[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB82330.1

[Show Plain Result]


## Summary of Sequence Search
    1::293
    3::288     3e-61  43%  300 aa  SDHA_BACSU RecName: Full=Probable L-serine dehydratase, alpha
    7::284     2e-52  47%  292 aa  SDHA_PEPAS RecName: Full=L-serine dehydratase, alpha chain;        
    1::204     3e-38  48%  209 aa  SDHA_LACSK RecName: Full=Probable L-serine dehydratase, alpha
  175::452     2e-31  33%  455 aa  SDHL_HELPY RecName: Full=L-serine dehydratase;         Short=SDH;  
  175::452     5e-30  32%  455 aa  SDHL_HELPJ RecName: Full=L-serine dehydratase;         Short=SDH;  
  172::449     2e-29  35%  454 aa  SDHL_ECOLI RecName: Full=L-serine dehydratase 1;         Short=SDH
  173::449     9e-27  28%  454 aa  TDCG_ECOLI RecName: Full=L-serine dehydratase tdcG;       
  176::450     1e-25  29%  455 aa  SDHL_STRCO RecName: Full=L-serine dehydratase;         Short=SDH;  
  173::450     5e-25  28%  455 aa  SDHL_HAEIN RecName: Full=L-serine dehydratase;         Short=SDH;  
  268::452     9e-22  44%  461 aa  SDHL_MYCTU RecName: Full=L-serine dehydratase;         Short=SDH;  
  268::452     9e-22  44%  461 aa  SDHL_MYCBO RecName: Full=L-serine dehydratase;         Short=SDH;  
  173::449     1e-20  32%  455 aa  SDHM_ECOLI RecName: Full=L-serine dehydratase 2;         Short=SDH
   12::75      6e-04  28%  307 aa  TRUB_PROMS RecName: Full=tRNA pseudouridine synthase B;       
    1::293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxRSGAELLEICRENNFSLAEYAIQYEMESKNCTREDVIKGMEKVLQVMKEAANEGQEKEVYSVSGLIG
SDHA_BACSU      ---RNVKELIEITKEKQILISDVMIAQEMEVTEKTKEDIFQQMDHNLSVMEAAVQKGLEG-VTSQTGLTG
SDHA_PEPAS      -------EIIDVCNERGIKIYDLVLEEEIKNSHTTEEEIRKKLDAVIDVMHASATKNLTQSDVTEYKMID
SDHA_LACSK      ----------------------------------------------------------------------
SDHL_HELPY      ----SAKELLELCQKHQKSIAEIVRLRENALKNHPDATMVKIYHAMLECYDNGANS---KERYKVTRLAP
SDHL_HELPJ      ----SAKELLELCQKHQKSIAEIVRLRENALKNHPDATMTKIYHAMLECYHNGANS---KERYKVTRLAP
SDHL_ECOLI      ---KSATELLAYCNETGYSLSGLAMQNELALHS--KKEIDEYFAHVWQTMQACIDRGMNTEGVLPGPLVP
TDCG_ECOLI      ----SAGELLKMCDYNGLSISGLMMHNELALRS--KAEIDAGFARIWQVMHDGIERGMNTEGVLPGPLVP
SDHL_STRCO      ---RTGDELLRLARETGLSIS--ALMLENERAWRDEDEIREGLLEIWRVMRACVDRGMTREGILPGGLKR
SDHL_HAEIN      ---KNAEDILKHCSDNGLMLSTVMLENEIALNG--KEAVSAHLENVWKTMQACIEHGIHTE-----GILP
