=Seryl-tRNA synthetase;       
  209::376     3e-05  27%  457 aa  SYS_SULIY RecName: Full=Seryl-tRNA synthetase;       
  209::376     3e-05  27%  457 aa  SYS_SULIN RecName: Full=Seryl-tRNA synthetase;       
  209::376     3e-05  27%  457 aa  SYS_SULIM RecName: Full=Seryl-tRNA synthetase;       
  209::376     3e-05  27%  457 aa  SYS_SULIL RecName: Full=Seryl-tRNA synthetase;       
  209::376     3e-05  27%  457 aa  SYS_SULIK RecName: Full=Seryl-tRNA synthetase;       
  209::376     3e-05  27%  457 aa  SYS_SULIA RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALAR RecName: Full=Seryl-tRNA synthetase;       
  140::371     3e-05  25%  461 aa  SYS_METSB RecName: Full=Seryl-tRNA synthetase;       
  137::378     3e-05  24%  422 aa  SYS_HALOH RecName: Full=Seryl-tRNA synthetase;       
  143::350     3e-05  24%  456 aa  SYS_HALLT RecName: Full=Seryl-tRNA synthetase;       
  139::359     3e-05  24%  421 aa  SYS_DESHY RecName: Full=Seryl-tRNA synthetase;       
  139::359     3e-05  24%  421 aa  SYS_DESHD RecName: Full=Seryl-tRNA synthetase;       
  142::362     3e-05  25%  424 aa  SYS1_CLOAB RecName: Full=Seryl-tRNA synthetase 1;       
   48::164     3e-05  25%  601 aa  SYP_SYNP2 RecName: Full=Prolyl-tRNA synthetase;       
   34::204     3e-05  25%  481 aa  SYP_SULIK RecName: Full=Prolyl-tRNA synthetase;       
   35::190     3e-05  23%  565 aa  SYP_LACGA RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-05  22%  565 aa  SYP_FRATW RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-05  22%  565 aa  SYP_FRATT RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-05  22%  565 aa  SYP_FRATO RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-05  22%  565 aa  SYP_FRATN RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-05  22%  565 aa  SYP_FRATM RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-05  22%  565 aa  SYP_FRATH RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-05  22%  565 aa  SYP_FRATF RecName: Full=Prolyl-tRNA synthetase;       
   33::161     3e-05  22%  565 aa  SYP_FRAT1 RecName: Full=Prolyl-tRNA synthetase;       
   32::176     3e-05  22%  581 aa  SYP_CHLTR RecName: Full=Prolyl-tRNA synthetase;       
   32::176     3e-05  22%  581 aa  SYP_CHLTB RecName: Full=Prolyl-tRNA synthetase;       
   32::176     3e-05  22%  581 aa  SYP_CHLTA RecName: Full=Prolyl-tRNA synthetase;       
   32::176     3e-05  22%  581 aa  SYP_CHLT2 RecName: Full=Prolyl-tRNA synthetase;       
   72::161     3e-05  31%  570 aa  SYP_ACIF5 RecName: Full=Prolyl-tRNA synthetase;       
   72::161     3e-05  31%  570 aa  SYP_ACIF2 RecName: Full=Prolyl-tRNA synthetase;       
  307::415     3e-05  28%  424 aa  SYH_BACLD RecName: Full=Histidyl-tRNA synthetase;       
  162::450     3e-05  28%  461 aa  SYG_LYSSC RecName: Full=Glycyl-tRNA synthetase;       
  555::687     3e-05  24%  886 aa  SYA_PROM9 RecName: Full=Alanyl-tRNA synthetase;       
  555::687     3e-05  24%  886 aa  SYA_PROM0 RecName: Full=Alanyl-tRNA synthetase;       
  246::377     3e-05  28%  422 aa  SYS_THEFY RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALTY RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALTI RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALSV RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALPK RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALPC RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALPB RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALPA RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALNS RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALHS RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALG2 RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALEP RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALDC RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALCH RecName: Full=Seryl-tRNA synthetase;       
  137::386     3e-05  26%  430 aa  SYS_SALA4 RecName: Full=Seryl-tRNA synthetase;       
  137::348     3e-05  23%  429 aa  SYS_ORITI RecName: Full=Seryl-tRNA synthetase;       
  169::360     3e-05  26%  423 aa  SYS_CLOTH RecName: Full=Seryl-tRNA synthetase;       
  159::381     3e-05  21%  424 aa  SYS_CHLAB RecName: Full=Seryl-tRNA synthetase;       
  187::380     3e-05  22%  427 aa  SYS2_STRAW RecName: Full=Seryl-tRNA synthetase 2;       
  419::570     3e-05  30%  572 aa  SYP_BACLD RecName: Full=Prolyl-tRNA synthetase;       
   36::161     3e-05  29%  585 aa  SYP_ACIC5 RecName: Full=Prolyl-tRNA synthetase;       
  164::455     3e-05  26%  466 aa  SYG_GEOTN RecName: Full=Glycyl-tRNA synthetase;       
  170::349     4e-05  21%  415 aa  SYS_SULDN RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_SHISS RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_SHIFL RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_SHIF8 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_SHIDS RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_SHIBS RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_SHIB3 RecName: Full=Seryl-tRNA synthetase;       
  137::375     4e-05  25%  428 aa  SYS_SHESH RecName: Full=Seryl-tRNA synthetase;       
  297::395     4e-05  33%  476 aa  SYS_RHOP2 RecName: Full=Seryl-tRNA synthetase;       
  139::380     4e-05  25%  427 aa  SYS_RHIEC RecName: Full=Seryl-tRNA synthetase;       
  138::357     4e-05  27%  421 aa  SYS_METAC RecName: Full=Seryl-tRNA synthetase;       
  137::379     4e-05  24%  426 aa  SYS_LEGPH RecName: Full=Seryl-tRNA synthetase;       
  137::379     4e-05  24%  426 aa  SYS_LEGPC RecName: Full=Seryl-tRNA synthetase;       
  137::379     4e-05  24%  426 aa  SYS_LEGPA RecName: Full=Seryl-tRNA synthetase;       
