[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB82333.1

[Show Plain Result]


## Summary of Sequence Search
    1::241
    3::229     2e-39  39%  235 aa  YBGA_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    9::235     5e-36  32%  243 aa  YVOA_BACSU RecName: Full=HTH-type transcriptional repressor yvoA;
   17::250     9e-33  33%  254 aa  DASR_STRAW RecName: Full=HTH-type transcriptional repressor dasR;
   16::249     1e-31  32%  253 aa  DASR_STRGR RecName: Full=HTH-type transcriptional repressor dasR;
   17::250     3e-31  32%  254 aa  DASR_STRCO RecName: Full=HTH-type transcriptional repressor dasR;
    1::237     1e-30  31%  242 aa  YURK_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    6::235     7e-27  27%  240 aa  MNGR_ECOLI RecName: Full=Mannosyl-D-glycerate transport/metabolism
   12::238     4e-26  27%  243 aa  FRLR_SHIFL RecName: Full=HTH-type transcriptional regulator frlR;
   12::238     6e-26  28%  243 aa  FRLR_ECO57 RecName: Full=HTH-type transcriptional regulator frlR;
   12::238     8e-26  27%  243 aa  FRLR_ECOLI RecName: Full=HTH-type transcriptional regulator frlR;
    2::225     4e-22  26%  238 aa  YIDP_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    8::236     5e-21  26%  239 aa  PHNR_SALCH RecName: Full=Putative transcriptional regulator of
    8::236     1e-20  26%  239 aa  PHNR_SALPA RecName: Full=Putative transcriptional regulator of
    8::236     2e-20  26%  239 aa  PHNR_SALTY RecName: Full=Putative transcriptional regulator of
    8::236     2e-20  26%  239 aa  PHNR_SALTI RecName: Full=Putative transcriptional regulator of
    4::233     9e-17  27%  237 aa  GMUR_BACSU RecName: Full=HTH-type transcriptional regulator
   24::248     1e-16  25%  248 aa  YEGW_SHIFL RecName: Full=Uncharacterized HTH-type transcriptional
   24::248     1e-16  25%  248 aa  YEGW_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   24::248     1e-16  25%  248 aa  YEGW_ECOL6 RecName: Full=Uncharacterized HTH-type transcriptional
   24::248     1e-16  25%  248 aa  YEGW_ECO57 RecName: Full=Uncharacterized HTH-type transcriptional
   10::237     2e-16  24%  241 aa  YMFC_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   10::235     8e-16  27%  244 aa  PHNF_MYCS2 RecName: Full=HTH-type transcriptional repressor phnF;
    2::80      1e-15  41%  364 aa  ARAR_BACST RecName: Full=Arabinose metabolism transcriptional
   12::230     1e-15  25%  238 aa  TRER_BACSU RecName: Full=Trehalose operon transcriptional
   22::224     1e-14  26%  250 aa  HUTC_PSEAE RecName: Full=Histidine utilization repressor;
   20::228     3e-14  25%  248 aa  HUTC_PSEPU RecName: Full=Histidine utilization repressor;
    7::233     1e-13  23%  241 aa  HUTC_KLEAE RecName: Full=Histidine utilization repressor;
    5::76      9e-12  40%  362 aa  ARAR_BACSU RecName: Full=Arabinose metabolism transcriptional
    4::140     1e-11  27%  236 aa  YYDK_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   33::239     2e-11  21%  241 aa  PHNF_ECOLI RecName: Full=Probable transcriptional regulator phnF;
    3::101     5e-10  38%  254 aa  PDHR_SALTY RecName: Full=Pyruvate dehydrogenase complex repressor;
    3::101     5e-10  38%  254 aa  PDHR_SALTI RecName: Full=Pyruvate dehydrogenase complex repressor;
    7::164     6e-10  23%  244 aa  Y6150_RHIME RecName: Full=Uncharacterized HTH-type transcriptional
    3::80      1e-09  37%  254 aa  PDHR_ECOLI RecName: Full=Pyruvate dehydrogenase complex
    3::80      1e-09  37%  254 aa  PDHR_ECOL6 RecName: Full=Pyruvate dehydrogenase complex
    3::80      1e-09  37%  254 aa  PDHR_ECO57 RecName: Full=Pyruvate dehydrogenase complex
    9::72      7e-09  45%  259 aa  EXUR_ERWCH RecName: Full=Exu regulon transcriptional regulator;
    5::70      3e-08  38%  375 aa  ARAR_BACHD RecName: Full=Arabinose metabolism transcriptional
   19::208     8e-08  27%  236 aa  YIHL_SHIFL RecName: Full=Uncharacterized HTH-type transcriptional
   19::208     8e-08  27%  236 aa  YIHL_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   19::208     8e-08  27%  236 aa  YIHL_ECO57 RecName: Full=Uncharacterized HTH-type transcriptional
    9::72      8e-08  42%  258 aa  EXUR_SHIFL RecName: Full=Exu regulon transcriptional regulator;
    9::72      8e-08  42%  258 aa  EXUR_ECOLI RecName: Full=Exu regulon transcriptional regulator;
    9::72      8e-08  42%  258 aa  EXUR_ECO57 RecName: Full=Exu regulon transcriptional regulator;
   18::88      2e-07  34%  233 aa  YCBG_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   12::98      2e-07  35%  130 aa  YTRA_BACSU RecName: Full=HTH-type transcriptional repressor ytrA;
   23::96      2e-07  41%  263 aa  NANR_SHISS RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_SHIFL RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_SHIDS RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_SHIBS RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOUT RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOSE RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOLU RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOLI RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOLC RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOL6 RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOL5 RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOK1 RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECODH RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECOBW RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECO8A RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECO81 RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECO7I RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECO57 RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECO55 RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECO45 RecName: Full=Transcriptional regulator nanR;
   23::96      2e-07  41%  263 aa  NANR_ECO27 RecName: Full=Transcriptional regulator nanR;
   11::104     3e-07  36%  121 aa  YHCF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    4::59      3e-07  38%  444 aa  YCXD_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   32::96      7e-07  38%  263 aa  NANR_SALTY RecName: Full=Transcriptional regulator nanR;
   32::96      7e-07  38%  263 aa  NANR_SALTI RecName: Full=Transcriptional regulator nanR;
   32::96      7e-07  38%  263 aa  NANR_SALPK RecName: Full=Transcriptional regulator nanR;
   32::96      7e-07  38%  263 aa  NANR_SALPC RecName: Full=Transcriptional regulator nanR;
   32::96      7e-07  38%  263 aa  NANR_SALPA RecName: Full=Transcriptional regulator nanR;
   32::96      7e-07  38%  263 aa  NANR_SALG2 RecName: Full=Transcriptional regulator nanR;
   32::96      7e-07  38%  263 aa  NANR_SALEP RecName: Full=Transcriptional regulator nanR;
   32::96      7e-07  38%  263 aa  NANR_SALCH RecName: Full=Transcriptional regulator nanR;
   32::96      7e-07  38%  263 aa  NANR_SALAR RecName: Full=Transcriptional regulator nanR;
    1::53      1e-06  40%  219 aa  LUTR_BACSU RecName: Full=HTH-type transcriptional regulator
    2::44      7e-06  42%  442 aa  NORG_STAAB RecName: Full=HTH-type transcriptional regulator norG;
    2::71      7e-06  39%  258 aa  LLDR_SHIFL RecName: Full=Putative L-lactate dehydrogenase operon
    2::71      7e-06  39%  258 aa  LLDR_ECOLI RecName: Full=Putative L-lactate dehydrogenase operon
   10::77      1e-05  34%  484 aa  YISV_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   22::82      1e-05  31%  242 aa  Y505_MYCBO RecName: Full=Uncharacterized HTH-type transcriptional
   22::82      1e-05  31%  242 aa  Y494_MYCTU RecName: Full=Uncharacterized HTH-type transcriptional
    2::44      1e-05  42%  442 aa  NORG_STAAC RecName: Full=HTH-type transcriptional regulator norG;
    2::44      1e-05  42%  442 aa  NORG_STAA8 RecName: Full=HTH-type transcriptional regulator norG;
    2::44      1e-05  42%  442 aa  NORG_STAA3 RecName: Full=HTH-type transcriptional regulator norG;
    9::74      1e-05  36%  241 aa  KORA_STRLI RecName: Full=Protein korA;
    9::77      2e-05  32%  463 aa  YDEL_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   16::79      2e-05  34%  479 aa  GABR_BACSU RecName: Full=HTH-type transcriptional regulatory
   13::107     2e-05  31%  279 aa  FADR_VIBVY RecName: Full=Fatty acid metabolism regulator protein;
   13::107     2e-05  31%  279 aa  FADR_VIBVU RecName: Full=Fatty acid metabolism regulator protein;
   13::107     2e-05  31%  279 aa  FADR_VIBPA RecName: Full=Fatty acid metabolism regulator protein;
    7::77      2e-05  30%  482 aa  YDFD_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   20::85      2e-05  35%  453 aa  PDXR_CORGL RecName: Full=HTH-type pyridoxine biosynthesis
   13::72      2e-05  37%  279 aa  FADR_VIBCM RecName: Full=Fatty acid metabolism regulator protein;
   13::72      2e-05  37%  279 aa  FADR_VIBCH RecName: Full=Fatty acid metabolism regulator protein;
   13::72      2e-05  37%  279 aa  FADR_VIBC3 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      2e-05  37%  239 aa  FADR_PHOLL RecName: Full=Fatty acid metabolism regulator protein;
    2::44      3e-05  40%  442 aa  NORG_STAAN RecName: Full=HTH-type transcriptional regulator norG;
    2::44      3e-05  40%  442 aa  NORG_STAAM RecName: Full=HTH-type transcriptional regulator norG;
   14::98      4e-05  38%  230 aa  YIEP_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   11::73      4e-05  33%  257 aa  UXUR_ECOLI RecName: Full=Uxu operon transcriptional regulator;
   25::76      8e-05  33%  456 aa  Y3073_RHOS4 RecName: Full=Uncharacterized HTH-type