SDHL_MYCTU      ----------------------------------------------------------------------
SDHL_MYCBO      ----------------------------------------------------------------------
SDHM_ECOLI      ----SAADLQKHCQETGLSLSGLMMKNELALHS--KEELEQHLANVWEVMRGGIERG-----ISTEGVLP
TRUB_PROMS      -----------------------------KDKGCTSHDCVKQIRKLLNTKKVGHTGTLDPEVIGTLPIAI


                         .         .         *         .         .         .         .:140
query           GDAYKLKKYLEKGDTLTGNVMVGAMARALSCSEVNASMGRIVACPTAGSCGILPAVILTVGERLNLSDEE
SDHA_BACSU      GDAVKLQAYIRSGKSLSGPLILDAVSKAVATNEVNAAMGTICATPTAGSAGVVPGTLFAVKEKLNPTREQ
SDHA_PEPAS      GFAKRTYEYANSGKSIVGDFLAKAMAMAFSTSEVNASMGKIVAAPTAGSSGIMPAMLVAATEKYNFDRTT
SDHA_LACSK      ------------------DIMLEAVQNAIATNEVNASMGIICATPTAGSAGTLPGILSVITKQLSLDRDA
SDHL_HELPY      SIKTRLEKHPTSGDPLALIDYISLYARAIA--EENASGGKVVTAPTNGACAVVPSVLLYAKNHLNLSQKA
SDHL_HELPJ      SVKTRLEKHPTSGDPLALIDYISLYARSIA--EENASGGKVVTAPTNGACAVVPSVLSYAKNHLNLSQKS
SDHL_ECOLI      RRASALRRMLVSSDKLSNNVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYYDHFISVSPDI
TDCG_ECOLI      RRAVALRRQLVSSDNISNNVIDWINMYALAVSEENAAGGRVVTAPTNGACGIIPAVLAYYDKRRPVNERS
SDHL_STRCO      RAANTARKLRSEGDP-QALAMEWITLYAMAVNEENAAGGRVVTAPTNGAAGIIPAVLHYYMNFVPGADED
SDHL_HAEIN      GPAASLYRALQANTNLSNDVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIIPAVLAYYEKFISPLTPE
SDHL_MYCTU      ---------------------------ALAVNEENASGGRVVTAPTNGAAGIVPAVLHYAIHYTSAGDDV
SDHL_MYCBO      ---------------------------ALAVNEENASGGRVVTAPTNGAAGIVPAVLHYAIHYTSAGDDV
SDHM_ECOLI      GKXXXXXXXVSQDKTTTDPMAVVDWINALAVNEENAAGGRVVTAPTNGACGIIPAVLAYYDKFIEVNANS
TRUB_PROMS      GNATRFIQYLPQGKTYIGEIKLG-----------------------------------------------


                         +         .         .         .         .         *         .:210
query           LIQGLLASSAVGMIIAQNATLXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEMALDAGAIVFKNILGLVC
SDHA_BACSU      MIRFLFTAGAFGFVVXXXXXXXXXXXXCQAEVGSASGMAAAAIVEMAGGTPEQSAEAMAITLKNMLGLVC
SDHA_PEPAS      IQNGFLTSIGIGQVITKYATFXXXXXXXXXXXXXXXXXXXXXXXXXXXGTVEQALHAASITIINVLGLVC
SDHA_LACSK      QIRFLFCASAFGMVVANDAMIAGATGGCQXXXXXXXXXXXXXXXXXXXXTHQQSSEAFAMAMSNLLGLVC
SDHL_HELPY      INDFLLTSAAIGYLYKKNASLSGAEAGCQAEIGVASSMAAGGLAHLCQATTQQVLIASEIAMEHHLGLTC