  138::366     4e-05  25%  434 aa  SYS_HAEPS RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOUT RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOSM RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOSE RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOLU RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOLI RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOLC RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOL6 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOL5 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOK1 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOHS RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECODH RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECOBW RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO8A RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO81 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO7I RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO5E RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO57 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO55 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO45 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO27 RecName: Full=Seryl-tRNA synthetase;       
  137::386     4e-05  24%  430 aa  SYS_ECO24 RecName: Full=Seryl-tRNA synthetase;       
  146::318     4e-05  23%  427 aa  SYS_CYAP8 RecName: Full=Seryl-tRNA synthetase;       
  218::397     4e-05  22%  514 aa  SYSC_PONAB RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
  218::397     4e-05  22%  514 aa  SYSC_HUMAN RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
  199::397     4e-05  25%  487 aa  SYSC_CAEEL RecName: Full=Probable seryl-tRNA synthetase,
   35::161     4e-05  28%  581 aa  SYP_SYNFM RecName: Full=Prolyl-tRNA synthetase;       
   37::185     4e-05  24%  481 aa  SYP_PELPB RecName: Full=Prolyl-tRNA synthetase;       
   83::175     4e-05  33%  568 aa  SYP_LISW6 RecName: Full=Prolyl-tRNA synthetase;       
  164::440     4e-05  29%  462 aa  SYG_CLOAB RecName: Full=Glycyl-tRNA synthetase;       
  144::353     6e-05  24%  435 aa  SYS_SYNJB RecName: Full=Seryl-tRNA synthetase;       
  139::368     6e-05  24%  425 aa  SYS_SPHWW RecName: Full=Seryl-tRNA synthetase;       
  137::375     6e-05  22%  428 aa  SYS_SHELP RecName: Full=Seryl-tRNA synthetase;       
  301::399     6e-05  34%  481 aa  SYS_RHOPB RecName: Full=Seryl-tRNA synthetase;       
  139::350     6e-05  24%  427 aa  SYS_RHILW RecName: Full=Seryl-tRNA synthetase;       
  141::346     6e-05  25%  425 aa  SYS_PROM5 RecName: Full=Seryl-tRNA synthetase;       
  250::354     6e-05  30%  434 aa  SYS_KOCRD RecName: Full=Seryl-tRNA synthetase;       
  142::357     6e-05  20%  426 aa  SYS_FERNB RecName: Full=Seryl-tRNA synthetase;       
  137::386     6e-05  24%  430 aa  SYS_ESCF3 RecName: Full=Seryl-tRNA synthetase;       
  139::350     6e-05  24%  425 aa  SYS_BART1 RecName: Full=Seryl-tRNA synthetase;       
  170::380     6e-05  25%  424 aa  SYS_BACP2 RecName: Full=Seryl-tRNA synthetase;       
   33::190     6e-05  22%  576 aa  SYP_THIDA RecName: Full=Prolyl-tRNA synthetase;       
   40::431     6e-05  24%  436 aa  SYP_NEOSM RecName: Full=Prolyl-tRNA synthetase;       
   32::176     6e-05  23%  577 aa  SYP_CHLFF RecName: Full=Prolyl-tRNA synthetase;       
   32::192     6e-05  21%  577 aa  SYP_CHLCV RecName: Full=Prolyl-tRNA synthetase;       
  360::425     6e-05  29%  425 aa  SYH_HELMI RecName: Full=Histidyl-tRNA synthetase;       
  126::435     6e-05  29%  451 aa  SYG_MESFL RecName: Full=Glycyl-tRNA synthetase;       
   89::267     6e-05  22%  338 aa  RM39_HUMAN RecName: Full=39S ribosomal protein L39, mitochondrial; 
  137::386     7e-05  25%  430 aa  SYS_SODGM RecName: Full=Seryl-tRNA synthetase;       
  296::394     7e-05  33%  476 aa  SYS_RHOP5 RecName: Full=Seryl-tRNA synthetase;       
  289::387     7e-05  33%  470 aa  SYS_NITHX RecName: Full=Seryl-tRNA synthetase;       
  137::379     7e-05  24%  426 aa  SYS_LEGPL RecName: Full=Seryl-tRNA synthetase;       
  249::378     7e-05  29%  425 aa  SYS_DICT6 RecName: Full=Seryl-tRNA synthetase;       
  146::381     7e-05  24%  430 aa  SYS_CYAP7 RecName: Full=Seryl-tRNA synthetase;       
  137::379     7e-05  24%  420 aa  SYS_CALS8 RecName: Full=Seryl-tRNA synthetase;       
   32::210     7e-05  23%  481 aa  SYP_PROA2 RecName: Full=Prolyl-tRNA synthetase;       
  239::373     7e-05  37%  484 aa  SYP_HALMA RecName: Full=Prolyl-tRNA synthetase;       
   33::161     7e-05  23%  565 aa  SYP_FRAP2 RecName: Full=Prolyl-tRNA synthetase;       
  288::407     7e-05  29%  425 aa  SYPM_SCHPO RecName: Full=Probable prolyl-tRNA synthetase,
  164::456     7e-05  31%  467 aa  SYG_CLOPE RecName: Full=Glycyl-tRNA synthetase;       
  250::350     1e-04  30%  430 aa  SYS_SILST RecName: Full=Seryl-tRNA synthetase;       
  161::350     1e-04  26%  430 aa  SYS_SILPO RecName: Full=Seryl-tRNA synthetase;       
  136::353     1e-04  24%  426 aa  SYS_RICB8 RecName: Full=Seryl-tRNA synthetase;       
  170::372     1e-04  25%  427 aa  SYS_METCA RecName: Full=Seryl-tRNA synthetase;       
  249::378     1e-04  29%  425 aa  SYS_DICTD RecName: Full=Seryl-tRNA synthetase;       
  170::382     1e-04  25%  425 aa  SYS_BACA2 RecName: Full=Seryl-tRNA synthetase;       
  144::375     1e-04  26%  433 aa  SYS_ACICJ RecName: Full=Seryl-tRNA synthetase;       
  218::397     1e-04  22%  514 aa  SYSC_MACFA RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
  218::397     1e-04  22%  514 aa  SYSC_BOVIN RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
   74::163     1e-04  27%  581 aa  SYP_RHOE4 RecName: Full=Prolyl-tRNA synthetase;       
   68::369     1e-04  22%  470 aa  SYP_MYCPE RecName: Full=Prolyl-tRNA synthetase;       
  237::368     1e-04  23%  479 aa  SYP_MYCH7 RecName: Full=Prolyl-tRNA synthetase;       
   37::196     1e-04  25%  480 aa  SYP_METBF RecName: Full=Prolyl-tRNA synthetase;       
   32::185     1e-04  23%  481 aa  SYP_CHLP8 RecName: Full=Prolyl-tRNA synthetase;       
  257::408     1e-04  30%  454 aa  PYLS_METMA RecName: Full=Pyrrolysyl-tRNA synthetase;       
  136::353     1e-04  24%  426 aa  SYS_RICBR RecName: Full=Seryl-tRNA synthetase;       
  139::350     1e-04  23%  427 aa  SYS_RHIE6 RecName: Full=Seryl-tRNA synthetase;       
  137::374     1e-04  26%  426 aa  SYS_PSEU5 RecName: Full=Seryl-tRNA synthetase;       
  139::359     1e-04  22%  422 aa  SYS_HELMI RecName: Full=Seryl-tRNA synthetase;       
  248::348     1e-04  34%  420 aa  SYS_GLUOX RecName: Full=Seryl-tRNA synthetase;       