    4::97      8e-05  36%  251 aa  LACR_STAES RecName: Full=Lactose phosphotransferase system
    4::97      8e-05  36%  251 aa  LACR_STAEQ RecName: Full=Lactose phosphotransferase system
   13::72      8e-05  37%  239 aa  FADR_PECCP RecName: Full=Fatty acid metabolism regulator protein;
   18::77      8e-05  33%  241 aa  FADR_PASMU RecName: Full=Fatty acid metabolism regulator protein;
   13::72      8e-05  37%  239 aa  FADR_ERWCT RecName: Full=Fatty acid metabolism regulator protein;
   13::72      8e-05  37%  239 aa  FADR_EDWI9 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERPY RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERPS RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERPP RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERPN RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERPG RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERPE RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERPB RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERPA RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_YERP3 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_KLEP7 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_KLEP3 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  238 aa  FADR_ERWT9 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ENTS8 RecName: Full=Fatty acid metabolism regulator protein;
  431::562     1e-04  29% 3210 aa  CENPF_HUMAN RecName: Full=Centromere protein F;AltName:
  534::629     1e-04  34%  803 aa  RASL2_HUMAN RecName: Full=Ras GTPase-activating protein 4;AltName:
   23::103     1e-04  36%  251 aa  IOLR_BACSU RecName: Full=HTH-type transcriptional regulator iolR;
   13::72      1e-04  35%  239 aa  FADR_YERE8 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SHISS RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SHIFL RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SHIDS RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SHIBS RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SHIB3 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SERP5 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALTY RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALSV RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALPK RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALPC RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALPB RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALPA RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALNS RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALHS RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALG2 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALEP RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALDC RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALAR RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_SALA4 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  33%  239 aa  FADR_PROMH RecName: Full=Fatty acid metabolism regulator protein;
   36::123     1e-04  35%  241 aa  FADR_HAEIN RecName: Full=Fatty acid metabolism regulator protein;
   36::123     1e-04  35%  241 aa  FADR_HAEIG RecName: Full=Fatty acid metabolism regulator protein;
   36::123     1e-04  35%  241 aa  FADR_HAEIE RecName: Full=Fatty acid metabolism regulator protein;
   36::123     1e-04  35%  241 aa  FADR_HAEI8 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ESCF3 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ENT38 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOUT RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOSM RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOSE RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOLU RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOLI RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOLC RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOL6 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOL5 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOK1 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOHS RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECODH RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECOBW RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO8A RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO81 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO7I RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO5E RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO57 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO55 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO45 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO27 RecName: Full=Fatty acid metabolism regulator protein;
   13::72      1e-04  35%  239 aa  FADR_ECO24 RecName: Full=Fatty acid metabolism regulator protein;
   37::88      2e-04  35%  266 aa  UXUR_HAEIN RecName: Full=Uxu operon regulator;
   20::71      2e-04  31%  229 aa  DGOR_ECOLI RecName: Full=Galactonate operon transcriptional
    6::76      3e-04  30%  493 aa  MOCR_RHIME RecName: Full=Probable rhizopine catabolism regulatory
   31::72      3e-04  43%  241 aa  FADR_SHESR RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  241 aa  FADR_SHESM RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  241 aa  FADR_SHESA RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  238 aa  FADR_SHEPC RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  239 aa  FADR_SHEPA RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  240 aa  FADR_SHEON RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  239 aa  FADR_SHEHH RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  239 aa  FADR_SHEFN RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  239 aa  FADR_SHEDO RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  238 aa  FADR_SHEB9 RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  238 aa  FADR_SHEB8 RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  238 aa  FADR_SHEB5 RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  238 aa  FADR_SHEB2 RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  240 aa  FADR_SHEAM RecName: Full=Fatty acid metabolism regulator protein;
   31::72      3e-04  43%  239 aa  FADR_SALTI RecName: Full=Fatty acid metabolism regulator protein;
    2::52      4e-04  39%  304 aa  YJJM_ECOLI RecName: Full=Uncharacterized protein yjjM;
   19::72      4e-04  33%  254 aa  GLCC_ECOLI RecName: Full=Glc operon transcriptional activator;
   19::72      4e-04  33%  254 aa  GLCC_ECOL6 RecName: Full=Glc operon transcriptional activator;
  324::387     7e-04  34%  859 aa  SYF1_YEAST RecName: Full=Pre-mRNA-splicing factor SYF1;AltName:
   24::88      9e-04  32%  462 aa  YDEF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    8::58      9e-04  37%  240 aa  Y601_MYCBO RecName: Full=Uncharacterized HTH-type transcriptional
    8::58      9e-04  37%  240 aa  Y586_MYCTU RecName: Full=Uncharacterized HTH-type transcriptional
    1::241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKRSRGIALYHQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERKEYVYKVHGKG
YBGA_BACSU      --------ALYSVIKFKIIELIKSGKYQANDQLPTESEFCEQYDVSRTTVRLALQQLELEGYIKRIQGKG
YVOA_BACSU      -------IPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRG
DASR_STRAW      ---RTARVPKYYRLKKHLLDMTET--LPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKG
DASR_STRGR      ---RAQRVPKYYRLKRHLLDMTDT--LPPGTPVPPERTLAAEFDTSRTTVPQALQELVVEGRLERIQGKG
DASR_STRCO      ---RTARVPKYYRLKKHLLDMTRTQT--PGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKG
YURK_BACSU      MLNNGSSTPLYIQLKQIITDDIKKGVYSPTAKLPTENELCTKYNVSRITVRKAILDLVEEGYLIRQQGKG
MNGR_ECOLI      ---------LYRQIADRIREQIARGELKPGDALPTESALQTEFGVSRVTVRQALRQLVEQQILESIQGSG
FRLR_SHIFL      ---------LYATVRQRLLDDIAQGVYQAGQQIPTENELCTQYNVSRITIRKAISDLVADGVLIRWQGKG
FRLR_ECO57      ---------LYATVRQRLLDDIAQGVYQAGQQIPTENELCTQYNVSRITIRKAISDLVADGVLIRWQGKG
FRLR_ECOLI      ---------LYATVRQRLLDDIAQGVYQAGQQIPTENELCTQYNVSRITIRKAISDLVADGVLIRWQGKG
YIDP_ECOLI      ---------IYKSIAERLRIRLNSADFTLNSLLPGEKKLAEEFAVSRMTIRKAIDLLVAWGLVVRRHGSG
PHNR_SALCH      -------IPQYLLIKAQLQERIQSGALKSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRG
PHNR_SALPA      -------IPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRG
PHNR_SALTY      -------IPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRG
PHNR_SALTI      -------IPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRG
GMUR_BACSU      ----------YEIIANEMRNRIKNNVYPIDQPIPDEVSLAKEFNSSRMTMKRALDNLVAEGLLFRKRGHG
YEGW_SHIFL      ---------LYIKFAETVKNAVRSGVLEHGNILPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYG
YEGW_ECOLI      ---------LYIKFAETVKNAVRSGVLEHGNILPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYG
YEGW_ECOL6      ---------LYIKFAETVKNAVRSGVLEHGNILPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYG
YEGW_ECO57      ---------LYIKFAETVKNAVRSGVLEHGNILPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYG
YMFC_BACSU      ---------LYLKVIERIKEDIKNGIYTEKEKLPSEFELSKKLGVSRATLREALRILEEEHVIIRRHGVG
PHNF_MYCS2      ---------LKHQVVRAELDRMLDG-MRIGDPFPAEREIAEQFEVARETVRQALRELLIDXXXXXXXXXX
ARAR_BACST      ---KEKTLPKYLQLKQEILSWIISGQMKPDEKIPTEHEIANQFQLSRHTVRQALGELEKEGWLYKIQGSG
TRER_BACSU      ----------------DIAQQIEGGRWKAEEILPSEHELTAQYGTSRETVRKALHMLAQNGYIQKIRGKG
HUTC_PSEAE      ---------LYARVKQMIVSQIQSGAWPPHHRVPSESELVSQLGFSRMTINRALRELTSDGLLVRMQGVG
HUTC_PSEPU      ---------LYARVKQMIIQQIDNGSWPPHHRVPSESELVNELGFSRMTINRALRELTADGLLVRMQGVG
HUTC_KLEAE      ---RSAPAPFYEKVKQAISEKIHSGVWRPHDRIPSEAELVAQFGFSRMTINRALRELTDEGLLVRLQGVG
ARAR_BACSU      ----------YAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGG
YYDK_BACSU      ----------YQQIATEIETYIEEHQLQQGDKLPVLETLMAQFEVSKSTITKSLELLEQKGAIFQVRGSG
