[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB82040.1

[Show Plain Result]


## Summary of Sequence Search
    1::99
    5::96      3e-30  63%  104 aa  YERC_BACSU RecName: Full=Uncharacterized protein yerC;
    1::99

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxKLKGKDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKTYTEIAEETKA
YERC_BACSU      ------KLRGKELDQLFNSILSLKDLEECYRFFDDLCTINEIQSLAQRLEVARMLREGNTYHKIETETGA


                         .         .         *         .         .         .         .:140
query           STATISRVNRCLNYGADGYNNILNRLDEx
YERC_BACSU      STATISRVKRCLNYGNDAYEMALDRVKE-