  137::348     1e-04  22%  427 aa  SYS_DESDG RecName: Full=Seryl-tRNA synthetase;       
  172::363     1e-04  23%  426 aa  SYS_CLOBJ RecName: Full=Seryl-tRNA synthetase;       
   37::274     1e-04  27%  480 aa  SYP_METMA RecName: Full=Prolyl-tRNA synthetase;       
  240::387     1e-04  25%  501 aa  SYP_HALSA RecName: Full=Prolyl-tRNA synthetase;       
  240::387     1e-04  25%  501 aa  SYP_HALS3 RecName: Full=Prolyl-tRNA synthetase;       
  319::375     1e-04  45%  739 aa  SYG_PONAB RecName: Full=Glycyl-tRNA synthetase;       
  319::375     1e-04  45%  739 aa  SYG_HUMAN RecName: Full=Glycyl-tRNA synthetase;       
  150::296     2e-04  26%  428 aa  SYS_SALRD RecName: Full=Seryl-tRNA synthetase;       
  116::376     2e-04  23%  425 aa  SYS_RICAH RecName: Full=Seryl-tRNA synthetase;       
  138::378     2e-04  22%  422 aa  SYS_MAGSA RecName: Full=Seryl-tRNA synthetase;       
  116::360     2e-04  25%  429 aa  SYS_HAES2 RecName: Full=Seryl-tRNA synthetase;       
  205::392     2e-04  22%  453 aa  SYS_ARCFU RecName: Full=Seryl-tRNA synthetase;       
   61::204     2e-04  30%  477 aa  SYP_METMJ RecName: Full=Prolyl-tRNA synthetase;       
  243::388     2e-04  26%  512 aa  SYP_HALWD RecName: Full=Prolyl-tRNA synthetase;       
   30::159     2e-04  31%  497 aa  SYP_BACTN RecName: Full=Prolyl-tRNA synthetase;       
   30::159     2e-04  31%  497 aa  SYP_BACFR RecName: Full=Prolyl-tRNA synthetase;       
   30::159     2e-04  31%  497 aa  SYP_BACFN RecName: Full=Prolyl-tRNA synthetase;       
 1113::1200    2e-04  30% 1512 aa  SYEP_HUMAN RecName: Full=Bifunctional aminoacyl-tRNA
  133::383     2e-04  22%  424 aa  SYS_THELT RecName: Full=Seryl-tRNA synthetase;       
  116::360     2e-04  25%  429 aa  SYS_HAES1 RecName: Full=Seryl-tRNA synthetase;       
  137::386     2e-04  24%  430 aa  SYS_ERWT9 RecName: Full=Seryl-tRNA synthetase;       
  172::350     2e-04  27%  425 aa  SYS_BARHE RecName: Full=Seryl-tRNA synthetase;       
  138::312     2e-04  22%  424 aa  SYS_AYWBP RecName: Full=Seryl-tRNA synthetase;       
  218::397     2e-04  22%  512 aa  SYSC_MOUSE RecName: Full=Seryl-tRNA synthetase, cytoplasmic;       
   35::165     2e-04  27%  476 aa  SYP_RUBXD RecName: Full=Prolyl-tRNA synthetase;       
   72::161     2e-04  32%  587 aa  SYP_ACIBL RecName: Full=Prolyl-tRNA synthetase;       
  580::733     2e-04  26%  923 aa  SYA_METBF RecName: Full=Alanyl-tRNA synthetase;       
  189::379     3e-04  23%  427 aa  SYS_SYNWW RecName: Full=Seryl-tRNA synthetase;       
  137::393     3e-04  23%  438 aa  SYS_RALSO RecName: Full=Seryl-tRNA synthetase;       
  137::348     3e-04  23%  429 aa  SYS_ORITB RecName: Full=Seryl-tRNA synthetase;       
  141::361     3e-04  24%  438 aa  SYS_HELAN RecName: Full=Seryl-tRNA synthetase;       
  172::363     3e-04  24%  426 aa  SYS_CLOK5 RecName: Full=Seryl-tRNA synthetase;       
  172::363     3e-04  24%  426 aa  SYS_CLOK1 RecName: Full=Seryl-tRNA synthetase;       
  137::385     3e-04  23%  427 aa  SYS_CHRVO RecName: Full=Seryl-tRNA synthetase;       
  142::380     3e-04  24%  451 aa  SYS_ARATH RecName: Full=Seryl-tRNA synthetase;       
   35::165     3e-04  22%  474 aa  SYP_MYCMS RecName: Full=Prolyl-tRNA synthetase;       
  385::436     3e-04  33%  439 aa  SYH_CLOTE RecName: Full=Histidyl-tRNA synthetase;       
  309::365     3e-04  43%  729 aa  SYG_MOUSE RecName: Full=Glycyl-tRNA synthetase;       
  551::677     3e-04  30%  867 aa  SYA_METCA RecName: Full=Alanyl-tRNA synthetase;       
  193::371     4e-04  27%  448 aa  SYS_PYRIL RecName: Full=Seryl-tRNA synthetase;       
  116::385     4e-04  25%  430 aa  SYS_MANSM RecName: Full=Seryl-tRNA synthetase;       
  304::405     4e-04  29%  482 aa  SYS_CAUCR RecName: Full=Seryl-tRNA synthetase;       
  304::405     4e-04  29%  482 aa  SYS_CAUCN RecName: Full=Seryl-tRNA synthetase;       
  170::361     4e-04  25%  425 aa  SYS_BACHD RecName: Full=Seryl-tRNA synthetase;       
  140::376     4e-04  21%  435 aa  SYS_ANAD2 RecName: Full=Seryl-tRNA synthetase;       
   35::159     4e-04  31%  496 aa  SYP_BACV8 RecName: Full=Prolyl-tRNA synthetase;       
  374::423     4e-04  34%  425 aa  SYH1_BACHK RecName: Full=Histidyl-tRNA synthetase 1;       
  374::423     4e-04  32%  425 aa  SYH1_BACCZ RecName: Full=Histidyl-tRNA synthetase 1;       
  374::423     4e-04  34%  425 aa  SYH1_BACAN RecName: Full=Histidyl-tRNA synthetase 1;       
  287::391     5e-04  30%  468 aa  SYS_XANP2 RecName: Full=Seryl-tRNA synthetase;       
  137::377     5e-04  24%  428 aa  SYS_SHESW RecName: Full=Seryl-tRNA synthetase;       
  137::377     5e-04  24%  428 aa  SYS_SHEPC RecName: Full=Seryl-tRNA synthetase;       
  137::428     5e-04  24%  428 aa  SYS_SHEFN RecName: Full=Seryl-tRNA synthetase;       
  137::377     5e-04  24%  428 aa  SYS_SHEB9 RecName: Full=Seryl-tRNA synthetase;       
  137::377     5e-04  24%  428 aa  SYS_SHEB8 RecName: Full=Seryl-tRNA synthetase;       
  137::377     5e-04  24%  428 aa  SYS_SHEB5 RecName: Full=Seryl-tRNA synthetase;       
  164::351     5e-04  23%  460 aa  SYS_HALMA RecName: Full=Seryl-tRNA synthetase;       
  172::350     5e-04  23%  425 aa  SYS_BARBK RecName: Full=Seryl-tRNA synthetase;       
  237::370     5e-04  26%  477 aa  SYP_THET2 RecName: Full=Prolyl-tRNA synthetase;       
  438::567     5e-04  28%  569 aa  SYP_LACPL RecName: Full=Prolyl-tRNA synthetase;       
   55::239     5e-04  22%  520 aa  SYP_ENCCU RecName: Full=Prolyl-tRNA synthetase;       
  241::391     5e-04  26%  477 aa  SYP_CLOPH RecName: Full=Prolyl-tRNA synthetase;       
  241::388     5e-04  25%  478 aa  SYP_CLOCE RecName: Full=Prolyl-tRNA synthetase;       
   32::296     5e-04  25%  488 aa  SYP_BORAP RecName: Full=Prolyl-tRNA synthetase;       
  217::273     5e-04  43%  637 aa  SYG_RAT RecName: Full=Glycyl-tRNA synthetase;       
  608::733     5e-04  23%  925 aa  SYA_METAC RecName: Full=Alanyl-tRNA synthetase;       
  525::677     5e-04  23%  865 aa  SYA_FRATN RecName: Full=Alanyl-tRNA synthetase;       
  778::900     5e-04  27% 1098 aa  SYA_ACIBL RecName: Full=Alanyl-tRNA synthetase;       