PHNF_ECOLI      ------------------------------DYLPAEQQLAARFEVNRHTLRRAIDQLVEKGWVQRRQGVG
PDHR_SALTY      -YSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGG
PDHR_SALTI      -YSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGG
Y6150_RHIME     --ERQMGVALWRQIADRIRLAISNGDYDATGMVPPETALAAEFGVNRHTVRSALAALAEEGLVRAVQGRG
PDHR_ECOLI      -YSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGG
PDHR_ECOL6      -YSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGG
PDHR_ECO57      -YSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGG
EXUR_ERWCH      ---------LYQQLAAELKQRIENGVYPVGDKLPAERNISEEMNVSRTVVREAIIMLEVEGYVEVRKGSG
ARAR_BACHD      ----------YNFVKQQIKSKILEGIVLPHGKIGSENELMKEYNVSRHTVRKAIDELVNEGWVYRKQGAG
YIHL_SHIFL      ---------------------LKDGITTPGGKLPSERELGELLGIKRMTLRQALLNLEAESKIFRKDRKG
YIHL_ECOLI      ---------------------LKDGITTPGGKLPSERELGELLGIKRMTLRQALLNLEAESKIFRKDRKG
YIHL_ECO57      ---------------------LKDGITTPGGKLPSERELGELLGIKRMTLRQALLNLEAESKIFRKDRKG
EXUR_SHIFL      ---------LYQQLAADLKERIEQGVYLVGDKLPAERFIADEKNVSRTVVREAIIMLEVEGYVEVRKGSG
EXUR_ECOLI      ---------LYQQLAADLKERIEQGVYLVGDKLPAERFIADEKNVSRTVVREAIIMLEVEGYVEVRKGSG
EXUR_ECO57      ---------LYQQLAADLKERIEQGVYLVGDKLPAERFIADEKNVSRTVVREAIIMLEVEGYVEVRKGSG
YCBG_BACSU      ---------LAKQVIERIVHLLSSGQLRAGDKLPTEMELMDILHVSRPVLREALSSLETLGVITRKTRGG
YTRA_BACSU      ---------IYEQIIQQMKELCLKGIMKPGDKLPSVRELATIIIANPNTVSKAYKELEREGIIETLRGRG
NANR_SHISS      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SHIFL      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SHIDS      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SHIBS      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOUT      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOSE      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOLU      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOLI      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOLC      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOL6      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOL5      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOK1      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECODH      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECOBW      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECO8A      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECO81      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECO7I      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECO57      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECO55      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECO45      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_ECO27      ---RSRPLALSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
YHCF_BACSU      ---------IYLQIADQIFYRLVRKELLPGDKLPSVREMAIQTKVNPNTIQRTYSEMERLGIVETRRGQG
YCXD_BACSU      ----------YMSLLTRIEEMMQSTSYQEGDRLPSIRQLSARYQVSKSTVIRALQELEKRHLIYSV----
NANR_SALTY      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SALTI      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SALPK      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SALPC      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SALPA      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SALG2      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SALEP      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SALCH      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
NANR_SALAR      ---------LSEMVEEELEQMIRRHEFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGER
LUTR_BACSU      --------------------MIKNGELKPGDKLDSVQALAESFQVSRSAVREALSALKAMGLVEMKQGEG
NORG_STAAB      -------------------------------KIPSQRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSG
LLDR_SHIFL      -------IVLPRRLSDEVADLIDEKNLEAGMKLPAERQLAMQLGVSRNSLREALAKLVSEGVLLSRRGGG
LLDR_ECOLI      -------IVLPRRLSDEVADLIDEKNLEAGMKLPAERQLAMQLGVSRNSLREALAKLVSEGVLLSRRGGG
YISV_BACSU      ---RKSDVPLHRQIEQYMKDKILHGEWAVGTKIPSQRTLADMFQVNRSTVTAAIDELTSQGLLEGRKGGG
Y505_MYCBO      ------------RIATTIADAILDGVFPPGSTLPPERDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSG
Y494_MYCTU      ------------RIATTIADAILDGVFPPGSTLPPERDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSG
NORG_STAAC      -------------------------------KIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSG
NORG_STAA8      -------------------------------KIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSG
NORG_STAA3      -------------------------------KIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSG
KORA_STRLI      ----------YLQVVAALKAKIVSGELKHGDTLPSVRDLAAQYEISTATAQKVHRTLKAEGLAEAKQGSA
YDEL_BACSU      ---RTLDIPLYQQLYRYFKENMHRGRIQKGMKLPSKRLLANQLSISQTTVERAYEQLAAEGYIVSKPRSG
GABR_BACSU      ---------IYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKG
FADR_VIBVY      --------------EKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_VIBVU      --------------EKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_VIBPA      --------------EKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
YDFD_BACSU      --KKMKKLPKYRQIVHFIKEKIGNGEWPIGSKIPSQRTLAKDFQVNRSTVITALEELMADGLIEGTMGKG
PDXR_CORGL      ------------QLTEQIRRLVARGILTPGDPLPSSRSLSTQLGVSRGSVVTAYDQLAGEGYLSTARGSG
FADR_VIBCM      --------------EKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_VIBCH      --------------EKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_VIBC3      --------------EKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_PHOLL      --------------EEYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
NORG_STAAN      -------------------------------KIPPQRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSG
NORG_STAAM      -------------------------------KIPPQRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSG
YIEP_ECOLI      ---------LSYVLAEKLAQRILKGEYEPGTILPGEIELGEQFGVSRTAVREAVKTLTAKGMVLPRPRIG
UXUR_ECOLI      ----------YQEVGAMIRDLIIKTPYNPGERLPPEREIAEMLDVTRTVVREALIMLEIKGLVEVRRGAG
Y3073_RHOS4     ---------------------IRAGRVTPGERLPPQRAIAEALGVDLTTVTRALNEAQRRGLVSAQVGRG
LACR_STAES      ----------YDRLD-EITKLVNKGSVRTN-------EIVEDLNVSDMTVRRDLAELEEKGVLTKIHGGA
LACR_STAEQ      ----------YDRLD-EITKLVNKGSVRTN-------EIVEDLNVSDMTVRRDLAELEEKGVLTKIHGGA
FADR_PECCP      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_PASMU      --------------EEYIVRSIWNNHFPPGSDLPAERELAEKIGVTRTTLREVLQRLARDGWLNIQHGKP
FADR_ERWCT      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_EDWI9      --------------EEYLIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIRHGKP
FADR_YERPY      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_YERPS      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_YERPP      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_YERPN      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_YERPG      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_YERPE      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_YERPB      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_YERPA      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_YERP3      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_KLEP7      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_KLEP3      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ERWT9      --------------EEYIIESIWNSRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ENTS8      --------------EEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
CENPF_HUMAN     ---------MHNVLQAELDKLTSVKQQLENNLEEFKQKLCQASQIKENELRRSMEEMKKENNLLKSHSEQ
RASL2_HUMAN     -----QGVAQLKDFITKLVDI------EEKDEL----------DLQRTLSLQAPPVKEGPLFIHRTKGKG
IOLR_BACSU      -------------------------------------ELCQVFNVSKNTVRRDINKLTEKGAIEKVYGGV
FADR_YERE8      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SHISS      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SHIFL      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SHIDS      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SHIBS      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SHIB3      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SERP5      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALTY      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALSV      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALPK      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALPC      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALPB      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALPA      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALNS      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALHS      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALG2      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALEP      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALDC      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALAR      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALA4      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_PROMH      --------------EEYIVESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_HAEIN      --------------------------------LPSERDLADKIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_HAEIG      --------------------------------LPSERDLADKIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_HAEIE      --------------------------------LPSERDLADKIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_HAEI8      --------------------------------LPSERDLADKIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ESCF3      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ENT38      --------------EEYIIESIWNNRFAPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOUT      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOSM      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOSE      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOLU      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOLI      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOLC      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOL6      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOL5      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOK1      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOHS      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECODH      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECOBW      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO8A      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO81      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO7I      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO5E      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO57      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO55      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO45      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO27      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_ECO24      --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
