[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB80292.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bxgA.bssp"
#ERROR : Can't open dsspfile "3dlxB.bssp"
#ERROR : Can't open dsspfile "3dlxA.bssp"
#ERROR : Can't open dsspfile "3bxeA.bssp"
#ERROR : Can't open dsspfile "3bxfB.bssp"
#ERROR : Can't open dsspfile "3ecsC.bssp"
#ERROR : Can't open dsspfile "3efbC.bssp"
#ERROR : Can't open dsspfile "3dlxC.bssp"
#ERROR : Can't open dsspfile "3cdkB.bssp"
#ERROR : Can't open dsspfile "3cdkD.bssp"
#ERROR : Can't open dsspfile "2bjqA.bssp"
#ERROR : Can't open dsspfile "3eh7A.bssp"
#ERROR : Can't open dsspfile "3bxeB.bssp"
#ERROR : Can't open dsspfile "3dlxD.bssp"
#ERROR : Can't open dsspfile "3ecsG.bssp"
#ERROR : Can't open dsspfile "2ahuA.bssp"
#ERROR : Can't open dsspfile "3ecsB.bssp"
#ERROR : Can't open dsspfile "3ecsD.bssp"
#ERROR : Can't open dsspfile "1b4aA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3by6E.bssp"
#ERROR : Can't open dsspfile "3ecsF.bssp"
#ERROR : Can't open dsspfile "3by6B.bssp"
#ERROR : Can't open dsspfile "2e1cA.bssp"
#ERROR : Can't open dsspfile "3by6C.bssp"
#ERROR : Can't open dsspfile "3ecsH.bssp"
#ERROR : Can't open dsspfile "3by6A.bssp"
#ERROR : Can't open dsspfile "2cfxA.bssp"
#ERROR : Can't open dsspfile "3edpB.bssp"
#ERROR : Can't open dsspfile "3by6D.bssp"
#ERROR : Can't open dsspfile "2efqA.bssp"
#ERROR : Can't open dsspfile "2e7wA.bssp"
#ERROR : Can't open dsspfile "2efoA.bssp"
#ERROR : Can't open dsspfile "2ek5B.bssp"
#ERROR : Can't open dsspfile "2cyyA.bssp"
#ERROR : Can't open dsspfile "2dbbB.bssp"
#ERROR : Can't open dsspfile "3bwgC.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"
#ERROR : Can't open dsspfile "3edpA.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "3bwgB.bssp"
#ERROR : Can't open dsspfile "2d45B.bssp"
#ERROR : Can't open dsspfile "3ecsA.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "2d45A.bssp"
#ERROR : Can't open dsspfile "3efbB.bssp"

## Summary of PDB Search
:248
    8e-26   9%  3bxgA  [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR
    1e-25  15%  3dlxB  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    8e-24  15%  3dlxA  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    2e-23   9%  3bxeA  [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR
    3e-23   9%  3bxfB  [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR
    5e-23  18%  3ecsC  [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
    6e-23  15%  3efbC  [x.x.x] PROBABLE SOR-OPERON REGULATOR
    6e-23  15%  3dlxC  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    9e-22  13%  3cdkB  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    5e-21  13%  3cdkD  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    3e-19   9%  2bjqA  [x.x.x] MFP2A
    4e-19  11%  3eh7A  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    5e-19  11%  3bxeB  [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR
    7e-19  15%  3dlxD  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    6e-18  21%  3ecsG  [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
    4e-17  12%  2ahuA  [x.x.x] PUTATIVE ENZYME YDIF
    7e-15  24%  3ecsB  [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
    8e-14  20%  3ecsD  [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
    1e-11   8%  1b4aA  [a.4.5 - d.74.2] ARGININE REPRESSOR
    4e-11  11%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    6e-11   8%  3by6E  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    9e-11  23%  3ecsF  [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
    7e-10   9%  3by6B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    5e-09  10%  2e1cA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    2e-08   9%  3by6C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    2e-08  25%  3ecsH  [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
    3e-08   9%  3by6A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    7e-08  14%  2cfxA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC
    1e-07  12%  3edpB  [x.x.x] LIN2111 PROTEIN