  247::376     6e-04  26%  425 aa  SYS_RICRS RecName: Full=Seryl-tRNA synthetase;       
  247::376     6e-04  26%  425 aa  SYS_RICRO RecName: Full=Seryl-tRNA synthetase;       
  247::376     6e-04  26%  425 aa  SYS_RICPU RecName: Full=Seryl-tRNA synthetase;       
  247::376     6e-04  26%  425 aa  SYS_RICM5 RecName: Full=Seryl-tRNA synthetase;       
  247::376     6e-04  26%  425 aa  SYS_RICCN RecName: Full=Seryl-tRNA synthetase;       
  243::352     6e-04  29%  425 aa  SYS_RICCK RecName: Full=Seryl-tRNA synthetase;       
  137::349     6e-04  24%  425 aa  SYS_DESVM RecName: Full=Seryl-tRNA synthetase;       
  207::378     6e-04  26%  459 aa  SYS_DESK1 RecName: Full=Seryl-tRNA synthetase;       
  135::376     6e-04  25%  436 aa  SYS_BLOFL RecName: Full=Seryl-tRNA synthetase;       
   36::183     6e-04  23%  476 aa  SYP2_BACCZ RecName: Full=Prolyl-tRNA synthetase 2;       
   36::183     6e-04  23%  476 aa  SYP2_BACCR RecName: Full=Prolyl-tRNA synthetase 2;       
   36::183     6e-04  23%  476 aa  SYP2_BACC1 RecName: Full=Prolyl-tRNA synthetase 2;       
  315::451     6e-04  31%  462 aa  SYG_EUBE2 RecName: Full=Glycyl-tRNA synthetase;       
 1045::1200    6e-04  25% 1512 aa  SYEP_MOUSE RecName: Full=Bifunctional aminoacyl-tRNA
  545::691     6e-04  24%  886 aa  SYA_PROMT RecName: Full=Alanyl-tRNA synthetase;       
  142::283     8e-04  26%  425 aa  SYS_SYNPW RecName: Full=Seryl-tRNA synthetase;       
  205::376     8e-04  22%  453 aa  SYS_SULTO RecName: Full=Seryl-tRNA synthetase;       
  137::377     8e-04  24%  428 aa  SYS_SHEB2 RecName: Full=Seryl-tRNA synthetase;       
  247::376     8e-04  26%  425 aa  SYS_RICAE RecName: Full=Seryl-tRNA synthetase;       
  165::357     8e-04  20%  422 aa  SYS_HELHP RecName: Full=Seryl-tRNA synthetase;       
  137::348     8e-04  28%  424 aa  SYS_GLUDA RecName: Full=Seryl-tRNA synthetase;       
  143::315     8e-04  23%  424 aa  SYS_CYAP4 RecName: Full=Seryl-tRNA synthetase;       
   32::159     8e-04  24%  488 aa  SYP_BORBZ RecName: Full=Prolyl-tRNA synthetase;       
   32::159     8e-04  24%  488 aa  SYP_BORBU RecName: Full=Prolyl-tRNA synthetase;       
   36::183     8e-04  23%  476 aa  SYP2_BACHK RecName: Full=Prolyl-tRNA synthetase 2;       
   36::183     8e-04  23%  508 aa  SYP2_BACAN RecName: Full=Prolyl-tRNA synthetase 2;       
  374::419     8e-04  35%  436 aa  SYH1_BACC1 RecName: Full=Histidyl-tRNA synthetase 1;       
  309::448     8e-04  27%  451 aa  SYG_MYCS5 RecName: Full=Glycyl-tRNA synthetase;       
  536::688     8e-04  23%  876 aa  SYA_STAHJ RecName: Full=Alanyl-tRNA synthetase;       
    1::643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
SYT_CLOPE       MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
SYT_CLOP1       MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
SYT_CLOPS       MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
SYT_CLOBB       MIKVTLKDGSVKEFEAGLSVYEIAKSISEGLARNACCGVVNGKVCDLREEVKEDVSLSICTFDSQEGKDA
SYT_CLOBA       MIKVSLKDGSVKEFEAGLSVYEIAKSISEGLARNACCGVVNGKVCDLRNKINEDVSLSICTFDSQEGKDA
SYT_CLOTH       MIKITLKDGSVREYNEGITIKEVAESISAGLARVALAGEVNGEVKDLSYPLENDCTLNLLTFDDEGGRDA
SYT_CLOD6       MIKVALKDGSIKEFENAISVMDVAKSISEGLARNVVAASVNGEVVGLDHIIDTDCDLNLFKFEDKEGKEV
SYT_ANOFW       VVKITFPDGAVKEFPKGVTTEDIAASISPGLKKKAIAGKLNERMIDLRTPIEEDGAISIITQDMPEALDI
SYT_GEOKA       VIRITFPDGAEKEFPKGTTTEDIAASISPGLKKKAIAGKLNGRFVDLRTPLHEDGELVIITQDMPEALDI
SYT_DESRM       MIKITLKDGSVREYAVGTTVLEVAKSISQGLAREALAGKVNGKIVDLEYPLKEDAALELLTFNDEEGKTV
SYT1_BACSU      MVKITFPDGAVKEFAKGTTTEDIAASISPGLKKKSLAGKLNGKEIDLRTPINEDGTVEIITEGSEEGLQI
SYT_BACA2       MINITFPDGAVKEFPKGTTTEDIAASISPGLKKKSLAGKLNGQEIDLRTPIQEDGAVEIITEGTEEGLNI
SYT_ENTFA       -IHITFPDGAVKPFDSGITTFDVAKSISNSLAKKALAGKFNGVLIDLDRPIVEDGSLEIVTPDHEDALGI
SYT_OCEIH       -LSIIFPDGSEKQFPVGTTGEEIAASISPGLKKQALAIKLDGELVDLRRELSSGGSIEIITYKNNEGLEV
SYT_CLONN       MIKITLKDGKVLEVEKGLTVSEIAARISTSLRKKALGAKINGEKAELMDVINEDSTLEILTFEDQEGKDT
SYT_CLOBL       MIKITLKDGKVMEIEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGKWA
SYT_CLOBJ       MIKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGKWT
SYT_CLOBH       MIKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGKWA
SYT_CLOB1       MIKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGKWA
SYT_CLOBM       MIKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGKWA
SYT_CLOB6       MIKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGKWA
SYT_GEOSW       MIRITFPDGAVKEFPKGTTTEQIAASISPGLKKKAIAGKLNDRFIDLRTPIQEDGSISIITQDMPEALDI
SYT_STACT       -INITFPDGNSTEFDKGITTEEIAQSISPGLRKKAVAGKFNDKMVDLTRPLEEDGSIEIVTPGSDEALEV
SYT_THETN       ---ITLRDGTKREFEKGITVYEIAKSISDKLAREAVGGKFNGKIVELNTKIEEDGELEILTFEDEEGKKI
SYT_STRA5       MIKITFPDGAIREFESGITTFEIAQSISNSLAKKALAGKFNGQLIDTTRAIEEDGSIEIVTPDHEDALGV
SYT_STRA3       MIKITFPDGAIREFESGITTFEIAQSISNSLAKKALAGKFNGQLIDTTRAIEEDGSIEIVTPDHEDALGV
SYT_STRA1       MIKITFPDGAIREFESGITTFEIAQSISNSLAKKALAGKFNGQLIDTTRAIEEDGSIEIVTPDHEDALGV
SYT_CLOBK       MIKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETMDLMTELHKDSSLEILTFEDEMGKWA
SYT_CLOK5       MIKISLKNGKEIEVEKGLKVIDIAAKLSISLSKKALGAVVDGKVVELNYKINKDCKVEILTFEDEEGKKI
SYT_CLOK1       MIKISLKNGKEIEVEKGLKVIDIAAKLSISLSKKALGAVVDGKVVELNYKINKDCKVEILTFEDEEGKKI
SYT_LISMO       -MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDALGI
SYT_STRPJ       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_STRGC       MIKITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_LISIN       -MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDALGI
SYT_STRZJ       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_LISMH       -MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDALGI
SYT_LISMF       -MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDALGI
SYT_LISMC       -MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDALGI
SYT_STRP4       MINITFPDGAIREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_STRZT       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_STRPI       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_STRP7       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_CLOTE       MINITLXXXXXXXXXXXXXXSDIVMKISPALYKKAVGAKINGEIAELMTEIKEDSELEILTFDDEEGRKT