SDHL_HELPJ      INDFLLTSAAIGYLYKKNASLSGAEAGCQAEIGVASSMAAGGLAHLCQATTQQVLIASEIAMEHHLGLTC
SDHL_ECOLI      YTRYFMAAGAIGALYKMNASISGAEVGCQGEVGVACSMXXXXXXXXXXXSPEQVCVAAEIGMEHNLGLTC
TDCG_ECOLI      IARYFLAAGAIGALYKMNASISGAEVGCQGEIGVACSMAAAGLTELLGGSPAQVCNAAEIAMEHNLGLTC
SDHL_STRCO      VVRFLLAAGAIGMLFKENASISGAEVGCQGEVGSACSMAAGALAEVLGGSPEQVENAAEIGMEHNLGLTC
SDHL_HAEIN      IIERLLAAGMIGSLYKMNASISGAEVGCQGEVGVACSMAAAGLAEILGGNPLQVCIAAEIAMEHNLGLTC
SDHL_MYCTU      TVRFLLTAGAIGSLFKERASISGAEVGCQXXXXXXXXXXXXXXXXXXXXTPRQVENAAEIAMEHSLGLTC
SDHL_MYCBO      TVRFLLTAGAIGSLFKERASISGAEVGCQXXXXXXXXXXXXXXXXXXXXTPRQVENAAEIAMEHSLGLTC
SDHM_ECOLI      LARYLLVASAIGSLYKMNASISGAEVGCQGEVGVACSMXXXXXXXXXXXSPAQVCIAAEIAMEHNLGLTC
TRUB_PROMS      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DPIAGLVEVPCAKRNFAGAVSALTTADLVMAGIHSKIPFDDTVEAMYRVGKSLPASLRETALGGLAITKT
SDHA_BACSU      DPVAGLVEVPCVKRNAMGASNAMIAADMALAGITSRIPCDEVIDAMYKIGQTMPTALRETGQGGLAATPT
SDHA_PEPAS      DPIAGLVQYPCTFRNASGVINAFISADLALAGVESLVPFDEVVIAMGEVGNSMIEALRETGLGGLAGSKT
SDHA_LACSK      DPVAGLVEVPCVKRNVIGSVNALTSADMALAGLVSKIPADEVISAMKSIGENLPSTLREXXXXXXXXXXX
SDHL_HELPY      DPVGGLVQIPCIERNVLGAIKAISASKLALEDEYKKVSLDEVIATMYATGKDMNEKYKETSLGGLAKT--
SDHL_HELPJ      DPVGGLVQIPCIERNVLGAIKAISASKLALEDEYKKVSLDEVIATMYATGKDMNEKYKETSLGGLAKT--
SDHL_ECOLI      DPVAGQVQVPCIERNAIASVKAINAARMALRRTSARVSLDKVIETMYETGKDMNAKYRETSRGGLAI---
TDCG_ECOLI      DPVAGQVQIPCIERXXXXXXXXXXXXRMAMRRTSARVSLDKVIETMYETGKDMNDKYRETSRGGLAI---
SDHL_STRCO      DPVGGLVQIPCIERNGXXXXXXXXXXXXXXXGDGSKVSLDKVIKTMKETGADMSVKYKETARGGLAV---
SDHL_HAEIN      DPVGGQVQVPCIERNAIASVKAINASRMALRTTNPRVTLDKVIETMYETGKDMNAKYRETSQGGLAV---
SDHL_MYCTU      DPIAGLVQIPCIERNAISAGKAINAARMALRGIH-RVTLDQVIDTMRATGADMHTKYKETSAGGLAI---
SDHL_MYCBO      DPIAGLVQIPCIERNAISAGKAINAARMALRGIH-RVTLDQVIDTMRATGADMHTKYKETSAGGLAI---
SDHM_ECOLI      DPVAGQVQVPCIEXXXXXXXXXXXXXXXXLRRTEPRVCLDKVIETMYETGKDMNAKYRETSRGGLAM---
TRUB_PROMS      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GLKLKEKVFGKDx
SDHA_BACSU      GRELEKKIFG---
SDHA_PEPAS      GQKIR--------
SDHA_LACSK      XXXXKMQIFGQD-
SDHL_HELPY      -------------
SDHL_HELPJ      -------------
SDHL_ECOLI      -------------
TDCG_ECOLI      -------------
SDHL_STRCO      -------------
SDHL_HAEIN      -------------
SDHL_MYCTU      -------------
SDHL_MYCBO      -------------
SDHM_ECOLI      -------------
TRUB_PROMS      -------------