    2e-07  10%  3by6D  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    6e-07  10%  2efqA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    8e-07  10%  2e7wA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-06  10%  2efoA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-06   8%  2ek5B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    3e-06  14%  2cyyA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    5e-06  11%  2dbbB  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    6e-06  10%  3bwgC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-05  12%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    6e-05  16%  3edpA  [x.x.x] LIN2111 PROTEIN
    6e-05  12%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    9e-05   8%  3bwgB  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    1e-04  16%  2d45B  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    2e-04  26%  3ecsA  [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
    3e-04  12%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    5e-04  16%  2d45A  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    7e-04  12%  3efbB  [x.x.x] PROBABLE SOR-OPERON REGULATOR
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLANVSKELSYNE
3bxgA           ----------------------------------------------------------------SGDSDQ
3dlxB           --------------------------------------DIGAFAPEDIHIPQIYVHR-LIKGEKYEKRIE
3dlxA           ----------------------------------------------------------------------
3bxeA           ----------------------------------------------------------------SGDSDQ
3bxfB           ----------------------------------------------------------------SGDSDQ
3ecsC           -----------------------------------------------LFLRFISLASLEYSKCKKIIERL
3efbC           ------------------------------------------LWLEQQLKQKFGLK-----DVVVVSGND
3dlxC           --------------------------------------DIGAFAPEDIHIPQIYVHR-LIKGEKYEKRIE
3cdkB           ----------------------------------------------------------------------
3cdkD           ----------------------------------------------------------------------
2bjqA           --STPVIMKTKDGKDLLGYIDMSTEVAAVGVSGKSEQVAGGPIQDMLVLFRNVKAPPKGIKIY------D
3eh7A           ---------------------------------------------------------------------K
3bxeB           ----------------------------------------------------------------SGDSDQ
3dlxD           ----------------------------------------------------------------------
3ecsG           -----------------------------------LTSAIETLCGVDLFLRFISLAKCKKIIERGELFLR
2ahuA           ----------------------------------------------------------------------
3ecsB           ----------------------------------------------------------------------
3ecsD           -------------------------------------------------------FLRFISLYSKCKKII
1b4aA           ----QRHIKIREIIMSNDIETQDELVDRLREAGFNVSRDIKEMQLVKVPMANGRYKYSLPSDQKLKRALV
2ahvA           ----------------------------------------------------------------------
3by6E           -----------------------------------VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSN
3ecsF           ----------------------------------------------------------------------
3by6B           -----------------------------------VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSN
2e1cA           ---------IIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALGYSMLAFIL
3by6C           -----------------------------------VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSN
3ecsH           ----------------------------------------------------------------------
3by6A           -----------------------------------VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSN
2cfxA           MKLDQIDLNIIEELKKDSRLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEVD--QKKLGLPVSCI
3edpB           -----------------------------------IRRAVDLLVEEGLVVRKNGVGLYVQPKLTAQNILE
3by6D           -----------------------------------VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSN
2efqA           -MDEIDLRI-LKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLNLDYIVITS
2e7wA           -MDEIDLRI-LKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLNLDYIVITS
2efoA           -MDEIDLRI-LKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLNLDYIVITS
2ek5B           --ASLIEDSIVDGTLSIDVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQAPALIRERD
2cyyA           VPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEAAFILVKVKAG
2dbbB           RKLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLI
3bwgC           -----ETYIEEHQLQQGDKLPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRKGYISL
2ek5A           -----------------------------------ARNGLTLLVEAGILYKKRGGFVSAQAPALIRERRD
3edpA           -----------------------------------IRRAVDLLVEEGLVVRKNGVGLYVQPKLTA-QNIL
2du9A           -----------------------------------ARNGLTLLVEAGILYKKRGGFVSAQAPALIRERRD
3bwgB           -----ETYIEEHQLQQGDKLPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRKSLLSN
2d45B           -ISSAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVE----E
3ecsA           ----------------------------------------------------------------------
2ek5C           -----------------------------------ARNGLTLLVEAGILYKKRGGFVSAQAPALIRERRD
2d45A           -ISSAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVE----E
3efbB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQKNIKCYVIG
3bxgA           SPWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMMTPDSKNRE--------------LLFVPAR
3dlxB           RLSIRDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQINAGKET
3dlxA           ------DVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPDLINAGKET
3bxeA           SPWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMM--------------TPDSKNRELLFVPAR
3bxfB           SPWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMMTPDSKNRE--------------LLFVPAR
3ecsC           FLRRISLSRNKIADLCHTFIKDGATILTHAYSRV--VLRVLEKKRFSVYVTESKKAKALCHLNVPVTVVL
3efbC           EDEETQLAGLHGAQLLDRLLEPGDIVGFSWGRAVSALVENLPQAICVPIIGGPSGKLEAAKLKGEADFPA
3dlxC           RLSIRDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGPRQHEADADLINAGKET
3cdkB           -------ARKRMVKRAVQEIKDGMNVNLGIGMPTLVANEIPDGVHVMLQSENGLLGIGPYPEDADLINAG
3cdkD           -------ARKRMVKRAVQEIKDGMNVNLGIGMPTLVANEIPDGVHVMLQSENGLLGIGPYPEDADLINAG
2bjqA           DTWLDLKYRDPFPAARNPIAAGGRKVKSDDGTEMFQYVALWYEHGQPVFGRAYPD-----SADKTLANFG
3eh7A           DVLAEYASRIVSAEEAVKHIKNGERVALSHAAGVQSCVDALVQQADLFV-------------EIYHLCLG
3bxeB           SPWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMMPDSKNRELLFGGLGEDVKNQANTICAHMA
3dlxD           ----SIRKRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPADADLINAG
3ecsG           RISLS---RNKIADLCHTFIKDGATILTHAYSRV--VLRVLEKKRFSVYVTESQKAKALCHLNVPVTVVL
2ahuA           ------LNQRKLVARRALFERKGAVGNVGVGIADGIGLVAREEGCADDF--------ILTVETGPIGGIT
3ecsB           --------RNKIADLCHTFIKDGATILTHAYSRV--VLRVLEKKRFSVYDLSGKKAKALCHLNVPVTVV-
3ecsD           ERGELFLRRNKIADLCHTFIKDGATILTHAYSRV--VLRVLEKKRFSVYDLSGKKAKALCHLNVPVTVV-
1b4aA           DVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTIGDDTCLIICRTPKDAKKVSNQ--------
2ahvA           ------NQRKLVARRALFEMRKGAVGNVGVGIADGIGLVAREGCADDFILTVETGPIGGITANVNT----
3by6E           QNRLLADLSQVIAELIKSGVKGERIKKIVNDILGGKN---------------------------------
3ecsF           ---------NKIADLCHTFIKDGATILTHAYSRV--VLRVLEKKRFSVYDLSGKKAKALCHLNVPVTVV-
3by6B           QNRLLADLSQVIAELIKSGVKGERIKKIVN----------------------------------------
2e1cA           VKVKAGKYSEVAS--NLAKYPEIVEVYETTGDYDMVVKIRTKNEELNNFLDLIGSIPGV--EGTHTMIVL
3by6C           QNRLLADLSQVIAELIKSGVKGERIKKIVN----------------------------------------
3ecsH           ---------NKIADLCHTFIKDGATILTHAYSRV--VLRVLEKKRFSVYDLSGKKAKALCHLNVPVTVV-
3by6A           QNRLLADLSQVIAELIKSGVKGERIKKIVN----------------------------------------
2cfxA           VEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYMLKINAESEAVEDFINKTSPY-----AQTVTHVIF
3edpB           TGVLKKDIKDFYIRKAGKFYAEIF---GKENELVYSIKFVQKSEHGATLDRLILPLG-------------
3by6D           QNRLLADLSQVIAELIKSGVKGER----------------------------------------------