SYT_STRR6       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_STRPN       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_STRP2       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_LISW6       -MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDALGI
SYT_STAAB       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPVSEEALEV
SYT_STAS1       -IKIKFPDGNTKEFDKGTTTEDIAQSISPGLRKKAVAGKLNGQLIDLTRPIESDGDIEIVTPGSDEALEV
SYT_STRZP       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDALPI
SYT_STAAW       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_STAAT       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_STAAS       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_STAAR       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_STAAE       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_STAAC       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_STAA9       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_STAA3       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_STAA2       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_EXISA       MIQLTFPDGAVKEFEAGVTAEDVAGSISPGLRKKAIAAKLDGELIDYRRPIEHDGKIELVMPDSEDGLDL
SYT_STAA8       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
SYT_SYNWW       MISIRLKDGSQREYPEGISLLQVAEDISPKLAKNAMAAVFNGKISDLNSQVKEDGCLELLDFEDERAREV
SYT_STAAN       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIGIVTPGSEEALEV
SYT_STAAM       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIGIVTPGSEEALEV
SYT_STAA1       -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIGIVTPGSEEALEV
SYT_STRSV       MIKITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGAIEIVTPDHEDALDI
SYT_STRPZ       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRP3       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRS7       MITITFPDGAVREFESGVTTFEIADSIXXXXXXXXXXGKFNGQLIDTTRAIEEDGSIEIITADHEDAFEV
SYT_FINM2       MFEVKLKDGSAKEFDGEISLLDVCKSISEGLARDCVGAVVDGKIMGLMETIDSDCEVQFVKFDDDEGKQV
SYT_STRPF       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRPD       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRPM       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRPG       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRPC       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRPB       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRP8       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STRP1       MIKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_CLOAB       MIKVTLKDGKVMEFENTTTPGDVAKAISPGLYKKAISAKINGKRAELMTNIDKDCNLEILTFDDEDGKWT
SYT_PROVI       -LTVTLPDGTTKPLPAGSTGMDIALEIGRRLAREAVAIKIDGKAVDLSAPLTADCTAEIITFDSPEGKEI
SYT_STRSY       MIKITFPDGAVREYQAGVTTFEIAESIXXXXXXXXXXGKFNGKLIDTTRAIDEDGTLEIVMPDHDDALDI
SYT_STRS2       MIKITFPDGAVREYQAGVTTFEIAESIXXXXXXXXXXGKFNGKLIDTTRAIDEDGTLEIVMPDHDDALDI
SYT_STRP6       MIKITFPDGAVREFESGVTTFDIAEXXXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAYEV
SYT_STAEQ       -INIQFPDGNTKEFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTRPLEQDGAIEIITPGSEEALEV
SYT_CHLT3       LIKLTLPNGDVRAYPKGVTGSEVAASIGKRLAEDALAIKFGGKLKDLAFPIQQDGAIEIVTFDSDEGKAL
SYT_STRMU       MIKITFPDGAVREFEIGTTTSEIAESIXXXXXXXXXXGKFNGQLIDTTRAITQDGSIEIVTPDHEDALDI
SYT_STAES       -INIQFPDGNTKEFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTRPLEQDGAIEIITPGSEEALEV
SYT_STRU0       MINITFPDGAVREFESGITTFDIAQSISNSLAKKALAGKFNGQLIDTNRPIDTDGSIEIVTPDHEDAFGV
SYT_CHLPB       -VTVTFPDGRNMSIPSGSSGYDIAQSIGHSLAREALAIRINGELADLGTAVTDDATVEIITFDGATGKHI
SYT_BACHD       MINITFPDGAVKEFPKGTTTAEIAGSISPGLKKKALAGMLDGTLLDLNTPIEQDGTITIVTPESDEALEV
SYT_PROA2       -VTVTLPDGESRSFPFGTTGYDIARSIGKKLAQDALAVVINGRAQDLDSPVSEDASIEIVTFDHPLGKEI
SYT_LACLS       MIKITFPDGNIKEFESGVTTFEIAKSISPSLAKKTLAGKVNGKLIDATRAINEDSDFEIVTPDHEDALGI
SYT_CARHZ       MISLKFPNNEVREFPENITALEVAKTLSPRLAKEALCASINGKLIDLSQKISESGEFRLYTFEDDEGKDV
SYT_LACLM       MIKITFPDGNIKEFESGVTTFEIAKSISPSLAKKTLAGKVNGKLIDATRAINEDSNFEIVTPDHEDALGI
SYT_CHLL2       -IAITLPDGTVKNVPSGSTGFDIALSIGKRLADDALAVTINGKPTDLHAPVLCDANIEIVTFDSQLGRDI
SYT_LACLA       MIKITFPDGNVKEFEAGVTTFEIAKSISPSLAKKTLAGKVNGKLIDATRAINEDSNFEIVTPDHEDALGI
SYT_CHLCH       -IALTLPDRSVRNVAMGSTGYDVALSIGRKLAQDALAIKLNGVVCDLNTLINSDAAIEIITFTSPEGPEI
SYT_STRTD       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRVITEDGSIEIVTPDHEDALPI
SYT_STRT2       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRVITEDGSIEIVTPDHEDALPI
SYT_STRT1       MINITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRVITEDGSIEIVTPDHEDALPI
SYT_CHLTE       ---ITLPDGSERTYSSGVTGLEIAESIGKKLAEAALAFTIDGKPRDLDTPVTENARVSIITFDSPEGKEI
SYT_FLAPJ       MIKITLPDGSIKEFENGVTPMDVAKSISEGLARNVISAAFNNITVEISTELTTDGSLVLYTWNDKDGKKA
SYT_CYTH3       MIKITLPDGSIREYEKGITSMGIALSISEGLARNVLAAKVNGEIWDASRAITSDSTVQLLTWNDTEGKST
SYT_THISH       ---ITLPDGSERRFDAPVTVRDVXXXXXXXXXXXXXXXRVNGRLVDTSHLIEDDASLAIITDRDPEGLEV
SYT_PELPB       VIALTLPDGSVKTFPIGTTGNDVALSIGRKLAQDALALRVNGVAIDLSTPLTADAAIEIITFSSPAGQDI
SYT_BACFR       MIKITFPDGSVREYNEGVNGLQIAESISSRLAQDVACGV-NGEIYDLGRPINEDASVVLYKWEDEQGKHA
SYT_BACFN       MIKITFPDGSVREYNEGVNGLQIAESISSRLAQDVACGV-NGEIYDLGRPINEDASVVLYKWEDEQGKHA
SYT_FLAJ1       MIKITLPDGSIREFAQGVTPMEVAKNISEGFARNVISASFNGXXXXXXXXXXXDGNLILYTWNDAEGKKA
SYT_BACTN       MIKITFPDGSVREYNEGVNGLQIAESISSRLAQDVACGV-NGETYDLGRPINEDADFVLYKWDDEEGKHA
SYT_ACHLI       MIKVTFPDGNIKSYKKGITVLEVAEDISISLAKKIVAAKFNEDLVEISRKLEHDGKLQLLTPKEELSFHV
SYT_NATTJ       MLKITLKDGSVKEIEKGSNVLDLAKSISNRLAKEAVGAKVDGKTVGLNKELNENCEVEILSFEDDEGCDI
SYT_LACSS       -IQLTFPDGAQKTFEQATSLLDVAKSISTSLAKKAIAGKFNGEVVDLQQPLLEDGAIEIITKDDQANLTA
SYT_PARD8       MIKITFPDNSVREYAKGTTAMQIAESISSRLAQEVLAASVNGEVWDLSRPINDDATVKLLKWEDEEGKHA
SYT_GLOVI       -----------------------------------------------------------------EKLHR
SYT2_BACSU      -VHIQLPDGQIQEYPKGITIKEAAGSISSSLQKKAAAGQVNGKLVDLSFKLEEDAELSIVTLDSQEGLQV
SYT_BACV8       MIKITFPDGSVREYNEGVTGLQIAESISSRLAQDVACGV-NGETIDLSRPINEDANFVLYKWEDEQGKHA
SYT_POLSQ       ---VTLPDGSKREYEAPVRVADVAQSIGSGLAKAALGGIVDGQMVDTSFVIDKDSHLAIITDKSPEALEI
SYT_POLNS       MLVVTLPDGSKREFEAPVRVADVAQSIGSGLAKAALGGIVDGKMVDTSFVIDKDSQLAIITDKSPEALEI
SYT_KOSOT       --KIELPDGSIKEYDHPVTAADVAADLSPALAKRAIGVEVNGELWDLTRELPEECKINLILEKDPRAPEF