UXUR_HAEIN      ---------------------ISQGIYSIGDKLPTEREISEKFGVSRTIVREAXXXXXXXXXXXXXXGSG
DGOR_ECOLI      ------------------------GKYVPGSPLPAEAELCEEFATSRNIIREVFRSLMAKRLIEMKRYRG
MOCR_RHIME      ---RDADVPMHRQLYEKLRAEILAGHLKADTRLPPTRMMAEDLGVSRNTVITTYDALLAEGYLESRSGSG
FADR_SHESR      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHESM      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHESA      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEPC      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEPA      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SHEON      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEHH      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SHEFN      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEDO      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEB9      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEB8      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEB5      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEB2      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKP
FADR_SHEAM      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
FADR_SALTI      --------------------------------LPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
YJJM_ECOLI      ----SRSQNLRHNVINQVIDDMARGHIPS--PLPSQSALAEMYNISRTTVRHILSHL-------------
GLCC_ECOLI      --------------------LIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRD
GLCC_ECOL6      --------------------LIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRD
SYF1_YEAST      ----------------------------------------------------------------------
YDEF_BACSU      ---------IYKALAGQLEQDILNGVLLPGTKLPPQRELADYLDLNVSTISKAFKVCELKGLLSATVGSG
Y601_MYCBO      --RRSVPEEVFEQIATDVL----TGEMPPGEALPSERRLAELLGVSRPAVREALKRL-------------
Y586_MYCTU      --RRSVPEEVFEQIATDVL----TGEMPPGEALPSERRLAELLGVSRPAVREALKRL-------------


                         .         .         *         .         .         .         .:140
query           TFISPKVYKQQLLKFYSFTEEMKKLGKNPSSKILSFDLIRADNKISEKLKVEENSLVYKIVRLRIADEVP
YBGA_BACSU      TFVSAKIQTPIPHKITSFAEQMR--GLRSESKVLELVVIPADHSIAELLKMKENEPVNKLVRVRYAEGEP
YVOA_BACSU      TFVSKPKMEQALQGLTSFTEDMKSRGMTPGSRLIDYQLIDSTEELAAILGCGHPSSIHKITRVRLANDIP
DASR_STRAW      TFVAPKV--SQALQLTSYTEDMRAQGLEPTSQLLDIGYITADDTLAGLLDITAGGRVLRIERLRLASGEP
DASR_STRGR      TFVAPKV--SQALQLTSYTEDMRAQGLEPTSQLLDIGYVTADDTLAGLLDISTGGRVLRIERLRLASGEP
DASR_STRCO      TFVAPKV--SQALQLTSYTEDMRAQGLEPTSQLLDIGYITADDRLAGLLDITAGGRVLRIERLRMANGEP
YURK_BACSU      TFVKSPKLKRELIAVNGYSEFMESTGKKPKHHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQP
MNGR_ECOLI      TYVKEERVNYDIFQLTSFDEKLSDRHVDTHSEVLIFEVIPADDFLQQQLQITPQDRVWHVKRVRYRKQKP
FRLR_SHIFL      TFVQSQKVENALLTVSGFTDFGVSQGKSTKEKVIEQERVSA-APFCEKLNIPGNSEVFHLCRVMYLDKEP
FRLR_ECO57      TFVQSQKVENALLTVSGFTDFGVSQGKATKEKVIEQERISA-APFCEKLNIPGNSEVFHLCRVMYLDKEP
FRLR_ECOLI      TFVQSQKVENALLTVSGFTDFGVSQGKATKEKVIEQERVSA-APFCEKLNIPGNSEVFHLCRVMYLDKEP
YIDP_ECOLI      TYLVRKDVLHQTASLTGLVEVLKRQGKTVTSQVLIFEIMPAPPAIASQLRIQINEQIYFSRRVRFVEGKP
PHNR_SALCH      WFVTPERLWLDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMESLQLQPFDQIYLLTRLRYADGRA
PHNR_SALPA      WFVTPERLWLDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRA
PHNR_SALTY      WFVTPERLWLDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRA
PHNR_SALTI      WFVTPERLWLDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRA
GMUR_BACSU      TFIIQSAIQDDHVHVVSLTNLLKD--KKIKSKVIQFEVQFPTEEVAAHLSIDQKTPVYYVVRLRIVEGEP
YEGW_SHIFL      TQIN-NIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEA
YEGW_ECOLI      TQIN-NIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEA
YEGW_ECOL6      TQIN-NIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEA
YEGW_ECO57      TQIN-NIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEA
YMFC_BACSU      TFVHSKLFLSGIEQLNSVTKMIEQANMTPGTIFLSSQVLMPSEDDTKRFHLAEGQELFYLERVRTADGQP
PHNF_MYCS2      XXXXPKI--RQPLGMGSYTEAAKAQGLSAGRILVAWSDLTADEXXXXXXXXXXXXXXXQLERVLTTDGVR
ARAR_BACST      TFVSRPKPKEQV----------------------------------------------------------
TRER_BACSU      SVVLNREKMQPVSGLVSFKELAQTLGKETKTTVHKFGLEPPSELIQKQLRANLDDDIWEVIRSRKIDGEH
HUTC_PSEAE      TFVAEPKGQSALFEVHNIADEIAARGHRHRCQVITLGEEVAGPERALALDVREGQRVFHSLIVHYENDIP
HUTC_PSEPU      TFVAEPKGRSALFEVNNIADEIAARGHQHSCQVITLTEEAAGSERALALDMREGQRVFHSLIVHFENGVP
HUTC_KLEAE      TFVAEPKGQSALFEVRSIAAEIVARHHQHRCEVLLLEETRADHIQATALSVPEGTRIFHSLMVHYENEVP
ARAR_BACSU      TFVASRSAKSAL----------------------------------------------------------
YYDK_BACSU      IFVRKHKRKGSLLSNQGFKKDLEDF--NVTSKVIELDVRKPTPEAAENLNIGMDEDIYYVKRVRYINGQT
PHNF_ECOLI      VLVLMRPFDYPLNAQARFSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVA
PDHR_SALTY      TFVQSSLWQ-------SFSDPLELLSDHPESQ---FDLL-------------------------------
PDHR_SALTI      TFVQSSLWQ-------SFSDPLELLSDHPESQ---FDLL-------------------------------
Y6150_RHIME     TMIERKRVSYPISRRTRFSQGLGRQVREIGTELLGHAQVPASGEIATALGVPPGTPLIELSTVSSGDGRP
PDHR_ECOLI      TFVQSSLWQ-------------------------------------------------------------
PDHR_ECOL6      TFVQSSLWQ-------------------------------------------------------------
PDHR_ECO57      TFVQSSLWQ-------------------------------------------------------------
EXUR_ERWCH      IHV-------------------------------------------------------------------
ARAR_BACHD      TFCADR----------------------------------------------------------------
YIHL_SHIFL      WFVTQPRFNYSPELSASFQRAAIEQGREPSEKNRTSDI---PETLAPLIAVTPSTELYRITGWGALEGHK
YIHL_ECOLI      WFVTQPRFNYSPELSASFQRAAIEQGREPSEKNRTSDI---PETLAPLIAVTPSTELYRITGWGALEGHK
YIHL_ECO57      WFVTQPRFNYSPELSASFQRAAIEQGREPSEKNRTSDI---PETLAPLIAVTPSTELYRITGWGALEGHK
EXUR_SHIFL      IHV-------------------------------------------------------------------
EXUR_ECOLI      IHV-------------------------------------------------------------------
EXUR_ECO57      IHV-------------------------------------------------------------------
YCBG_BACSU      TYFNDKIGMQ------------------------------------------------------------
YTRA_BACSU      TYISENA-KTTLVKMTMIKEQLKQL---------------------------------------------
NANR_SHISS      ARVS------------------------------------------------------------------
NANR_SHIFL      ARVS------------------------------------------------------------------
NANR_SHIDS      ARVS------------------------------------------------------------------
NANR_SHIBS      ARVS------------------------------------------------------------------
NANR_ECOUT      ARVS------------------------------------------------------------------
NANR_ECOSE      ARVS------------------------------------------------------------------
NANR_ECOLU      ARVS------------------------------------------------------------------
NANR_ECOLI      ARVS------------------------------------------------------------------
NANR_ECOLC      ARVS------------------------------------------------------------------
NANR_ECOL6      ARVS------------------------------------------------------------------
NANR_ECOL5      ARVS------------------------------------------------------------------
NANR_ECOK1      ARVS------------------------------------------------------------------
NANR_ECODH      ARVS------------------------------------------------------------------
NANR_ECOBW      ARVS------------------------------------------------------------------
NANR_ECO8A      ARVS------------------------------------------------------------------
NANR_ECO81      ARVS------------------------------------------------------------------
NANR_ECO7I      ARVS------------------------------------------------------------------
NANR_ECO57      ARVS------------------------------------------------------------------
NANR_ECO55      ARVS------------------------------------------------------------------
NANR_ECO45      ARVS------------------------------------------------------------------
NANR_ECO27      ARVS------------------------------------------------------------------
YHCF_BACSU      TFIAEKAEIVDELKLEGFVKQMKELG--------------------------------------------
YCXD_BACSU      ----------------------------------------------------------------------
NANR_SALTY      ARVS------------------------------------------------------------------
NANR_SALTI      ARVS------------------------------------------------------------------
