[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB80017.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a1uB.bssp"
#ERROR : Can't open dsspfile "1efpB.bssp"
#ERROR : Can't open dsspfile "1efvB.bssp"
#ERROR : Can't open dsspfile "3clrC.bssp"
#ERROR : Can't open dsspfile "3cluC.bssp"
#ERROR : Can't open dsspfile "3cltC.bssp"
#ERROR : Can't open dsspfile "2a1tS.bssp"
#ERROR : Can't open dsspfile "3cltD.bssp"
#ERROR : Can't open dsspfile "3clrD.bssp"
#ERROR : Can't open dsspfile "1do8A.bssp"
#ERROR : Can't open dsspfile "3clsD.bssp"
#ERROR : Can't open dsspfile "2e77B.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "3cluD.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"

## Summary of PDB Search
:262
    1e-52  28%  2a1uB  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    2e-49  24%  1efpB  [c.26.2] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
    1e-48  28%  1efvB  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN
    7e-45  27%  3clrC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    1e-43  27%  3cluC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    9e-40  26%  3cltC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    4e-27  28%  2a1tS  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    8e-10  17%  3cltD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    2e-08  15%  3clrD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    1e-07  12%  1do8A  [c.58.1 - c.2.1] MALIC ENZYME
    1e-07  13%  3clsD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    3e-05  13%  2e77B  [x.x.x] LACTATE OXIDASE
    1e-04  12%  2du2A  [x.x.x] LACTATE OXIDASE
    5e-04  14%  3cluD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    0.001  16%  2e77C  [x.x.x] LACTATE OXIDASE
:262

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETALRIKEKKGGNIKVISMGPPQAKAVI
2a1uB           LRVLVAVKRVIDYVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLKEVIAVSCGPAQCQETI
1efpB           MKVLVPVKRLIDYVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEIIAVSIGVKQAAETL
1efvB           LRVLVAVKRVIDYVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKVKEVIAVSCGPAQCQETI
3clrC           MKILVAVKQTAALEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVVSVGPDRVDESL
3cluC           MKILVAVKQTAALEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVVSVGPDRVDESL
3cltC           MKILVAVKQTAALEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVVSVGPDRVDESL
2a1tS           LRVLVAVKRVIDYVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKVKEVIAVSCGPAQCQETI
3cltD           ---------------------------EHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGS-QADAFV
3clrD           ---------------------------EHRRNDLRPVSLELIGAANGLKKSGED-KVVVAVIGSQADAFV
1do8A           SYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTA
3clsD           ---------------------------EHRRNDLRPVSLELIGAANGLKKSGED-KVVVAVIGSQADAFV
2e77B           SGLPVFVKGIQHPEDADMAIKRGAIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHV
2du2A           SGLPVFVKGIQHPEDADMAIKRGAIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHV
3cluD           ---------------------------EHRRNDLRPVSLELIGAANGLKKSGED-KVVVAVIGSQADAFV
2e77C           SGLPVFVKGIQHPEDADMAIKRGAIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHV


                         .         .         *         .         .         .         .:140
query           KEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPH
2a1uB           RTALAMGADRGIHVEVPPAEALGPLQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
1efpB           RTALAMGADRAILVVAADDVQQDIEPLAVAILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQ
1efvB           RTALAMGADRGIHVEVPPAEALGPLQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
3clrC           RKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKK-EAPDMVFAGVQSSDQAYASTGISVASYLNWPH
3cluC           RKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKK-EAPDMVFAGVQSSDQAYASTGISVASYLNWPH
3cltC           RKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKK-EAPDMVFAGVQSSDQAYASTGISVASYLNWPH
2a1tS           RTALAMGADRGIHVEVPPAEAERLGPLQ-VARVLAKLAEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
3cltD           PALSVNGVDELVVVKGSSIDFDPDVFEA--SVSALIAAHNPSVVLLPHS---VDSLGYASSLASKTGYGF
3clrD           PALSVN-------GVDELVVVKGSSIDFDPSVSALIAAHNPSVVLLPHS---VDSLGYASSLASKTGYGF
1do8A           EEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAHISDSVFLEAADEELAQGRLYPP
3clsD           PALSVNGVDELVVVKGSSIDFDPDVFEA--SVSALIAAHNPSVVLLPHS---VDSLGYASSLASKTGYGF
2e77B           AKALASGADVVALG--RPVLFGLALGGWQGAYSVLDYFLTRVMQLTGSQNVEDLKGLDLFDNPYGY----
2du2A           AKALASGADVVALGRP--VLFGLALGGWQGAYSVLDYFLTRVMQLTGSQNVEDLKGLDLFDNPYGY----
3cluD           PALSVNGVDELVVVKGSSIDFDPDVFEA--SVSALIAAHNPSVVLLPHS---VDSLGYASSLASKTGYGF
2e77C           AKALASGADVVALG--RPVLFGLALGGWQGAYSVLDYFLTRVMQLTGSQNVEGLDLFDNPYGYEY-----


                         +         .         .         .         .         *         .:210
query           VANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFE
2a1uB           GTFASQV-TLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLG
1efpB           ATFASKV-EIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYG
1efvB           GTFASQV-TLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLG
3clrC           AAVVAD-LQYKPGDNKAVIRREGMLQEVEINCPAVLTIQLGINKPRYASTKPIEEVSLADIGL-------
3cluC           AAVVADQYKPGDNKAVIRRELEGMLQEVEINCPAVLTIQLGINKPRYAS---------KPIEEVSLAD-I
3cltC           AAVVADQYKPGDNKAVIRRELEGMLQEVEINCPAVLTIQLGINKPRYASTKPIEEVSLADI---------
2a1tS           GTFASQV-TLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLG
3cltD           ATDVYIV-EYQGDELVATRGGYNQKVNVEVDFPGKSTV--------------------------------
3clrD           ATDVYIVEYQGDE-LVATRGGYNQKVNVEVDFPGKSTVVLTIRPSV------------------------
1do8A           LANIQ-EVSINIAIKVTEYLYANKAFRYPEPEDKAKYVKERTWRSEYDSLLPD-----------------
3clsD           ATDVYIV-EYQGDELVATRGGYNQKVNVEVTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYV
2e77B           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
3cluD           ATDVYIVYQGDELVATRGGYNQKVNVDFPGKSTVVLTIRPSVFKP-------------------------
2e77C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DKDEKKYGLNGSPTQVERIFPPSNNDDHEIWTGDSSELSERMEDKLRELKFI
2a1uB           VDL-------TSKLSVISVEDPPQRTAGVKVET-----TEDLVAKLKEIGRI
1efpB           VDV-------APRLEVVSVREP------------------------------
1efvB           VDL-------TSKLSVISVEDPPQRTAGVKVET-----TEDLVAKLKEIGRI
3clrC           --SANDVGAAQSMSRVRRMYIP-EKGRATMIEGTISEQAAKIIQIINEFK--
3cluC           GLSANDVGAAQSMSRVRRMYIPEKG-RATMIEGTISEQAAKIIQIINEF---
3cltC           GLSANDVGAAQSMSRVRRMYIP-EKGRATMIEGTISEQAAKIIQIINE----
2a1tS           VDLT-------SKLSVISVEDPPTTEDL------------------------
3cltD           ----------------------------------------------------
3clrD           ----------------------------------------------------
1do8A           ----------------------------------------------------
3clsD           EVGG------------------------------------------------
2e77B           ----------------------------------------------------
2du2A           ----------------------------------------------------
3cluD           ----------------------------------------------------
2e77C           ----------------------------------------------------