[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB82239.1

[Show Plain Result]


## Summary of Sequence Search
    1::192
    1::154     3e-33  41%  196 aa  SPMA_BACSU RecName: Full=Spore maturation protein A;
    1::192

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MINYIWFAIIALGLIFSIMTGQGELITTGLTESSEGAVKFIISLVGIMCFWCGVMKIAENSGLTSKVAKL
SPMA_BACSU      MVNIIWVSLTVIGLVFAMCNGTLQDVNEAVFKGAKEAITISFGLMSVLVFWLGLMKIAEQSGLLDIFSRM


                         .         .         *         .         .         .         .:140
query           LNPILKKIFKESSHSDEAMGAIVMNLTANMFGLSNAATPLGIKAMSELNKINKEKDGRASNDMALFLVIN
SPMA_BACSU      CRPFISKLFPDIPPDHPAMGYILSNLMANFFGLGNAATPLGIKAMEQMKKLNGNR-SEASRSMITFLAVN


                         +         .         .         .         .         *         .:210
query           AACIQLIPSTVISIRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SPMA_BACSU      TSCITLIPTTVIAVR-------------------------------------