NANR_SALPK      ARVS------------------------------------------------------------------
NANR_SALPC      ARVS------------------------------------------------------------------
NANR_SALPA      ARVS------------------------------------------------------------------
NANR_SALG2      ARVS------------------------------------------------------------------
NANR_SALEP      ARVS------------------------------------------------------------------
NANR_SALCH      ARVS------------------------------------------------------------------
NANR_SALAR      ARVS------------------------------------------------------------------
LUTR_BACSU      TYL-------------------------------------------------------------------
NORG_STAAB      TYVN------------------------------------------------------------------
LLDR_SHIFL      TFI-------------------------------------------------------------------
LLDR_ECOLI      TFI-------------------------------------------------------------------
YISV_BACSU      T---------------------------------------------------------------------
Y505_MYCBO      SVV-------------------------------------------------------------------
Y494_MYCTU      SVV-------------------------------------------------------------------
NORG_STAAC      TYVN------------------------------------------------------------------
NORG_STAA8      TYVN------------------------------------------------------------------
NORG_STAA3      TYVN------------------------------------------------------------------
KORA_STRLI      TTVSTR----------------------------------------------------------------
YDEL_BACSU      WF--------------------------------------------------------------------
GABR_BACSU      FFV-------------------------------------------------------------------
FADR_VIBVY      TKVN---------------QFMETSGLHILDTLMTLDVDNATNIVEDLLAARTN----------------
FADR_VIBVU      TKVN---------------QFMETSGLHILDTLMTLDVDNATNIVEDLLAARTN----------------
FADR_VIBPA      TKVN---------------QFMETSGLHILDTLMTLDVDNATNIVEDLLAARTN----------------
YDFD_BACSU      TVV-------------------------------------------------------------------
PDXR_CORGL      TTINPDLH--------------------------------------------------------------
FADR_VIBCM      TKVN------------------------------------------------------------------
FADR_VIBCH      TKVN------------------------------------------------------------------
FADR_VIBC3      TKVN------------------------------------------------------------------
FADR_PHOLL      TKVN------------------------------------------------------------------
NORG_STAAN      TYVN------------------------------------------------------------------
NORG_STAAM      TYVN------------------------------------------------------------------
YIEP_ECOLI      TRVMPQFLDQELLTWW-MTEE-------------------------------------------------
UXUR_ECOLI      IYV-------------------------------------------------------------------
Y3073_RHOS4     TFV-------------------------------------------------------------------
LACR_STAES      RSNSAFQYKEHQEKHTRFIEEKRFIAKNAVDLIEDGDTI-------------------------------
LACR_STAEQ      RSNSAFQYKEHQEKHTRFIEEKRFIAKNAVDLIEDGDTI-------------------------------
FADR_PECCP      TKIN------------------------------------------------------------------
FADR_PASMU      TKVN------------------------------------------------------------------
FADR_ERWCT      TKIN------------------------------------------------------------------
FADR_EDWI9      TQVN------------------------------------------------------------------
FADR_YERPY      TKVN------------------------------------------------------------------
FADR_YERPS      TKVN------------------------------------------------------------------
FADR_YERPP      TKVN------------------------------------------------------------------
FADR_YERPN      TKVN------------------------------------------------------------------
FADR_YERPG      TKVN------------------------------------------------------------------
FADR_YERPE      TKVN------------------------------------------------------------------
FADR_YERPB      TKVN------------------------------------------------------------------
FADR_YERPA      TKVN------------------------------------------------------------------
FADR_YERP3      TKVN------------------------------------------------------------------
FADR_KLEP7      TKVN------------------------------------------------------------------
FADR_KLEP3      TKVN------------------------------------------------------------------
FADR_ERWT9      TKVN------------------------------------------------------------------
FADR_ENTS8      TKVN------------------------------------------------------------------
CENPF_HUMAN     KAAELKNIKQCLNQSQNFAEEMK--AKNTSQETMLRDL-------QEKINQQENSLTLEKLKLAVAD---
RASL2_HUMAN     PLMSSSFKKL----YFSLTTEALSFAKTPSSKLIKLANIRAAEKVEEK----------------------
IOLR_BACSU      TSIE----KTALVPFENRTDEKTKIAHYASRFIEDHDLVFIDSGTTTK----------------------
FADR_YERE8      TKVN------------------------------------------------------------------
FADR_SHISS      TKVN------------------------------------------------------------------
FADR_SHIFL      TKVN------------------------------------------------------------------
FADR_SHIDS      TKVN------------------------------------------------------------------
FADR_SHIBS      TKVN------------------------------------------------------------------
FADR_SHIB3      TKVN------------------------------------------------------------------
FADR_SERP5      TKVN------------------------------------------------------------------
FADR_SALTY      TKVN------------------------------------------------------------------
FADR_SALSV      TKVN------------------------------------------------------------------
FADR_SALPK      TKVN------------------------------------------------------------------
FADR_SALPC      TKVN------------------------------------------------------------------
FADR_SALPB      TKVN------------------------------------------------------------------
FADR_SALPA      TKVN------------------------------------------------------------------
FADR_SALNS      TKVN------------------------------------------------------------------
FADR_SALHS      TKVN------------------------------------------------------------------
FADR_SALG2      TKVN------------------------------------------------------------------
FADR_SALEP      TKVN------------------------------------------------------------------
FADR_SALDC      TKVN------------------------------------------------------------------
FADR_SALAR      TKVN------------------------------------------------------------------
FADR_SALA4      TKVN------------------------------------------------------------------
FADR_PROMH      TKVN------------------------------------------------------------------
FADR_HAEIN      TKVN---------------NIWDAAGPNIIETLIALDMQSADNMLSLRSKMSE-SYIYEAVK--------
FADR_HAEIG      TKVN---------------NIWDAAGPNIIETLIALDMQSADNMLSLRSKMSE-SYIYEAVK--------
FADR_HAEIE      TKVN---------------NIWDAAGPNIIETLIALDMQSADNMLSLRSKMSE-SYIYEAVK--------
FADR_HAEI8      TKVN---------------NIWDAAGPNIIETLIALDMQSADNMLSLRSKMSE-SYIYEAVK--------
FADR_ESCF3      TKVN------------------------------------------------------------------
FADR_ENT38      TKVN------------------------------------------------------------------
FADR_ECOUT      TKVN------------------------------------------------------------------
FADR_ECOSM      TKVN------------------------------------------------------------------
FADR_ECOSE      TKVN------------------------------------------------------------------
FADR_ECOLU      TKVN------------------------------------------------------------------
FADR_ECOLI      TKVN------------------------------------------------------------------
FADR_ECOLC      TKVN------------------------------------------------------------------
FADR_ECOL6      TKVN------------------------------------------------------------------
FADR_ECOL5      TKVN------------------------------------------------------------------
FADR_ECOK1      TKVN------------------------------------------------------------------
FADR_ECOHS      TKVN------------------------------------------------------------------
FADR_ECODH      TKVN------------------------------------------------------------------
FADR_ECOBW      TKVN------------------------------------------------------------------
FADR_ECO8A      TKVN------------------------------------------------------------------
FADR_ECO81      TKVN------------------------------------------------------------------
FADR_ECO7I      TKVN------------------------------------------------------------------
FADR_ECO5E      TKVN------------------------------------------------------------------
FADR_ECO57      TKVN------------------------------------------------------------------
FADR_ECO55      TKVN------------------------------------------------------------------
FADR_ECO45      TKVN------------------------------------------------------------------
FADR_ECO27      TKVN------------------------------------------------------------------
FADR_ECO24      TKVN------------------------------------------------------------------
UXUR_HAEIN      VYV-------------------------------------------------------------------
DGOR_ECOLI      AFVAPR----------------------------------------------------------------
MOCR_RHIME      TWVA------------------------------------------------------------------
FADR_SHESR      TRVN------------------------------------------------------------------
FADR_SHESM      TRVN------------------------------------------------------------------
FADR_SHESA      TRVN------------------------------------------------------------------
