[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB80140.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3efaA.bssp"
#ERROR : Can't open dsspfile "2c27A.bssp"
#ERROR : Can't open dsspfile "2a6aB.bssp"
#ERROR : Can't open dsspfile "2b3vA.bssp"
#ERROR : Can't open dsspfile "3ec4A.bssp"
#ERROR : Can't open dsspfile "2b5gB.bssp"
#ERROR : Can't open dsspfile "2beiB.bssp"
#ERROR : Can't open dsspfile "3ec4B.bssp"
#ERROR : Can't open dsspfile "3cxsA.bssp"
#ERROR : Can't open dsspfile "3dnsA.bssp"
#ERROR : Can't open dsspfile "3cxpA.bssp"
#ERROR : Can't open dsspfile "2b3uB.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "2bueA.bssp"
#ERROR : Can't open dsspfile "3e0kA.bssp"
#ERROR : Can't open dsspfile "3dnsB.bssp"
#ERROR : Can't open dsspfile "3cxqA.bssp"
#ERROR : Can't open dsspfile "2b3uA.bssp"
#ERROR : Can't open dsspfile "1cm0B.bssp"
#ERROR : Can't open dsspfile "2ae6B.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "3bj8C.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "3bj7B.bssp"
#ERROR : Can't open dsspfile "3bj8A.bssp"
#ERROR : Can't open dsspfile "2ae6A.bssp"
#ERROR : Can't open dsspfile "3dsbA.bssp"
#ERROR : Can't open dsspfile "2b4dB.bssp"
#ERROR : Can't open dsspfile "1b6bA.bssp"
#ERROR : Can't open dsspfile "2b4bB.bssp"
#ERROR : Can't open dsspfile "2b4bA.bssp"
#ERROR : Can't open dsspfile "3eg7F.bssp"
#ERROR : Can't open dsspfile "2atrA.bssp"
#ERROR : Can't open dsspfile "3bj8B.bssp"
#ERROR : Can't open dsspfile "3eg7E.bssp"
#ERROR : Can't open dsspfile "3eg7B.bssp"
#ERROR : Can't open dsspfile "1cjwA.bssp"
#ERROR : Can't open dsspfile "2b4dA.bssp"
#ERROR : Can't open dsspfile "1b6bB.bssp"
#ERROR : Can't open dsspfile "2d4pA.bssp"
#ERROR : Can't open dsspfile "3dr8A.bssp"
#ERROR : Can't open dsspfile "3d3sB.bssp"
#ERROR : Can't open dsspfile "3dr8B.bssp"
#ERROR : Can't open dsspfile "3dr6B.bssp"
#ERROR : Can't open dsspfile "2beiA.bssp"
#ERROR : Can't open dsspfile "3d3sA.bssp"
#ERROR : Can't open dsspfile "3eg7A.bssp"
#ERROR : Can't open dsspfile "3dr6C.bssp"
#ERROR : Can't open dsspfile "3bj7A.bssp"
#ERROR : Can't open dsspfile "3dr6A.bssp"
#ERROR : Can't open dsspfile "3d8pA.bssp"
#ERROR : Can't open dsspfile "3d3sD.bssp"
#ERROR : Can't open dsspfile "3eg7C.bssp"
#ERROR : Can't open dsspfile "2ae6C.bssp"
#ERROR : Can't open dsspfile "2aj6A.bssp"
#ERROR : Can't open dsspfile "2bswA.bssp"
#ERROR : Can't open dsspfile "3d3sC.bssp"
#ERROR : Can't open dsspfile "2cnmA.bssp"
#ERROR : Can't open dsspfile "2b5gA.bssp"
#ERROR : Can't open dsspfile "3c26A.bssp"
#ERROR : Can't open dsspfile "2bl1A.bssp"
#ERROR : Can't open dsspfile "3d8pB.bssp"
#ERROR : Can't open dsspfile "1bo4A.bssp"
#ERROR : Can't open dsspfile "2ae6D.bssp"

## Summary of PDB Search
:162
    6e-09  16%  3efaA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    1e-08  19%  2c27A  [x.x.x] MYCOTHIOL SYNTHASE
    1e-08   9%  2a6aB  [x.x.x] HYPOTHETICAL PROTEIN TM0874
    2e-08  10%  2b3vA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-08  22%  3ec4A  [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY
    3e-08  11%  2b5gB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-08  20%  2beiB  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    5e-08  16%  3ec4B  [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY
    6e-08  14%  3cxsA  [x.x.x] GLUCOSAMINE 6-PHOSPHATE N-ACETYLTRANSFERASE
    9e-08  18%  3dnsA  [x.x.x] RIBOSOMAL-PROTEIN-ALANINE ACETYLTRANSFERASE
    1e-07  13%  3cxpA  [x.x.x] GLUCOSAMINE 6-PHOSPHATE N-ACETYLTRANSFERASE
    2e-07  13%  2b3uB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-07  21%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    2e-07  25%  2bueA  [x.x.x] AAC(6')-IB