SYT_THEMA       -IKVKLPDGKEKEYDRGITPAEIAKELG---IKKAIGAVVNGELWDLKRPIENDCELRLVTLEDPEAPEF
SYT_THEP1       -IKVKLPDGKEKEYDRGITPAEIAKELG---VKKAIGAVVNGELWDLKRPIENDCELRLVTLEDPEAPEF
SYT_LEUMM       -ISLTFPDGAIKKFDEGIKPIGVAESISKSLAKKSVSGKINGSYIGMNDVITESGDFQLITTSDSEALDL
SYT_RUBXD       MATVRLPDGKELEVGSGERLEDVARRIGPRLARDAVVARLNGRLVDLDLPVDGGGELEFVTADSPEGLYV
SYT_THET8       ---VYLPDGKPLELPEGATAKDVARALGEGWERRAVGAIVDGELYDLLKPLPQGAKVRLLTEKDPEFQTL
SYT_PEDPA       -INIEFPDGSVKPFEQGVSILDIAKSISTSLAKKAVAGKINGALVRLDQAINENVKIEIVTKDSEDGNIV
SYT_BORA1       MVQITLPDGSQRQYPGPVTVAEVAQSIGTGLAKAALAGRVTPKLVDTSFRIDQDAKLAIVTAKDADGLDL
SYT_THESQ       -IKVKLPDGKEKEYDRGITPAEIAKELG---VKKAIGAVVNGELWDLKRPIENDCELRLVTLEDPEAPEF
SYT_PELCD       MIQIELPDGSIKEFSETTTPGDIAAGIGSGLARQAVAARFNDRMVDLCTPITESGRLEIITLNSPQGLEV
SYT_LACPL       -INVKFPDGAEKQFDAGVTTEAIAKSISPSLAKRSVAGKFNDQIVDYRQPLTTDGSIEIIAADSEDGLNV
SYT_THENN       -IKVVLPDGSEREYEKGTKPMEIAREVG---IKKVIGAVVDEELWDLKRPLERDCRIRFVTLEDPEAPEF
SYT_PETMO       MVKITYPDNSVQEFKDGITPAEIAKGISEGLYRNAIAAEINGELKDLNTPIMQDSTIKLITLDDEIAPKI
SYT_DESVV       -------EGQMLEVASGASCGDALKGALSGKKKNVLACRLDGGLVDITATVPDGTTIEPVYADSPEGLDL
SYT_DESVH       -------EGQMLEVASGASCGDALKGALSGKKKNVLACRLDGGLVDITATVPDGTTIEPVYADSPEGLDL
SYT_PELPD       -ISIALPDGSKREIASGSTIADXXXXXXXXXXXXXXXXXXDGELVDLSTELKDDSRVEIITEKSPEALTV
SYT_LEGPH       MPNVKLPDGNVKHFEAPLTIYDVAHHISPGLAKAAIAGRVDGVLVDTSYLIKEDCSLIIVTEKHEDSLEI
SYT_METFK       ---IRLPDGSERKFDGPVTVAEVAMNIXXXXXXXXXXXKVNGKAVDTSYLITDDADLSIITDRDAEGLAI
SYT_DESDG       -------------------------------------------------------TLEPVYADSPEGLGL
SYT_ALHEH       MPAITLPDGSRREFDHPVTVRDVAESIGKXXXXXXXXXXXXXXXVDLSHRIDDDVQLEIVTDRDPDGVDM
SYT_LEGPC       MPNVKLPDGNVKHFEAPLTIYDVAHHISPGLAKAAIAGRVDGVLVDTSYLIKEDCSLIIVTEKHEDSLEI
SYT_LEGPL       MPNVKLPDGNVKHFEAPLTIYDVAHHISPGLAKAAIAGRVDGVLVDTSYLIKEDCSLIIVTEKHEDSLEV
SYT_LEGPA       MPNVKLPDGNVKHFEAPLTIYDVAHHISPGLAKAAIAGRVDGVLVDTSYLIKEDCSLIIVTEKHEDSLEI
SYT_SULSY       MIEIFIEDLNQKTFNEGITLKDILKNLN-GKFKDVVGGKLNGEIIDIHTPINQSGNLKFLKKEDKESLEI
SYT_GEOBB       -INVTLPDGSQRPLPAGASIFDXXXXXXXXXXXXXXXXXXDGNLVDLNTPLADGARVEIITEKSPEALEI
SYT_SYMTH       VVHVTLPDGSVREYPQGITIAEAVAQIGPRLAKAALAAKVDGRLVDLSARLEKDCTLQVLTFKDEEGREV
SYT_HALHL       MPAITLPDGSVKAFDHPVTTREIAESIGRKLAKDAIVGRVDGELIDLDRPIEHDAYVEIVTSNDPDGLEV
SYT_LACS1       -IKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIITKDSNDGLVV
SYT_TERTT       ---ITLPNGSKREFSNPITVLDVAADIGPGLAKATLAGIVDGKEVDAGFTIEQDAALSIVTEKSPEGLEV
SYT_PORGI       MIKITFPDGNFREYEAGITGWDIAGSISPRLQQDVLAAGVNGQVWDLHRQINEDAEVKLFKWDDAEGKHA
SYT_PORG3       MIKITFPDGNFREYEAGITGWDIAGSISPRLQQDVLAAGVNGQVWDLHRPINEDAEVKLFKWDDAEGKHA
SYT_METCA       ---VTLPDGSRREFDHPVTLLQVAEAIGPGLAKAALAGRVDGRLVDLSHRIEADAEVALVTARDADGVEV
SYT_GEOSM       -INVTLPDGSQRPLPAGASIFDXXXXXXXXXXXXXXXXXXDGNLVDLNTPLADGARVEIVTEKSPEALEI
SYT_THICR       ---ITLPDGSKRAFEDAVTVMQVASDIGAGLAKATIAGRVNGQLKEASDLITEDAELQLITLKDEDGLHI
SYT_ACIC5       -IQVTLPDGTVKTFPAGTTPFQVAESISPRLAQAAVVARIXXRLVDLSTPLEEDVQLALLTEKDPEALKV
SYT_PSYWF       MVAITLPDGNVKEFDGATTVMEVAQSIGPGLAKATIAGRVDGKLVDASDPITQDASVEIVTAKDKDGVDI
SYT_NITEU       MTVVRLPDGTDRVFDNSVTVREVAESISPGLARAALAGKLNGKLVDLSEQIETDSDLVLITDKDSEGLEI
SYT_DESVM       -------EGQVFDVQSGVSCRDALKGALSGKKKNVVACRCNGTPLDLTATVPADTTIEPVFADSPEGIEL
SYT_GEOSL       -IRVTLPDGSERILAEGATVRDXXXXXXXXXXXXXXXXXXDGVQVDVTAPLTDGARVEIITDKSADGLDI
SYT_RALPJ       MIAITLPDGSRREFPGPVTVAEVAQSIXXXXXXXXXXXRVDGQMVDTSYTIDHDAKLAIITDKDADGVDV
SYT_PROM4       ---ITLPDGTKKEFSGSITIADIASDIGPGLASAAIAGKVNQDLVDISIPIDYDAEIKIITAKDKEGVEI
SYT_ACIF5       MPDIQLPDGSHRQFAEPVTGLTLARAIGSGLARAAVAMRVDGILKDLSAVLDQDAEVAIVTRDSADGLEV
SYT_ACIF2       MPDIQLPDGSHRQFAEPVTGLTLARAIGSGLARAAVAMRVDGILKDLSAVLDQDAEVAIVTRDSADGLEV
SYT_MAGSM       MVEIILPDGSSRSYDQELTCGQXXXXXXXXXXXXXXXXVVNGQKVDLDAPVPHGAQVAIITEDSPEGLEI
SYT_HAHCH       ---ITLPDGSKREFSNPVTVLDVAADIGPGLAKAAVAGKVDGTLVDCSHVIDKDAELAIVTERDAEGVEV
SYT_LACCB       -LDITFPDGNVKQFPDGTTVKAITEGISNSLAKKAVAGKLDGDLIAYDEPIAHSGQLQIMTKDDAEGLTV
SYT_LACC3       -LDITFPDGNVKQFPDGTTVKAITEGISNSLAKKAVAGKLDGDLIAYDEPIAHSGQLQIMTKDDAEGLTV
SYT_LACBA       -ISIKFPDGAVKAFPAGTTPADVAKSISISLAKKAVAAKLDGQLVDYLTPLASDGSIEIVTKDSDDGLTV
SYT_METPP       MIVITLPDGSQREFPGPVTVAEVAASIGTGLAKAALGGRVDGKLVDTGHRIEGDARLAIVTDKDADGLDL
SYT_BORPE       MVQITLPDGSQRQYPGPVTVAEVAQSIXXXXXRVAFDGA-EPRLVDTSFRIDNDAQLAIVTAKDADGLDL
SYT_BORPA       MVQITLPDGSQRQYPGPVTVAEVAQSIXXXXXRVAFDGA-EPRLVDTSFRIDNDAQLAIVTAKDADGLDL
SYT_BORBR       MVQITLPDGSQRQYPGPVTVAEVAQSIXXXXXRVAFDGA-EPRLVDTSFRIDNDAQLAIVTAKDADGLDL
SYT_POLNA       MIQITLPDSSKRDYSGPVTVAEVAASIXXXXXXXXXXXXXXXXXVDTSFLISQDSALSIVTAKDAEGLEL
SYT_NITEC       MTVVRLPDGTDKVFDYPVTVLDVAESIGPGLARVALAGKLNGRLVDLSEPIEIDSDLVLITNKDPEGLEI
SYT_LAWIP       ---------------------------------------INGSIIDL-FTPLPTITKEVITIDSEDGLEM
SYT_BORPD       MVQITLPDGSQRQFPGPVTVAEVAQSIGTGLAKAALGGRVTERLVDTSYRLEHDAQLAIVTAKDADGLDM
SYT_RALSO       MIAITLPDGSRREFPGPVTVAEVAQSIXXXXXXXXXXXRIDGQLVDTSFRIEQNVDLAIVTDKDTDGLDV
SYT_LACH4       ---ITLPDGSKKDFEESLTIADLAQNIATSLGKAAVAGKVNGELKPLDYKLDSDSEVAIITNKDEEGLDV
SYT_FUSNN       -------------------MFEIAKGISNSLAKKSVGAKVDGKNVDMSYILDHDAEVEFIDIDSPEGEDI
SYT_CHRVO       MPDIRLPDGSVRSFDKPVTVHEVXXXXXXXXXXXXXXXXVDGQLVDTSYLIDRNADLAIVTDKDADGLSV
SYT_CUPTR       MIAITLPDGSRREFPGPVTVAEVAQSIXXXXXXXXXXXXVDGQLVDTSYKIERDAELAIVTDKDADGVDV
SYT_STRMK       MINITLPDGSRREFENPVSVMEVAQSIGAGLAKATIAGAVDGVLVDASDVIDHDASLRIITAKDEEGVEI
SYT_XANC5       MINITLPDGSRREFESPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDVIDHDASLRIITAKDAEGVEI
SYT_RALEJ       MIAITLPDGSRREFPGPVTVAEVAQSIGTXXXXXXXXXXVDGNLVDTSYSIDRDVALAIITDKDADGVDV
SYT_XANOR       MINITLPDGSRREFESPVSVMQVAQSIGAGLAKATIAGRVDGQLVDASDVIDHDASLRIITAKDAEGVEI
SYT_XANOM       MINITLPDGSRREFESPVSVMQVAQSIGAGLAKATIAGRVDGQLVDASDVIDHDASLRIITAKDAEGVEI
SYT_THET2       ---VYLPDGKPLELPEGATAKDVARALGEGWERRAVGAIVDGELYDLLKPLPQGAKVRLLTEKDPEFQTL
SYT_JANMA       MITVRLPDGSQREFDTPVTVAQVAANIGTXXXXXXXXXXVNGDVVDTSYLIEKDSDLAIITDKDAEGIDV
SYT_XANAC       MINITLPDGSRREFESPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDVIDHDASLRIITAKDAEGVEI
SYT_PSE14       MPTITLPDGSQRSFDHVVSVADVALSIGAGLAKATVAGKVDGKLVDACDLIENDASLQIITPKDQEGLEI
SYT_RICCN       MINISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQDLSIVIDNDCKLRILTAQDPECLEI