FADR_SHEPC      TRVN------------------------------------------------------------------
FADR_SHEPA      TRVN------------------------------------------------------------------
FADR_SHEON      TRVN------------------------------------------------------------------
FADR_SHEHH      TRVN------------------------------------------------------------------
FADR_SHEFN      TQVN------------------------------------------------------------------
FADR_SHEDO      TQVN------------------------------------------------------------------
FADR_SHEB9      TRVN------------------------------------------------------------------
FADR_SHEB8      TRVN------------------------------------------------------------------
FADR_SHEB5      TRVN------------------------------------------------------------------
FADR_SHEB2      TRVN------------------------------------------------------------------
FADR_SHEAM      TRVN------------------------------------------------------------------
FADR_SALTI      TKVN------------------------------------------------------------------
YJJM_ECOLI      ----------------------------------------------------------------------
GLCC_ECOLI      SRVA------------------------------------------------------------------
GLCC_ECOL6      SRVA------------------------------------------------------------------
SYF1_YEAST      ----------------------------------------------------------------------
YDEF_BACSU      TFVS------------------------------------------------------------------
Y601_MYCBO      ----------------------------------------------------------------------
Y586_MYCTU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTKAKESFKPILISKSDSKLLNVEDGTAAMRIE
YBGA_BACSU      LQYHTSYIPWKAAPGLAQEECTGS-LFELLRTKYNIEISRGTESIEPILTDETISGHLLTNVGAPAFLSE
YVOA_BACSU      MAIESSHIPFELAGELNESHF-QSSIYDHIERYNSIPISRAKQELEPSAATTEEANILGIQKGAPVLLIK
DASR_STRAW      MAIETTHLSAKRFPALRRSLVKYTSLYTALAEVYDVRLAEAEETIETSLATPREAGLLGTDVGLPMLMLS
DASR_STRGR      MAIETTHLSAKRFPALRRSLVKYTSLYTALAEVYDVRLAEAEETIETSLATPREAGLLGTDVGLPMLMLS
DASR_STRCO      MAIETTHLSAKRFPALRRSLVKYTSLYTALAEVYDVHLAEAEETIETSLATPREAGLLGTDVGLPMLMLS
YURK_BACSU      LTFEVTHYPLDLFPGIDTFIADGVSMHDILKQQYKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEID
MNGR_ECOLI      MALEETWMPLALFPDLTWQVM-ENSKYHFIEEVKKMVIDRSEQEIIPLMPTEEMSRLLNISQTKPILKVS
FRLR_SHIFL      LFIDSSWIPLSRYPDFDEIYVEGSSTYQLFQERFDTRVVSDKKTIDIFAATRPQAKWLKCELGEPLFRIS
FRLR_ECO57      LFIDSSWIPLSRYPDFDEIYVEGSSTYQLFQERFDTRVVSDKKTIDIFAATRPQAKWLKCELGEPLFRIS
FRLR_ECOLI      LFIDSSWIPLSRYPDFDEIYVEGSSTYQLFQERFDTRVVSDKKTIDIFAATRPQAKWLKCELGEPLFRIS
YIDP_ECOLI      LMLEDSYMPVKLFRNLSLQHL-EGSKFEYIEQECGILIGGNYESLTPVLADRLLARQMKVAEHTPLLRIT
PHNR_SALCH      VCYCENHCLPARVPELLQYDLNGS-LTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLR
PHNR_SALPA      VCYCENHCLPARVPELLQYDLNGS-LTEVYESYYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLR
PHNR_SALTY      VCYCENHCLPARVPELLQYDLNGS-LTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLR
PHNR_SALTI      VCYCENHCLPARVPELLQYDLNGS-LTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLR
GMUR_BACSU      YVLEKTYMPTHLIPGINDDVLHD----SIYNHITNVLQLKIAGTHRKIRACKSDQQHLGCKQDDPILEVE
YEGW_SHIFL      VSIEESWVPAHLIHDVDAIGIS---LYDYFRS-QHIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIK
YEGW_ECOLI      VSIEESWVPAHLIHDVDAIGIS---LYDYFRS-QHIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIK
YEGW_ECOL6      VSIEESWVPAHLIHDVDAIGIS---LYDYFRS-QHIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIK
YEGW_ECO57      VSIEESWVPAHLIHDVDAIGIS---LYDYFRS-QHIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIK
YMFC_BACSU      IVYCIDKIP--MNILPNSFSHQQESMFDLLEKNSGSVISYAVTDIEPIGYHDTISPVLECDPETALLLLK
PHNF_MYCS2      VGLETTKLPAQRYPGLRETFDHEASLYAEIRS-RGIAFTRTVDTIDTALPDAREAALLGADARTPMFLLN
ARAR_BACST      ----------------------------------------------------------------------
TRER_BACSU      VILDKDYFFR-KHVPHLTKEICENSIYEYIEGELGLSISYAQKEIVAEPCTDEDRELLDLRGYDHMVVVR
HUTC_PSEAE      VQIEDRYVPDY----LKQDFTRQTP-YAYLTQV--APLTEGEHVVEAILAEPAECKLLQIERGEPCLLIR
HUTC_PSEPU      VQIEDRYVPDY----LKQDFTRQTP-YAYLSQV--APLTEGEHVVEAILAEPEECRLLQIERGEPCLLIR
HUTC_KLEAE      VQIEAAVVPDY----LHQDYTATTP-HDYLSLI--APLTEGEHIVEAVQATAEECALLHIHAHDPCLLIR
ARAR_BACSU      ----------------------------------------------------------------------
YYDK_BACSU      LCYEESY---------------------------------------------------------------
PHNF_ECOLI      LCLIDHYFADLTLWPTLQRF-DSGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVR
PDHR_SALTY      ----------------------------------------------------------------------
PDHR_SALTI      ----------------------------------------------------------------------
Y6150_RHIME     LSTAVSYYPAERFARMAEE---------------------------------------------------
PDHR_ECOLI      ----------------------------------------------------------------------
PDHR_ECOL6      ----------------------------------------------------------------------
PDHR_ECO57      ----------------------------------------------------------------------
EXUR_ERWCH      ----------------------------------------------------------------------
ARAR_BACHD      ----------------------------------------------------------------------
YIHL_SHIFL      VFYHETYIPEVAFIE----QLENHSFSAVWEKCYQKETVVKKLIFKPVRMPGDISKYLGGSAGMPAILIE
YIHL_ECOLI      VFYHETYIPEVAFIE----QLENHSFSAVWEKCYQKETVVKKLIFKPVRMPGDISKYLGGSAGMPAILIE
YIHL_ECO57      VFYHETYIPEVAFIE----QLENHSFSAVWEKCYQKETVVKKLIFKPVRMPGDISKYLGGSAGMPAILIE
EXUR_SHIFL      ----------------------------------------------------------------------
EXUR_ECOLI      ----------------------------------------------------------------------
EXUR_ECO57      ----------------------------------------------------------------------
YCBG_BACSU      ----------------------------------------------------------------------
YTRA_BACSU      ----------------------------------------------------------------------
NANR_SHISS      ----------------------------------------------------------------------
NANR_SHIFL      ----------------------------------------------------------------------
NANR_SHIDS      ----------------------------------------------------------------------
NANR_SHIBS      ----------------------------------------------------------------------
NANR_ECOUT      ----------------------------------------------------------------------
NANR_ECOSE      ----------------------------------------------------------------------
NANR_ECOLU      ----------------------------------------------------------------------
NANR_ECOLI      ----------------------------------------------------------------------
NANR_ECOLC      ----------------------------------------------------------------------
NANR_ECOL6      ----------------------------------------------------------------------
NANR_ECOL5      ----------------------------------------------------------------------
NANR_ECOK1      ----------------------------------------------------------------------
NANR_ECODH      ----------------------------------------------------------------------
NANR_ECOBW      ----------------------------------------------------------------------
NANR_ECO8A      ----------------------------------------------------------------------
NANR_ECO81      ----------------------------------------------------------------------
NANR_ECO7I      ----------------------------------------------------------------------
NANR_ECO57      ----------------------------------------------------------------------
NANR_ECO55      ----------------------------------------------------------------------
NANR_ECO45      ----------------------------------------------------------------------
NANR_ECO27      ----------------------------------------------------------------------
YHCF_BACSU      ----------------------------------------------------------------------
YCXD_BACSU      ----------------------------------------------------------------------
NANR_SALTY      ----------------------------------------------------------------------
NANR_SALTI      ----------------------------------------------------------------------
NANR_SALPK      ----------------------------------------------------------------------
NANR_SALPC      ----------------------------------------------------------------------
NANR_SALPA      ----------------------------------------------------------------------
NANR_SALG2      ----------------------------------------------------------------------
NANR_SALEP      ----------------------------------------------------------------------
NANR_SALCH      ----------------------------------------------------------------------
NANR_SALAR      ----------------------------------------------------------------------
LUTR_BACSU      ----------------------------------------------------------------------
NORG_STAAB      ----------------------------------------------------------------------
LLDR_SHIFL      ----------------------------------------------------------------------
LLDR_ECOLI      ----------------------------------------------------------------------
YISV_BACSU      ----------------------------------------------------------------------
Y505_MYCBO      ----------------------------------------------------------------------
Y494_MYCTU      ----------------------------------------------------------------------
NORG_STAAC      ----------------------------------------------------------------------
NORG_STAA8      ----------------------------------------------------------------------
NORG_STAA3      ----------------------------------------------------------------------
KORA_STRLI      ----------------------------------------------------------------------