    2e-07  19%  3e0kA  [x.x.x] AMINO-ACID ACETYLTRANSFERASE
    4e-07  19%  3dnsB  [x.x.x] RIBOSOMAL-PROTEIN-ALANINE ACETYLTRANSFERASE
    4e-07  15%  3cxqA  [x.x.x] GLUCOSAMINE 6-PHOSPHATE N-ACETYLTRANSFERASE
    4e-07   9%  2b3uA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    5e-07  20%  1cm0B  [d.108.1] P300/CBP ASSOCIATING FACTOR
    6e-07  19%  2ae6B  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    1e-06  14%  1bobA  [x.x.x] HISTONE ACETYLTRANSFERASE
    1e-06  13%  3bj8C  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-06  20%  1cm0A  [d.108.1] P300/CBP ASSOCIATING FACTOR
    1e-06  10%  3bj7B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-06  10%  3bj8A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-06  20%  2ae6A  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    2e-06  13%  3dsbA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    2e-06  11%  2b4dB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-06  19%  1b6bA  [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    3e-06  10%  2b4bB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-06  10%  2b4bA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-06  21%  3eg7F  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    4e-06  19%  2atrA  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    4e-06  10%  3bj8B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-06  21%  3eg7E  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    5e-06  21%  3eg7B  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    7e-06  19%  1cjwA  [d.108.1] PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
    7e-06  10%  2b4dA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    7e-06  19%  1b6bB  [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    8e-06  15%  2d4pA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1254
    1e-05  24%  3dr8A  [x.x.x] YNCA
    1e-05  20%  3d3sB  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    1e-05  23%  3dr8B  [x.x.x] YNCA
    1e-05  23%  3dr6B  [x.x.x] YNCA
    1e-05  19%  2beiA  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    1e-05  20%  3d3sA  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    2e-05  21%  3eg7A  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    2e-05  24%  3dr6C  [x.x.x] YNCA
    2e-05  13%  3bj7A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-05  24%  3dr6A  [x.x.x] YNCA
    3e-05  15%  3d8pA  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    3e-05  15%  3d3sD  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    3e-05  21%  3eg7C  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    3e-05  21%  2ae6C  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    5e-05  17%  2aj6A  [x.x.x] HYPOTHETICAL PROTEIN MW0638
    6e-05  21%  2bswA  [x.x.x] GLYPHOSATE N-ACETYLTRANSFERASE
    9e-05  18%  3d3sC  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    1e-04  21%  2cnmA  [x.x.x] MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN
    2e-04  12%  2b5gA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-04  19%  3c26A  [x.x.x] PUTATIVE ACETYLTRANSFERASE TA0821
    2e-04  20%  2bl1A  [x.x.x] PUTATIVE PHOSPHINOTHRICIN N-ACETYLTRANSFERASE
    2e-04  11%  3d8pB  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    5e-04  22%  1bo4A  [d.108.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    6e-04  22%  2ae6D  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
:162

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxSTSLPDGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLK
3efaA           ----------------------------------------------------------------------
2c27A           -----------------------------------------------------------ERRGEAWFDPD
2a6aB           -----------------------------------------------------------------VSPYD
2b3vA           -----------------------------------------ARYEYEEQVILTEKDLLEDGFGEHPFYHC
3ec4A           ----------------------------------------------------------------------
2b5gB           ----------------------------FVIRPATAADCSDILRLIKELAYEYEEQVILTEKDLLEDGFF
2beiB           ----------------------------------------------------------------------
3ec4B           ------------------------VAPLLQIADGPVPSFDDPGIVALGETDVPETA---LALATEPPWAS
3cxsA           ---------------------PTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKK
3dnsA           ---------------------------------------------------------ALKGKYTKIEKVN
3cxpA           ----------------------THPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKK
2b3uB           ---------------------------------------KELARYEYEEQVILTEKDLLEDGFPFYHCLV
3d2pA           ----------------------------------------------------------------------
2bueA           ----------------------------------------------------------------------
3e0kA           ----------------------------------------------------------------------
3dnsB           ----------------------------------------------------------------------
3cxqA           ----------------------THPGEGLVLRPLCTADLNRGFFKVLGQ--LTETGVVSPEQFMKEHMKK
2b3uA           ----------------------------------------------LTEKDLLEDGFGEHPFYHCLVA--
1cm0B           ----------------------------------------------------------------------
2ae6B           ---------------------------------------------------------ALHALDQIILAAY
1bobA           ----------------------------FVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSW-
3bj8C           ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
3bj7B           -------------------------------------YEYMEDQVILTEKDLQEDGFGEHPFYHCLVA--
3bj8A           -------------------------------------YEYMEDQVILTEKDLQEDGFGEHPFYHCLVA--
2ae6A           ----------------------------------------------------------------------
3dsbA           ----------------------------------------------------------------------
2b4dB           ---------------------------------------KELAYEYEEQVILTEKDLLEDGFGEHPFYHC
1b6bA           ----------------------------------------------------------------------
2b4bB           -----------------------------------------ARYEYEEQVILTEKDLLEDGFGEHPFYHC
2b4bA           -----------------------------------------ARYEYEEQVILTEKDLLEDGFGEHPFYHC
3eg7F           ----------------------------------------------------------------------
2atrA           ----------------------------------------------------------YQAVGWTNELEQ
3bj8B           -------------------------------------YEYMEDQVILTEKDLQEDGFGEHPFYHCLVA--
3eg7E           ----------------------------------------------------------------------
3eg7B           ----------------------------------------------------------------------
1cjwA           ----------------------------------------------------------------------
2b4dA           -----------------------------------------AKYEYEEQVILTEKDLLEDGFGEHPFYHC
1b6bB           ----------------------------------------------------------------------
2d4pA           ----------------------------------------------------------AGKRPVSLGALR
3dr8A           ----------------------------------------------------------------------
3d3sB           ----------------------------------------------------------------------