2efqA           VKAKYGKNYHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTEEFMEKFLERVMSIPEVE-RTSAQVVV
2e7wA           VKAKYGKNYHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTEEFMEKFLERVMSIPEVE-RTSTQVVV
2efoA           VKAKYGKNAHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTEEFMEKFLERVMSIPEVE-RTSTQVVV
2ek5B           AAFAATYVAPLIDESIHLGFTRARIHALLD----------------------------------------
2cyyA           KYSEVASNLAKYPEIVEVYETTGDYDVVKIRTKNSEELNNF--LDLIGSIPGVEGTHTIVLKTHK-----
2dbbB           KSKVPSDADKVISEISD--IEYVKSVEKGVGRYNIIVRLLLDIKDAENLISEFLQRIKNAE-NVEVILIS
3bwgC           LSLEDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKR------------------------------
2ek5A           AAFAATYVAPLIDESIHLGFTRARIHALLD----------------------------------------
3edpA           ETGVKNLKKDIKDFYIRKAGKFYAEIFGKENELVYSIKFVQK----------------------------
2du9A           AAFAATYVAPLIDESIHLGFTRARIHALLD----------------------------------------
3bwgB           QDLEDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYIN-------------------------
2d45B           SDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELR----------------------------
3ecsA           --------RNKIADLCHTFIKDGATILTHAYSRV--VLRVLEKKRFSVYDLSGKKAKALCHLNVPVTVV-
2ek5C           AAFAATYVAPLIDESIHLGFTRARIHALLD----------------------------------------
2d45A           SDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELR----------------------------
3efbB           --------GLHGAQLLDRLLEPGDIVGFSWGRAVSALVENLQSRQLICVPIIGGPSGSAAAKKGESHLAD


                         +         .         .         .         .         *         .:210
query           GNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKF
3bxgA           GGLGEDVKNQANTICAHMAEKASGTYRLLFVPGQLSQ-GAYSSIIEEPSVKEVLNTIKSASMLVHGIGEA
3dlxB           VTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIKGMGGAMDLVSSAKTKVVVTNAHKI
3dlxA           VTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMVSSAKTKVVVTMEHSAK
3bxeA           GGLGEDVKNQANTICAHMAEKASGTYRLLFVPGQLSQ-GAYSSIIEEPSVKEVLNTIKSASMLVHGIGEA
3bxfB           GGLGEDVKNQANTICAHMAEKASGTYRLLFVPGQLSQ-GAYSSIIEEPSVKEVLNTIKSASMLVHGIGEA
3ecsC           DA--------------AVGYIEKADLVIVGAEGVVENGGIINK--IGTNQAVCAKAQNKPFYVVAESFKF
3efbC           LLDNPLIRNGIQSQHFKTIYWDNLDIALVGIGSPARQVAGVETNSEKTLSIENKLKQARYSIGIASEEKY
3dlxC           VTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMVSSAKTKVVVTMEHSAK
3cdkB           KTEVTGASYFDSAESFAMIRGGHIDLAILGGMEVSEQGDLANWKVKGMGGAMDLVNGAKRIVVIMEHVNK
3cdkD           KTEVTGASYFDSAESFAMIRGGHIDLAILGGMEVSEQGDLANGMVKGMGGAMDLVNGAKRIVVIMENSKV
2bjqA           WGGQENAGAEIGSFQ----MLVVPDPDILGFEYKWIPYKEAKAGGPFKPLHVGECTPCLL--KDANGTER
3eh7A           EGRADFIPVFFYEVPSIRKDILHIDVAIVQLSPDEN--GYCSFGVSCDYSKP-AAESAHLVIGEINRQPY
3bxeB           EKASGTYRLLFVPGQLSQIEEPSVKEVLNTIKSASMLVHGIGEAKTMA---QRRNTPLEDLKKIDDNDAV
3dlxD           KTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGVSSAKTKVVVTMEHSA
3ecsG           DAAVGYI--------------EKADLVIVGAEGVVENGGIINKI--GTNQAVCAKAQNKPFYVVAESFKF
2ahuA           SGANVNTRAILDTSQFDFYHGGGLDVCYLSFAEVDQHGNVKFNGKIGTGGFIDISATSKKIIFCGTLTAG
3ecsB           ------------LDAAVGY-IEKADLVIVGAEGVVENGGIINK--IGTNQAVCAKAQNKPFYVVAESFKF
3ecsD           ------------LDAAVGYIE-KADLVIVGAEGVVENGGIINKGTNQAV---CAKAQNKPFYVVAESFKF
1b4aA           ----------------------------------------------------------------------
2ahvA           ------RAILDMTSQFDFYHGGGLDVCYLSFAEVDQHGNVGVGKIMGTGGFIDISATSKKIIFCGTLTAG
3by6E           ----------------------------------------------------------------------
3ecsF           --------LDAAVGYIE-----KADLVIVGAEGVVENGGIINKGTNQAV---CAKAQNKPFYVVAESFKF
3by6B           ----------------------------------------------------------------------
2e1cA           KTHKETT---------------------------------------------------------------
3by6C           ----------------------------------------------------------------------
3ecsH           ------------LDAAVGYIE-KADLVIVGAEGVVENGGIINKGTNQAV---CAKAQNKPFYVVAESFKF
3by6A           ----------------------------------------------------------------------
2cfxA           SEID------------------------------------------------------------------