YDEL_BACSU      ----------------------------------------------------------------------
GABR_BACSU      ----------------------------------------------------------------------
FADR_VIBVY      ----------------------------------------------------------------------
FADR_VIBVU      ----------------------------------------------------------------------
FADR_VIBPA      ----------------------------------------------------------------------
YDFD_BACSU      ----------------------------------------------------------------------
PDXR_CORGL      ----------------------------------------------------------------------
FADR_VIBCM      ----------------------------------------------------------------------
FADR_VIBCH      ----------------------------------------------------------------------
FADR_VIBC3      ----------------------------------------------------------------------
FADR_PHOLL      ----------------------------------------------------------------------
NORG_STAAN      ----------------------------------------------------------------------
NORG_STAAM      ----------------------------------------------------------------------
YIEP_ECOLI      ----------------------------------------------------------------------
UXUR_ECOLI      ----------------------------------------------------------------------
Y3073_RHOS4     ----------------------------------------------------------------------
LACR_STAES      ----------------------------------------------------------------------
LACR_STAEQ      ----------------------------------------------------------------------
FADR_PECCP      ----------------------------------------------------------------------
FADR_PASMU      ----------------------------------------------------------------------
FADR_ERWCT      ----------------------------------------------------------------------
FADR_EDWI9      ----------------------------------------------------------------------
FADR_YERPY      ----------------------------------------------------------------------
FADR_YERPS      ----------------------------------------------------------------------
FADR_YERPP      ----------------------------------------------------------------------
FADR_YERPN      ----------------------------------------------------------------------
FADR_YERPG      ----------------------------------------------------------------------
FADR_YERPE      ----------------------------------------------------------------------
FADR_YERPB      ----------------------------------------------------------------------
FADR_YERPA      ----------------------------------------------------------------------
FADR_YERP3      ----------------------------------------------------------------------
FADR_KLEP7      ----------------------------------------------------------------------
FADR_KLEP3      ----------------------------------------------------------------------
FADR_ERWT9      ----------------------------------------------------------------------
FADR_ENTS8      ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
RASL2_HUMAN     ----------------------------------------------------------------------
IOLR_BACSU      ----------------------------------------------------------------------
FADR_YERE8      ----------------------------------------------------------------------
FADR_SHISS      ----------------------------------------------------------------------
FADR_SHIFL      ----------------------------------------------------------------------
FADR_SHIDS      ----------------------------------------------------------------------
FADR_SHIBS      ----------------------------------------------------------------------
FADR_SHIB3      ----------------------------------------------------------------------
FADR_SERP5      ----------------------------------------------------------------------
FADR_SALTY      ----------------------------------------------------------------------
FADR_SALSV      ----------------------------------------------------------------------
FADR_SALPK      ----------------------------------------------------------------------
FADR_SALPC      ----------------------------------------------------------------------
FADR_SALPB      ----------------------------------------------------------------------
FADR_SALPA      ----------------------------------------------------------------------
FADR_SALNS      ----------------------------------------------------------------------
FADR_SALHS      ----------------------------------------------------------------------
FADR_SALG2      ----------------------------------------------------------------------
FADR_SALEP      ----------------------------------------------------------------------
FADR_SALDC      ----------------------------------------------------------------------
FADR_SALAR      ----------------------------------------------------------------------
FADR_SALA4      ----------------------------------------------------------------------
FADR_PROMH      ----------------------------------------------------------------------
FADR_HAEIN      ----------------------------------------------------------------------
FADR_HAEIG      ----------------------------------------------------------------------
FADR_HAEIE      ----------------------------------------------------------------------
FADR_HAEI8      ----------------------------------------------------------------------
FADR_ESCF3      ----------------------------------------------------------------------
FADR_ENT38      ----------------------------------------------------------------------
FADR_ECOUT      ----------------------------------------------------------------------
FADR_ECOSM      ----------------------------------------------------------------------
FADR_ECOSE      ----------------------------------------------------------------------
FADR_ECOLU      ----------------------------------------------------------------------
FADR_ECOLI      ----------------------------------------------------------------------
FADR_ECOLC      ----------------------------------------------------------------------
FADR_ECOL6      ----------------------------------------------------------------------
FADR_ECOL5      ----------------------------------------------------------------------
FADR_ECOK1      ----------------------------------------------------------------------
FADR_ECOHS      ----------------------------------------------------------------------
FADR_ECODH      ----------------------------------------------------------------------
FADR_ECOBW      ----------------------------------------------------------------------
FADR_ECO8A      ----------------------------------------------------------------------
FADR_ECO81      ----------------------------------------------------------------------
FADR_ECO7I      ----------------------------------------------------------------------
FADR_ECO5E      ----------------------------------------------------------------------
FADR_ECO57      ----------------------------------------------------------------------
FADR_ECO55      ----------------------------------------------------------------------
FADR_ECO45      ----------------------------------------------------------------------
FADR_ECO27      ----------------------------------------------------------------------
FADR_ECO24      ----------------------------------------------------------------------
UXUR_HAEIN      ----------------------------------------------------------------------
DGOR_ECOLI      ----------------------------------------------------------------------
MOCR_RHIME      ----------------------------------------------------------------------
FADR_SHESR      ----------------------------------------------------------------------
FADR_SHESM      ----------------------------------------------------------------------
FADR_SHESA      ----------------------------------------------------------------------
FADR_SHEPC      ----------------------------------------------------------------------
FADR_SHEPA      ----------------------------------------------------------------------
FADR_SHEON      ----------------------------------------------------------------------
FADR_SHEHH      ----------------------------------------------------------------------
FADR_SHEFN      ----------------------------------------------------------------------
FADR_SHEDO      ----------------------------------------------------------------------
FADR_SHEB9      ----------------------------------------------------------------------
FADR_SHEB8      ----------------------------------------------------------------------
FADR_SHEB5      ----------------------------------------------------------------------
FADR_SHEB2      ----------------------------------------------------------------------
FADR_SHEAM      ----------------------------------------------------------------------
FADR_SALTI      ----------------------------------------------------------------------
YJJM_ECOLI      ----------------------------------------------------------------------
GLCC_ECOLI      ----------------------------------------------------------------------
GLCC_ECOL6      ----------------------------------------------------------------------
SYF1_YEAST      --------------DLLKKSLQQTLRYSDFDRIYNFYLLFEQECSQFILLKENDSKFFNQKDWTEKLQAH
YDEF_BACSU      ----------------------------------------------------------------------
Y601_MYCBO      ----------------------------------------------------------------------
Y586_MYCTU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RVTFENERVIEYTVSVSRGDKFEYTVVLEEx