3dr8B           ----------------------------------------------AAIWNDRTVDTDNRLAWYEARQLL
3dr6B           ----------------------------------------------AAIWNDRTVDTDNRLAWYEARQLL
2beiA           --------------------------------------------------LAEFEKLKISEEALRADGFG
3d3sA           ----------------------------------------------------------------------
3eg7A           ----------------------------------------------------------------------
3dr6C           ----------------------------------------------------------------------
3bj7A           ----------------------------------------------------------------------
3dr6A           ----------------------------------------------------------------------
3d8pA           ----------------------------------------------------------------------
3d3sD           ----------------------------------------------------------------------
3eg7C           ----------------------------------------------------------------------
2ae6C           ----------------------------------------------------------------------
2aj6A           ----------------------------------------------------------------------
2bswA           ----------------------------------------------------------------------
3d3sC           ----------------------------------------------------------------------
2cnmA           ----------------------------------------------------------------------
2b5gA           ----------------------------------------------------------------------
3c26A           --------------------------------------------------------------------IE
2bl1A           ----------------------------------------------------------------------
3d8pB           ---------------------------AINIIEYNRSYKEELIEFILSIQKNEKIDRDDQPDLENIEHNY
1bo4A           ----------------------------------------------------------------------
2ae6D           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNFKNRCVFLENENGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATR
3efaA           ----CEYAVLYLQPDLPITTLRLEP----QADHVRFGRVCTRKAYRGHGWGRQLLTAAEEWATQ-RGFTH
2c27A           GLILAFGDSPRERPGRLLGFHWTKV-HPDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARPAVEPA
2a6aB           IPVAPLNSFETAKSCPADGVVLVARR--ARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITK-EFSPK
2b3vA           LVAEVPKEHWTPEGHSIVGFAYYFT-YDPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARC-RCSSH
3ec4A           ----YGQFYGVRIDGRLAAAGERRP----APNLAEVSGVCTWPEYRGRGLAARLIRKVIAGAAR-GEVPY
2b5gB           YHCLVAEVPWTPEGHSIVGFAYYFT-YDPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARC-RCSSH
2beiB           ----NPFYHCLVAEICVVGYGIYYFIYSTWKGRTIYLEDIYVPEYRGQGIGSKIIKKVAEVALD-KGCSQ
3ec4B           GTWRYGQFYGVRIDGRLAAAGERRP----APNLAEVSGVCTWPEYRGRGLAARLIRKVIAGAAR-GEVPY
3cxsA           SGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRVEDVVVSDECRKQLGKLLLS-TLTLLSKKLNCYK
3dnsA           GV--EREYLITDKYGITIGRIFIVD-LNKDNRFCFRKIY---KQGKSINTYIKEILSVFEFLFKSNDINK
3cxpA           SGDYYVTVVEDVTLGQIVATATLIIEIHSCAKRGRVEDVVVSDECRGKQLGKLLLS-TLTLLSKKLNCYK
2b3uB           AE--VPKEHWTPEGHSIVGFAYYFT-YDPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARC-RCSSH
3d2pA           ----ISEFSILEHDGNLYGCAALKTF--AEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARG-IGISR
2bueA           ----SVTPYIAMLNGEPIGYAQSYVEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTK
3e0kA           ---EIGKFTIIEKDGLIIGCAALYP---YSEERKAEACVAIHPDYRDGNRGLLLLNYKHRSKSENINQIF
3dnsB           --------LITDKYGITIGRIFIVD-LNKDNRFCFRKIY---KQGKSINTYIKEILSVFEFLFKSNDINK
3cxqA           SGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVVVSDECRGKQLGKLLLS-TLTLLSKKLNCYK