SYT_RICAE       MINISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQDLSIVIDNDCKLRILTAKDPECLEI
SYT_RALEH       MIAITLPDGSRREFPGPVTVAEVAQGIXXXXXXXXXXXXVDGQLVDTSYRIDRDAELAIVTDKDADGVDV
SYT_PSEPF       MPTITLPDGSQRSFDHPVSVAEVAASIGAGLAKATVAGKVNGKLVDACDIIDSDATLQIITPKDEEGLEI
SYT_NEIMB       MLNITLPDGSVRQYESPVTVAQIAASIGAGLAKATVAGRVNGKLVDACDPIVEDSAVQIITPKDQEGIEI
SYT_THELT       -IKVKIKNDGEFISEKPVQIREIIRS------DEVIAAVFNGKLIDLRSTIDSDGEVEFVDLFHELAPEV
SYT_STRM5       MINITLPDGSRREFENPVSVMDVAQSIGAGLAKATIAGSVDGVLVDASDVIDHDASLRIITAKDEEGVEI
SYT_BURTA       MVSIRLPDGSIRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_XANCP       MITITLPDGSRREFDAPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDLIEHDASLRIITAKDAEGVEI
SYT_XANCB       MITITLPDGSRREFDAPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDLIEHDASLRIITAKDAEGVEI
SYT_XANC8       MITITLPDGSRREFDAPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDLIEHDASLRIITAKDAEGVEI
SYT_SACD2       ---ITLPDGSKREYDAPISVMGVAADIGPGLAKATLAGVVDGKEVDASFEITQDVSLSIITAKSEEGLEV
SYT_BURPS       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_BURP6       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_BURP1       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_BURP0       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_BURMS       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_BURMA       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_BURM9       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_BURM7       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGLDI
SYT_RICRS       MINISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQDLSIVIDNDCKFRILTAKDPECLEI
SYT_RICFE       MINISFPDGSVKQFESNITAFEVANAISMSLAKAAMVAEINGELKDLSTIIENDCKLRILTAKDSECLEI
SYT_DESDA       --------------------------------------------------------------DSPEGLQI
SYT_RICBR       MINISFPDGSVKQFEKNITAFEIAVVISTSLAKAAMIAEINGDLKDLSTQIDNDCRLRILTAKDPECLEV
SYT_RICB8       MINISFPDGSVKQFEKNITAFEIAVVISTSLAKAAMIAEINGDLKDLSTQIDNDCRLRILTAKDPECLEV
SYT_MARMS       ---ITLPDGSQRSFSNPVTVMQVAEDIGPGLAKATVAGRIDGQLVDACELISDDAKLSIITGKDPEGVEI
SYT_MARAV       ---ITLPDGSHRSFAEPVTVHDVXXXXXXXXXXXXXXXXXXXXXVDTSHLIENDTELAIVTERDEDGVDI
SYT_DESMR       -MQVTIEDQSL-EAAAGEACGQVSRAVSGKRLKNAVACLVDGQPRDLAFPLPEDAELALVAADSPMGLSI
SYT_ACIAC       MIRITLPDNSQREYAGPVSVADVAQSIGPGLAKMTVAGKVDGRLVDASDVIDHDARLQIITPWDQEGVEI
SYT_PSYCK       MVAITLPDGSVKNFEGNTTVMEVAQSIGTGLAKATVAGRVDGQLVDAHDPIAHDAKVEIVTPKDDDGVDI
SYT_RICPU       MINISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQDLSIVIDNDCKLRILTAKDPECLEI
SYT_RICCK       MINISLSDGSVRQFEKGMTIYEVANAISMSLAKQAIVAEINGELKDLSTVIENNCKLRILTAKDPECLEI
SYT_PSEPK       ---ITLPDGSQRSFDHAVSVAEVAASIGAGLAKATVAGKVDGKLVDACDLISNDATLQIITPKDEEGLEI
SYT_RICAH       MINISFPDGSVRQFENDITAYEVANAISMSLAKAAMVAEINGELKDLSTVIENDCKLRILTAKDSECLEI
SYT_PSEMY       MPTITLPDGSQRSFDHPVSVLEVAQSIXXXXXXXXXXXXVNGKQVDACDVIDTDATLQIITPKDEEGLEI
SYT_BURCJ       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDASLAIVTDKDADGLDI
SYT_BURS3       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSAVIDRDASLAIVTDKDADGLDI
SYT_PSYA2       MVAITLPDGSVKNFEGNTTVMEVAQSIGTGLAKATVAGRVDGHLVDAHDPIVADAKVEIVTPRDDDGVDI
SYT_PSEP1       ---ITLPDGSQRSFDHAVSIAEVAASIGAGLAKATVAGKVDGKLVDACDLISNDATLQIITPKDEEGLEI
SYT_PSEU2       MPTITLPDGSQRSFDQAVSVADVALSIGAGLAKATVAGKVDGKLVDACDLIENDASLQIITPKDQEGLEI
SYT_DESAD       --------GKELEVQQGALCGEVLEALSKKQFKNVVVAKCGDTLLDLTTTVPADTDLEPVMADSKEGLEV
SYT_BURXL       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXIDGELVDTSALIDHDVALAIVTEKDADGLDI
SYT_BURCC       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDASLAIVTDKDADGLDI
SYT_AZOPC       MIKITFPNTSARNYAIGTTPMQIAESISCRLAEEILSANVNGEMWDLSRPINENASVKLYKWEDFEGKRT
SYT_SYNY3       ----------------------------------------------------------------------
SYT_PSEU5       MPTITLPDGSQRSFDHPVTVAEVAQSIXXXXXXXXXXXXVDGKLVDACDLIERDASLQIITPKDEEGLEI
SYT_FRATN       MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATVAAYIDDQLKDAKDAINSNCELRLITVKDPEGLEI
SYT_BURVG       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDASLAIVTDKDADGLDI
SYT_BURPP       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXIDGELVDTSALIDHDVALAIVTEKDADGLDI
SYT_DESAH       MINITLPDDSIKSFKEYPKGMDVARGISEGFARNCVAMEIDGQLLDLDVEIRNDCAVRLITTRDAEAVEI
SYT_COXBU       MPTIQLPDGSVKQFSKPVSVQAVAESIGTSLAKPALAGKIDDHLVDVSFIIDKDVSLRIITEKDPEGLEV
SYT_FRATT       MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGLEI
SYT_FRATM       MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGLEI
SYT_FRAT1       MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGLEI
SYT_BURA4       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDAALAIITDKDADGLDI
SYT_VARPS       MIQITLPDNSRREFPGPVSVAEVAQSIGPGLAKMTVAGKVDGKLVDASDVIDHDARLQIITPRDDEGLEI
SYT_PSEAE       ---ITLPDGSQRSFDHPVSVAEVAQSIXXXXXXXXXXXXVDGRLVDACDTIDRDATLQIITPKDEEGLEI
SYT_PSEAB       ---ITLPDGSQRSFDHPVSVAEVAQSIXXXXXXXXXXXXVDGRLVDACDTIDRDATLQIITPKDEEGLEI
SYT_PSEA8       ---ITLPDGSQRSFDHPVSVAEVAQSIXXXXXXXXXXXXVDGRLVDACDTIDRDATLQIITPKDEEGLEI
SYT_FRATW       MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGLEI
SYT_FRAP2       MINIKFPDGSIREFESGVNSLQIAKSISPSLAKITVGAYIDNKLSDAKDVINHDCELRLITTKDTEGLEI
SYT_BURP8       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXIDGELVDTSALIDHDVALAIVTDKDADGLDI
SYT_PSESM       MPTITLPDGSQRSFDHAVSVADVALSIGAGLAKATVAGKVDGKLVDACDLIENDASLQIITPKDAEGLEI
SYT_PSEA7       ---ITLPDGSQRSFDHPVSVAEVAQSIXXXXXXXXXXXXVDGRLVDACDTIERDATLQIITPKDEEGLEI
SYT_PROM3       ---ITLPDGNKKKFDQPVTIMEVAESLGPGLAKAAIAGRVNGVLLDTCIPIEKDSEVNIITAKDQDGIET
SYT_NITMU       MAVVRLPDGSERVYEHSVTVGEVXXXXXXXXXXXXXXXKVNGKLVDLSARIENDSDVAIITEKDAEGLEI
SYT_FRATO       MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGLEI
SYT_BURCM       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDAALAIITDKDADGLDI
SYT_AZOVD       ---ITLPDGSQRTFDHPVSVAEVAQSIGAGLAKATVAGKVDGKLVDACDLIDHDATLQIITPKDEEGVEI
SYT_FRATH       MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGLEI
SYT_FRATF       MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGLEI
SYT_NITOC       ---ITLPDGSQRSFDHPVTVYDVAADIGPXXXXXXXXXXIEGRLVDSSYPLEKDTKLTIITERDMDGLEI