YBGA_BACSU      SLTYDNEEVVEYAQIITRGDRTKFTV-----
YVOA_BACSU      RTTYQNGTAFEHAKSVYRGDRYTF-------
DASR_STRAW      RHSLDKDRPVEWVRSVYRGDRYKFVARLK--
DASR_STRGR      RHSVDGQEPVEWVRSVYRGDRYKFVARLK--
DASR_STRCO      RHSQDRTQPVEWVRSVYRGDRYKFVARLK--
YURK_BACSU      KTAFSNDQPIYCSLFLMHTNRVTFTI-----
MNGR_ECOLI      RGYLVDGRVFEYSRNAFNTDDYKFTLIAQ--
FRLR_SHIFL      KIAFQNDKPVHVSELFCRANRITLTI-----
FRLR_ECO57      KIAFQNDKPVHVSELFCRANRITLTI-----
FRLR_ECOLI      KIAFQNDKPVHVSELFCRANRITLTI-----
YIDP_ECOLI      SLSYESGEFLNYSVMFRNASEYQ--------
PHNR_SALCH      RLNYDQHRVLDLDIEYWRHDSLRIEV-----
PHNR_SALPA      RLNYDQHRVLDLDIEYWRHDSLRIEV-----
PHNR_SALTY      RLNYDQHRVLDLDIEYWRHDSLRIEV-----
PHNR_SALTI      RLNYDQHRVLDLDIEYWRHDSLRIEV-----
GMUR_BACSU      HVGFLDTGIFEYSFSRHRHDKFVVTSV----
YEGW_SHIFL      QVALQQQRPIEYSISHCRSDL--YVFVCEE-
YEGW_ECOLI      QVALQQQRPIEYSISHCRSDL--YVFVCEE-
YEGW_ECOL6      QVALQQQRPIEYSISHCRSDL--YVFVCEE-
YEGW_ECO57      QVALQQQRPIEYSISHCRSDL--YVFVCEE-
YMFC_BACSU      QTHYQHDKPVLYSLNYFRADKFRFHVL----
PHNF_MYCS2      RVSYDQDDVIEQRRSLYRGDRMTFTAVM---
ARAR_BACST      -------------------------------
TRER_BACSU      NYVFEDTSLFQYTESRHRLDKFRF-------
HUTC_PSEAE      RRTW---------------------------
HUTC_PSEPU      RRTWSGRQPV---------------------
HUTC_KLEAE      RRTWSTTHIVSHARLLFPGSRY---------
ARAR_BACSU      -------------------------------
YYDK_BACSU      -------------------------------
PHNF_ECOLI      TLNHRDSSPAEYSVSLTRADMIEFTM-----
PDHR_SALTY      -------------------------------
PDHR_SALTI      -------------------------------
Y6150_RHIME     -------------------------------
PDHR_ECOLI      -------------------------------
PDHR_ECOL6      -------------------------------
PDHR_ECO57      -------------------------------
EXUR_ERWCH      -------------------------------
ARAR_BACHD      -------------------------------
YIHL_SHIFL      K------------------------------
YIHL_ECOLI      K------------------------------
YIHL_ECO57      K------------------------------
EXUR_SHIFL      -------------------------------
EXUR_ECOLI      -------------------------------
EXUR_ECO57      -------------------------------
YCBG_BACSU      -------------------------------
YTRA_BACSU      -------------------------------
NANR_SHISS      -------------------------------
NANR_SHIFL      -------------------------------
NANR_SHIDS      -------------------------------
NANR_SHIBS      -------------------------------
NANR_ECOUT      -------------------------------
NANR_ECOSE      -------------------------------
NANR_ECOLU      -------------------------------
NANR_ECOLI      -------------------------------
NANR_ECOLC      -------------------------------
NANR_ECOL6      -------------------------------
NANR_ECOL5      -------------------------------
NANR_ECOK1      -------------------------------
NANR_ECODH      -------------------------------
NANR_ECOBW      -------------------------------
NANR_ECO8A      -------------------------------
NANR_ECO81      -------------------------------
NANR_ECO7I      -------------------------------
NANR_ECO57      -------------------------------
NANR_ECO55      -------------------------------
NANR_ECO45      -------------------------------
NANR_ECO27      -------------------------------
YHCF_BACSU      -------------------------------
YCXD_BACSU      -------------------------------
NANR_SALTY      -------------------------------
NANR_SALTI      -------------------------------
NANR_SALPK      -------------------------------
NANR_SALPC      -------------------------------
NANR_SALPA      -------------------------------
NANR_SALG2      -------------------------------
NANR_SALEP      -------------------------------
NANR_SALCH      -------------------------------
NANR_SALAR      -------------------------------
LUTR_BACSU      -------------------------------
NORG_STAAB      -------------------------------
LLDR_SHIFL      -------------------------------
LLDR_ECOLI      -------------------------------
YISV_BACSU      -------------------------------
Y505_MYCBO      -------------------------------
Y494_MYCTU      -------------------------------
NORG_STAAC      -------------------------------
NORG_STAA8      -------------------------------
NORG_STAA3      -------------------------------
KORA_STRLI      -------------------------------
YDEL_BACSU      -------------------------------
GABR_BACSU      -------------------------------
FADR_VIBVY      -------------------------------
FADR_VIBVU      -------------------------------
FADR_VIBPA      -------------------------------
YDFD_BACSU      -------------------------------
PDXR_CORGL      -------------------------------
FADR_VIBCM      -------------------------------
FADR_VIBCH      -------------------------------
FADR_VIBC3      -------------------------------
FADR_PHOLL      -------------------------------
NORG_STAAN      -------------------------------
NORG_STAAM      -------------------------------
YIEP_ECOLI      -------------------------------
UXUR_ECOLI      -------------------------------
Y3073_RHOS4     -------------------------------
LACR_STAES      -------------------------------
LACR_STAEQ      -------------------------------
FADR_PECCP      -------------------------------
FADR_PASMU      -------------------------------
FADR_ERWCT      -------------------------------
FADR_EDWI9      -------------------------------
FADR_YERPY      -------------------------------
FADR_YERPS      -------------------------------
FADR_YERPP      -------------------------------
FADR_YERPN      -------------------------------
FADR_YERPG      -------------------------------
FADR_YERPE      -------------------------------
FADR_YERPB      -------------------------------
FADR_YERPA      -------------------------------
FADR_YERP3      -------------------------------
FADR_KLEP7      -------------------------------
FADR_KLEP3      -------------------------------
FADR_ERWT9      -------------------------------
FADR_ENTS8      -------------------------------
CENPF_HUMAN     -------------------------------
RASL2_HUMAN     -------------------------------
IOLR_BACSU      -------------------------------
FADR_YERE8      -------------------------------
FADR_SHISS      -------------------------------
FADR_SHIFL      -------------------------------
FADR_SHIDS      -------------------------------
FADR_SHIBS      -------------------------------
FADR_SHIB3      -------------------------------
FADR_SERP5      -------------------------------
FADR_SALTY      -------------------------------
FADR_SALSV      -------------------------------
FADR_SALPK      -------------------------------
FADR_SALPC      -------------------------------
FADR_SALPB      -------------------------------
FADR_SALPA      -------------------------------
FADR_SALNS      -------------------------------
FADR_SALHS      -------------------------------
FADR_SALG2      -------------------------------
FADR_SALEP      -------------------------------
FADR_SALDC      -------------------------------
FADR_SALAR      -------------------------------
FADR_SALA4      -------------------------------
FADR_PROMH      -------------------------------
FADR_HAEIN      -------------------------------
FADR_HAEIG      -------------------------------
FADR_HAEIE      -------------------------------
FADR_HAEI8      -------------------------------
FADR_ESCF3      -------------------------------
FADR_ENT38      -------------------------------
FADR_ECOUT      -------------------------------
FADR_ECOSM      -------------------------------
FADR_ECOSE      -------------------------------
FADR_ECOLU      -------------------------------
FADR_ECOLI      -------------------------------
FADR_ECOLC      -------------------------------
FADR_ECOL6      -------------------------------
FADR_ECOL5      -------------------------------
FADR_ECOK1      -------------------------------
FADR_ECOHS      -------------------------------
FADR_ECODH      -------------------------------
FADR_ECOBW      -------------------------------
FADR_ECO8A      -------------------------------
FADR_ECO81      -------------------------------
FADR_ECO7I      -------------------------------
FADR_ECO5E      -------------------------------
FADR_ECO57      -------------------------------
FADR_ECO55      -------------------------------
FADR_ECO45      -------------------------------
FADR_ECO27      -------------------------------
FADR_ECO24      -------------------------------
UXUR_HAEIN      -------------------------------
DGOR_ECOLI      -------------------------------
MOCR_RHIME      -------------------------------
FADR_SHESR      -------------------------------
FADR_SHESM      -------------------------------
FADR_SHESA      -------------------------------
FADR_SHEPC      -------------------------------
FADR_SHEPA      -------------------------------
FADR_SHEON      -------------------------------
FADR_SHEHH      -------------------------------
FADR_SHEFN      -------------------------------
FADR_SHEDO      -------------------------------
FADR_SHEB9      -------------------------------
FADR_SHEB8      -------------------------------
FADR_SHEB5      -------------------------------
FADR_SHEB2      -------------------------------
FADR_SHEAM      -------------------------------
FADR_SALTI      -------------------------------
YJJM_ECOLI      -------------------------------
GLCC_ECOLI      -------------------------------
GLCC_ECOL6      -------------------------------
SYF1_YEAST      MATFES-------------------------
YDEF_BACSU      -------------------------------
Y601_MYCBO      -------------------------------
Y586_MYCTU      -------------------------------