3edpB           ----------------------------------------------------------------------
3by6D           ----------------------------------------------------------------------
2efqA           KIIKESP---------------------------------------------------------------
2e7wA           KIIKESP---------------------------------------------------------------
2efoA           KIIKESP---------------------------------------------------------------
2ek5B           ----------------------------------------------------------------------
2cyyA           ----------------------------------------------------------------------
2dbbB           EVRKFEI---------------------------------------------------------------
3bwgC           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
3edpA           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
3bwgB           ----------------------------------------------------------------------
2d45B           ----------------------------------------------------------------------
3ecsA           ------------LDAAVGYIE-KADLVIVGAEGVVENGGIINKGTNQAV---CAKAQNKPFYVVAESFKF
2ek5C           ----------------------------------------------------------------------
2d45A           ----------------------------------------------------------------------
3efbB           FPALLDIRNGIQSQHFISAYWDNLDIALVGIGSPNWH---------------------------------


                         .         .         .         +         .         .         .:280
query           GEISTIKFSDINKCVIITNEKPKDNTYDKKTDIKVVDI
3bxgA           KTMAQRRNTPLEDLKKIDDNDAVTEAFGYYFNADGEVV
3dlxB           MEKCTLPLTGKQCNRIITEKAVFD--VDKKKGLTLIEL
3dlxA           GNAHKIME------------------------------
3bxeA           KTMAQRRNTPLEDLKKIDDNDAVTEAFGYYFNADGEVV
3bxfB           KTMAQRRNTPLEDLKKIDDNDAVTEAFGYYFNADGEVV
3ecsC           VRLFPLNQQDVPDKFKYKQDLKEEHPWVDYTAPSLIT-
3efbC           SIIGALRGKYIN--CLVTNSST----------------
3dlxC           GNAHKIME------------------------------
3cdkB           HGESKVKK------------------------------
3cdkD           KKTCSLPLTGQKVVRLITDLAVFDFVNGTLTELTIEEV
2bjqA           LGNLHMGMEKA----TAGLAGKD---------------
3eh7A           V-------------------------------------
3bxeB           TEAFGYYF------------------------------
3dlxD           --------------------------------------
3ecsG           VRLFPLNQQDVP--------------------------
2ahuA           SLKTEIADGRVKK--FIRELPEITFSGKIALERGLDVR
3ecsB           VRLFPLNQQDVP--------------------------
3ecsD           VRLFPLNQQDVPDKFKYKADGQDLKEEHPWVDY-----
1b4aA           --------------------------------------
2ahvA           SLKTEIADGKL---------------------------
3by6E           --------------------------------------
3ecsF           VRLFPLNQQDVPDKFKYKALKEEHPWVD----------
3by6B           --------------------------------------
2e1cA           --------------------------------------
3by6C           --------------------------------------
3ecsH           VRLFPLNQQDVPDKFKYKEEHP----------------
3by6A           --------------------------------------
2cfxA           --------------------------------------
3edpB           --------------------------------------
3by6D           --------------------------------------
2efqA           --------------------------------------
2e7wA           --------------------------------------
2efoA           --------------------------------------
2ek5B           --------------------------------------
2cyyA           --------------------------------------
2dbbB           --------------------------------------
3bwgC           --------------------------------------
2ek5A           --------------------------------------
3edpA           --------------------------------------
2du9A           --------------------------------------
3bwgB           --------------------------------------
2d45B           --------------------------------------
3ecsA           VRLFPLNQQDVDKFKYLKEEHP----------------
2ek5C           --------------------------------------
2d45A           --------------------------------------
3efbB           --------------------------------------