SYT_IDILO       ---ITLPDGSQREFDKPVSIMEVAADIGAGLAKATVAGRIDGELVDACELIEHDARIEIVTPKDDDGVHI
SYT_CELJU       ---ITLPDGSQRSFDKPVSVYEVAASIGPGLAKATLGGRVNGQRVDAHDLISEDANLVIFTPKDDDGLEI
SYT_RHOBA       -VQVRLPDGSLKTQPADATAMDVAKEISEGLARSVVAAEVDGTIVDLGEIADDENPLRLLTTRDESALDV
SYT_VESOH       ---ITLPDGTKKIFEQVVSVEQVAKSM--GLVKAALAGEVDGELVSTSFLIKTDANLTIITANDDQGLEI
SYT_RICTY       MINISFPDGSVKQFAQNITAFEIANAISMSLAKAAMVVEINGEFKDLSTVIEHDCKLRILTAKDYECLEI
SYT_PROMM       ---IALPDGNKKKFDQPVTIMEVAESLGPGLAKAAIAGRVNGVLLDTCIPIEKDSEVNIITAKDQDGIET
SYT_POLSJ       MIQITLPDASKREYPQAVTVAEVAASIXXXXXXXXXXXXXXXXXXXTSYLIEKDSALSIITAKDADGLEL
SYT_LACJO       ---VTLPDGSKKDFDKAVSVKELASSIATSLGKAAVGAKINGVMKPLDYIVDEDVEAAIITDKDEEGLDI
SYT_PSEFS       MPTITLPDGSQRSFDHSVSVAEVAASIGAGLAKATVAGKVDGKLVDASDLITNDASLQIITPKDQEGLEI
SYT_DECAR       MPDIKLPDGSIRSYEQAVTVAEVXXXXXXXXXXXXXXXXXXXQLVDTSYLIEQNADLAIITERDAEGLEL
SYT_PROMA       ---ITLPDGAQRTYSTPVTIAEIAAEIGPGLAKAAIAGEVNGELVDTCIPISVNANINIITSKNKEGIDI
SYT_ANADE       LVKVTLPDGSQKEAPRGTPVIDFVKGIGAGLAKAAYFAKLDGAPVDLSRALDRDARLEIVTTRSPEALEV
SYT_DELAS       MIHITLPDGSQREYPGPVTVAEVAASIXXXXXXXXXXXXXDAKVVDTSFVINKDMPLSIVTAKDADGLDV
SYT_CHRSD       ---VTLPDGSQKTFDSPITVMQLAESIGTGLAKACVAGKIDGVPVDTADVIEHDAEVSILTPRDQEGLEI
SYT_RICPR       MINISFPDGSVKQFAQNITAFEIVNAISMSLAKAAIVVEINGELKDLSTVIENDCKLRILTAQDYECLEI
SYT_LEUCK       -ISLTFPDGAVKVFPEGTTPLPVAESIXXXXXXXXXXXXXHGAYVGMHDMIPASGDFQLITTSDDEXXXX
SYT_BURM1       MVSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSAVIDHDASLAIVTDKDPDGLDI
SYT_PROM1       ---ITLPDGSEKNYESSVTIEKIATDIGPGLAKAALAGRVNGNLLDTCIPITNDAEIQIITSKDNEGLEI
SYT_PROMT       ---ITLPDGTEKKYDSAVTIDQIASEIGPGLAKAALAGRVNGELIDTCIPITQNSHIQIITSKDDEGLEI
SYT_ANAMM       ---------------------EVASAMFPEIAESIVALFVDGNLQDLATPISKDGSVDPVTIESNTGMDI
SYT_ANAMF       ---------------------EVASAMFPEIAGSIVALFVDGNLQDLATPISKDGSVDPVTIESNTGMDI
SYT_VIBVY       ---ITLPDGSQRQFDNSVSTMDVALSIGPGLAKATIAGRVNGQRVDACDLIEEDASLEIITTDEVDGLEI
SYT_VIBHB       ---ITLPDGSQRQFDNPVSTMEVAQSIGPGLAKATIAGRVNGNRVDACDLIEEDASLEIITVDEVDGLEI
SYT_SHESW       ---ITLPDGSKREFAHAVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGVEI
SYT_SHEPC       ---ITLPDGSKREFAHAVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGVEI
SYT_SHEPW       ---ITLPDGSKREFAQPVSTLDVAADIGPGLAKACIAGRVNGELKDACDIIDTDSELSIITAKDEEGVEI
SYT_SHEB9       ---ITLPDGSKREFAHAVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGVEI
SYT_SHEB8       ---ITLPDGSKREFAHAVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGVEI
SYT_SHEB5       ---ITLPDGSKREFAHAVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGVEI
SYT_SHEB2       ---ITLPDGSKREFAHAVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGVEI
SYT_PSEE4       ---ITLPDGSQRTFDQPVSVAEVAASIXXXXXXXXXXXXVDGKLVDACDKIDHDATLQIITPKDEEGLEI
SYT_VIBVU       ---ITLPDGSQRQFDNPVSTMDVALSIGPGLAKATIAGRVNGQRVDACDLIEEDASLEIITTDEVDGLEI
SYT_SYNP6       ----------------------------------------------------------------------
SYT_SYNE7       ----------------------------------------------------------------------
SYT_SHEON       ---ITLPDGSKREFAHPVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGIEI
SYT_LACGA       ---VTLPDGSKKDFDKAVSVKELASSIATSLGKAAVGAKINGEMKPLDYVVDEDVEAAIITDKDEEGLNI
SYT_AQUAE       -IKVKIK-GKEYEVEKGTKIFELAG------IKDALGGVINGKIIDLQTPVRESGEIKPVYRGSKESLEI
SYT_ACIBY       ---ITLPNGDQKSFDHPVSVMEVAQSIGPGLAKNTVAGRVNDRLVDACDLITEDSTLQIITPKDEEGLEI
SYT_ACIBT       ---ITLPNGDQKSFDHPVSVMEVAQSIGPGLAKNTVAGRVNDRLVDACDLITEDSTLQIITPKDEEGLEI
SYT_ACIBC       ---ITLPNGDQKSFDHPVSVMEVAQSIGPGLAKNTVAGRVNDRLVDACDLITEDSTLQIITPKDEEGLEI
SYT_ACIB3       ---ITLPNGDQKSFDHPVSVMEVAQSIGPGLAKNTVAGRVNDRLVDACDLITEDSTLQIITPKDEEGLEI
SYT_LACAC       ---VTLPDGSKKEFDKAVSVKEVASSIATSLGKAAVGAKVNGQVKPLDYEIDSDVEIAIITDKDEEGLDI
SYT_ACIB5       ---ITLPNGDQKSFDHPVSVMEVAQSIGPGLAKNTVAGRVNDRLVDACDLITEDSTLQIITPKDEEGLEI
SYT_UREU1       ----------------------------------------------------------------------
SYT_MYXXD       IITVTLPDGSQKQTARGTTIADVRESIGPGLAKAALFARVNGQDMDLARKLDEDVKLQIFTPKSPESLEL
SYT_DEIDV       ---VVLPDGKQLELPMGATALDAASAIGPRLAQDALAATANGELVDLMTPLPDGASITLITKKNPDAAPL
SYT_DEHE1       ----------------------------------------------------------------------
SYT_SHEPA       ---ITLPDGSKREFAHSVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDSDLSIITAKDEEGVEI
SYT_XYLFA       MITITLPDGSRREFEGPVSVMQVAHAIGPGLAKATIAGQIDGHLVDASDLIEHDAMLRIITPEDQEALDI
SYT_VIBPA       ---ITLPDGSQRQFDNPVSTMEVAQSIGPGLAKATIAGRVNGNRVDACDLIEEDASLEIITVDEVDGLEI
SYT_BRUAB       -VSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKLEIITREDPRALEL
SYT_BRUA2       -VSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKLEIITREDPRALEL
SYT_BRUA1       -VSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKLEIITREDPRALEL
SYT_XYLFM       MITITLPDGSRREFEGPVSVMQVAHAIGPGLAKATIAGQIDGHLVDASDLIEHDAILRIITPEDQEALEI
SYT_SHESR       ---ITLPDGSKREFAHPVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGIEI
SYT_NEIMA       MLNITLPDGSVRQYESPVTVAQIXXXXXXXXXXXXXXXRVNGKLVDACDPIVEDSAVQIITPKDQEGIEI
SYT_HERAR       MITVRLPDGSQREFDTPVTVAQXXXXXXXXXXXXXXXXXXXXNVVDTSYLIEQDSDLSIITDKDAEGLDV
SYT_ACTSZ       ---ITLPDGSQRQFDNPVSVLEVAQSIGSGLAKATIAGRVNGERRDACDMINDDSTLEIITAKDEDGLEI
SYT_SHESM       ---ITLPDGSKREFAHPVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGIEI
SYT_SHESA       ---ITLPDGSKREFAHPVSTLDVAADIGPGLAKACIAGRVNGELKDACDLIETDAELSIITAKDEEGIEI
SYT_DESAA       MINITLPDGKIVESDGPVSGEDVAKGISEGFARNCVAVEVDGKLTDLSTPIETDASVVFITTKDEQGLDI
SYT_DEHSB       ----------------------------------------------------------------------
SYT_BRUME       -VSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKVEIITREDPRALEL
SYT_XYLFT       MITITLPDGSRREFEGPVSVMQVAHAIGPGLAKATIAGQIDGHLVDASDLIEHDAILRIITPEDQEALEI
SYT_XYLF2       MITITLPDGSRREFEGPVSVMQVAHAIGPGLAKATIAGQIDGHLVDASDLIEHDAILRIITPEDQEALEI
SYT_HAES1       ---ITLPDGSQRQFDNPVSVLEVAQSIGSGLAKATIAGRVNGERRDASDMISEDANLEIITAKDEDGLEI
SYT_ACIAD       ---ITLPNGDQKSFDQPVSVMQVAQSIGPGLAKNTVAGRVNDRLVDACDLITEDATLQIITPKDPEGVEI
SYT_SHEDO       ---ITLPDGSKREFVNPVSTLDVAADIGPGLAKACIAGRVNGELKDACDLISTDSDLSIITAKDQEGVEI
SYT_PSEPG       ---ITLPDGSQRSFDHXXXXXXXXXXXXXXLAKATVAGKVDGKLVDACDLISNDATLQIITPKDEEGLEI
SYT_LARHH       MPAIRLPDGSVRQFENPVSVHDXXXXX