2b3uA           ---EVPKEHWTPEGHSIVGFAYYFTY-DPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARC-RCSSH
1cm0B           ----KHKTLALIKDGRVIGGICFRMFPSQGFT--EIVFCAVTSNEQVKGYGTHLMNHLKEYHIK-HDILN
2ae6B           QEKKDETIFVAISGQQLAGFIEVHPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDAEIS-GIHKL
1bobA           ----QIYWLLNKKTKELIGFVTTYKYWHYIDKKFKISQFLIFPPYQNKGHGSCLYEAIIQSWLE-DKSIT
3bj8C           ----CLVAEVPPEGHSIVGFAMYYFTYDPWIGLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMK-CRCSS
1cm0A           ---PKHKTLALIKDGRVIGGICFRMFPSQGFT--EIVFCAVTSNEQVKGYGTHLMNHLKEYHIK-HDILN
3bj7B           ---EVPKEHWTPEGHSIVGFAMYYFTYDPWIGLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKC-RCSS
3bj8A           ---EVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLYLEDFFVMSDYRGFGIGSEILKNLSQVAMK-CRCSS
2ae6A           ----DETIFVAISGQQLAGFIEVHPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDAEISGIHKLS
3dsbA           ----KGKYHVYTVFDKVVAQIYTYEWSDWRGNFLWIQSVYVDKEYRRKGIFNYLFNYIKNICDK-DENIV
2b4dB           LVAEVPKEHWTPEGHSIVGFAYYFT-YDPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARC-RCSSH
1b6bA           ----------------------------PRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRR
2b4bB           LVAEVPKEHWTPEGHSIVGFAYYFT-YDPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARC-RCSSH
2b4bA           LVAEVPKEHWTPEGHSIVGFAYYFT-YDPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARC-RCSSH
3eg7F           ----ERRFVVEDAQKNLIGLVELIEINYIHRS--AEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHK
2atrA           ALSHSLVIYLALDGDAVVGLIRLVG---DGFSSVFVQDLIVLPSYQRQGIGSSLKEALGNFKEA-YQVQL
3bj8B           ---EVPKEHWTPEGHSIVGFAMYYFTYDPWIGLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMK-CRCSS
3eg7E           ----ERRFVVEDAQKNLIGLVELIEI--NYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHK
3eg7B           ----ERRFVVEDAQKNLIGLVELIEINYIHRS--AEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHK
1cjwA           ---------------EERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRR
2b4dA           LVAEVPKEHWTPEGHSIVGFAYYFT-YDPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARC-RCSSH
1b6bB           ---------------EERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRR
2d4pA           FFARTGHSFLAEEGEEPMGFALAQAVWQGEATTVLVTRIEGRSVEALRGLLRAVVKSAYDA-----GVYE
3dr8A           --LLGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEHVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVV
3d3sB           -HHAHTCVVAESPGGRIDGFVSAYL-LPTRPDVLFVWQVAVHSRARGHRLGRALGHILERQEC--RHVRH
3dr8B           GYP----VLVSEENGVVTGYASFGDWRSFDGFRYTVEHVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVV
3dr6B           GYP----VLVSEENGVVTGYASFGDWRSFDGFRYVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVV
2beiA           DNPFYHCLVAEILGPCVVGYGIYYFIYSTWKGRTIYLEDIYVPEYRGQGIGSKIIKKVAEVALD-KGCSQ
3d3sA           -HHAHTCVVAESPGGRIDGFVSAYL-LPTRPDVLFVWQVAVHSRARGHRLGRALGHILERQEC--RHVRH
3eg7A           ----ERRFVVEDAQKNLIGLVELIEI--NYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHK
3dr6C           ----GYPVLVSEENGVVTGYASFGDWRSFDGFYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVV
3bj7A           ----CLVAEVPPEGHSIVGFAMYYFTYDPWIGLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMK-CRCSS
3dr6A           ----GYPVLVSEENGVVTGYASFGDWRSFDGFRYVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVV
3d8pA           ----GQFWLAINNHQNIVGTIGLIRL-----DNNSALKKFVDKGYRNLKIGKKLLDKVITCKEQNIDGIY
3d3sD           -HHAHTCVVAESPGGRIDGFVSAYLL-PTRPDVLFVWQVAVHSRARGHRLGRALGHILERQEC--RHVRH
3eg7C           ----ERRFVVEDAQKNLIGLVELIEI--NYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHK
2ae6C           ----DETIFVAISGQQLAGFIEVHPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDAEIS-GIHKL
2aj6A           ---TNDKIYIYENEGQLIAFIWGHF---SNEKSVNIELLYVEPQFRKLGIATQLKIALEKWAKT-NAKRI
2bswA           ----GAFHLGGYYGGKLISIASFHQAEHSELQKQYQLRGATLEGYREQKAGSSLIKHAEEILRK-RGADL
3d3sC           -HHAHTCVVAESPGGRIDGFVSAYLL-PTRPDVLFVWQVAVHSRARGHRLGRALGHILERQEC--RHVRH
2cnmA           ----RYLNLKLTADDRMAAFAITQVV----LDEATLFNIAVDPDFQRRGLGRMLLEHLIDELET-RGVVT
2b5gA           ------------EGHSIVGFAYYFTYDPWIGKLLYLEDFFV-SDYRGFGIGSEILKNLSQVARC-RCSSH
3c26A           RWVNDGSVYVLRVSGRPVATIHEKL-----PDGSVLGGLRVHPEYRGSRLGSIQETIQFLRGKT-ERLRS
2bl1A           ----YPILVASDAAGEVLGYASYGDWRPFEGFGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVV
3d8pB           LNSGGQFWLAINNHQNIVGTIGLIR-----LDNNSALKKFVDKGYRNLKIGKKLLDKVITCKEQNIDGIY
1bo4A           ----TFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYDLAVSGEHRRQGIATALINLLKHEANA-LGAYV
2ae6D           ----DETIFVAISGQQLAGFIEVHPPTSLAAHKQWLLSIGVSPDFQDQGIGGSLLSYIKDAEIS-GIHKL


                         +         .         .         .         .         *         .:210
query           INLEAYNDKSIVLFENLGFERx
3efaA           GEIHG-ELTAQRFYELCGYRV-
2c27A           VLLYSDNVAAVRTYQSLGFTT-
2a6aB           IVLKDDISPAVLVEESERLFR-
2b3vA           FLVAEWNEPSINFYKRRGASD-
3ec4A           LHSYASNASAIRLYESLGFRA-
2b5gB           FLVAEWNEPSINFYKRRGASD-
2beiB           FRLAVLWNQRADLYKALGAQD-
3ec4B           LHSYASNASAIRLYESLGFRA-
3cxsA           ITLEC-LPQNVGFYKKFGYTV-
3dnsA           VNIIVDEEVSTQPFVELGFAF-
3cxpA           ITLAC-LPQNVGFYKKFGYTV-
2b3uB           FLVAEWNEPSINFYKRRGASD-
3d2pA           LFAL--STNTGEWFAERGFQT-
2bueA           IQTDPSNLRAIRCYEKAGFER-
3e0kA           VL----TTHSLHWFREQGFYE-
3dnsB           VNIIVDEEVSTQPFVELGFAF-
3cxqA           ITLEC-LPQNVGFYKKFGYTV-
2b3uA           FLVAEWNEPSINFYKRRGASD-
1cm0B           FLTYA-DEYAIGYFKKQGFSK-
2ae6B           SLRVATNQEAIRFYEKHGFVQ-
1bobA           EITVEDNEAFDDLRDRNDIQR-
3bj8C           MHFLVANEPSINFYKRRGASD-
1cm0A           FLTYA-DEYAIGYFKKQGFSK-
3bj7B           MHFLVANEPSINFYKRRGASD-
3bj8A           MHFLVANEPSINFYKRRGASD-
2ae6A           LRVAT-NQEAIRFYEKHGFVQ-
3dsbA           GRLYVENINAKATYESLNYEC-
2b4dB           FLVAEWNEPSINFYKRRGASD-
1b6bA           AVLMC-EDALVPFYQRFGFHP-
2b4bB           FLVAEWNEPSINFYKRRGASD-
2b4bA           FLVAEWNEPSINFYKRRGASD-
3eg7F           IYLHVANPKAVHLYEECGFVE-
2atrA           ATE---ETEKNVGFYRSGFEI-
3bj8B           MHFLVANEPSINFYKRRGASD-
3eg7E           IYLHVENPKAVHLYEECGFVE-
3eg7B           IYLAVENPKAVHLYEECGFVE-
1cjwA           AVLMC-EDALVPFYQRFGFHP-
2b4dA           FLVAEWNEPSINFYKRRGASD-
1b6bB           AVLMC-EDALVPFYQRFGFHP-
2d4pA           VALHLDPE--------------
3dr8A           AGIESQNAASIRLHHSLGFT--
3d3sB           LETTVGNQASRRTFAGLAGER-
3dr8B           AGIESQNAASIRLHHSLGFTV-
3dr6B           AGIESQNAASIRLHHSLGFTV-
2beiA           FRLAVLDWQRADLYKALGAQD-
3d3sA           LETTVGNQASRRTFAGLAGER-
3eg7A           IYLHVANPKAVHLYEECGFVE-
3dr6C           AGIESQNAASIRLHHSLGFTV-
3bj7A           MHFLVANEPSINFYKRRGASD-
3dr6A           AGIESQNAASIRLHHSLGFTV-
3d8pA           LGTIDKFISAQYFYSNNGFRE-
3d3sD           LETTASRRTFAGLAGERGAHV-
3eg7C           IYLAVENPKAVHLYEECGFVE-
2ae6C           SLRVATNQEAIRFYEKHGFVQ-
2aj6A           S---------------------
2bswA           LWCN-ARTSASGYYKKLGFSE-
3d3sC           LETTVGNQASRRTFAGLAGER-
2cnmA           LWLRASNAAAIALYESLGFNE-
2b5gA           FLVAEWNEPSINFYKRRGAS--
3c26A           AVYSW-NEPSLRLVHRLGFHQ-
2bl1A           AAIESGNAASIGLHRRLGFEI-
3d8pB           LGTIDKFISAQYFYSNNGFRE-
1bo4A           IYVQADDDPAVALYTKLG----
2ae6D           SLRVATNQEAIRFYEKHGFVQ-