[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB80582.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2beiB.bssp"
#ERROR : Can't open dsspfile "2bl1A.bssp"
#ERROR : Can't open dsspfile "3cxsA.bssp"
#ERROR : Can't open dsspfile "2dxqA.bssp"
#ERROR : Can't open dsspfile "2dxqB.bssp"
#ERROR : Can't open dsspfile "3cxqA.bssp"
#ERROR : Can't open dsspfile "2beiA.bssp"
#ERROR : Can't open dsspfile "3dr8A.bssp"
#ERROR : Can't open dsspfile "3dsbA.bssp"
#ERROR : Can't open dsspfile "1bo4A.bssp"
#ERROR : Can't open dsspfile "2b3uA.bssp"
#ERROR : Can't open dsspfile "1cm0B.bssp"
#ERROR : Can't open dsspfile "1bo4B.bssp"
#ERROR : Can't open dsspfile "3ec4A.bssp"
#ERROR : Can't open dsspfile "3bj7A.bssp"
#ERROR : Can't open dsspfile "1cjwA.bssp"
#ERROR : Can't open dsspfile "3d8pA.bssp"
#ERROR : Can't open dsspfile "1b6bA.bssp"
#ERROR : Can't open dsspfile "3bj8C.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "2b5gB.bssp"
#ERROR : Can't open dsspfile "2bswA.bssp"
#ERROR : Can't open dsspfile "3bj7B.bssp"
#ERROR : Can't open dsspfile "3cxpA.bssp"
#ERROR : Can't open dsspfile "2a6aB.bssp"
#ERROR : Can't open dsspfile "1b6bB.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "3dr6B.bssp"
#ERROR : Can't open dsspfile "2aj6A.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "3eg7F.bssp"
#ERROR : Can't open dsspfile "3dr6A.bssp"
#ERROR : Can't open dsspfile "3bj8A.bssp"
#ERROR : Can't open dsspfile "2cnmA.bssp"
#ERROR : Can't open dsspfile "2bueA.bssp"
#ERROR : Can't open dsspfile "3efaA.bssp"
#ERROR : Can't open dsspfile "2b4dB.bssp"
#ERROR : Can't open dsspfile "3d8pB.bssp"
#ERROR : Can't open dsspfile "3dr6C.bssp"
#ERROR : Can't open dsspfile "3eg7B.bssp"
#ERROR : Can't open dsspfile "3c26A.bssp"
#ERROR : Can't open dsspfile "2ae6A.bssp"
#ERROR : Can't open dsspfile "2atrA.bssp"
#ERROR : Can't open dsspfile "2b4dA.bssp"
#ERROR : Can't open dsspfile "3eg7A.bssp"
#ERROR : Can't open dsspfile "2b4bA.bssp"
#ERROR : Can't open dsspfile "3e0kA.bssp"
#ERROR : Can't open dsspfile "3eg7E.bssp"
#ERROR : Can't open dsspfile "3bj8B.bssp"
#ERROR : Can't open dsspfile "3dr8B.bssp"
#ERROR : Can't open dsspfile "2b4bB.bssp"
#ERROR : Can't open dsspfile "3eg7C.bssp"
#ERROR : Can't open dsspfile "2b3uB.bssp"
#ERROR : Can't open dsspfile "2b3vA.bssp"
#ERROR : Can't open dsspfile "2ae6C.bssp"
#ERROR : Can't open dsspfile "3d3sD.bssp"
#ERROR : Can't open dsspfile "2ae6D.bssp"
#ERROR : Can't open dsspfile "3ec4B.bssp"
#ERROR : Can't open dsspfile "2c27A.bssp"
#ERROR : Can't open dsspfile "1b87A.bssp"
#ERROR : Can't open dsspfile "2ae6B.bssp"
#ERROR : Can't open dsspfile "2b5gA.bssp"
#ERROR : Can't open dsspfile "3d3sB.bssp"
#ERROR : Can't open dsspfile "3d3sC.bssp"
#ERROR : Can't open dsspfile "2d4pA.bssp"
#ERROR : Can't open dsspfile "3d3sA.bssp"

## Summary of PDB Search
:147
    6e-13  13%  2beiB  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    1e-12  15%  2bl1A  [x.x.x] PUTATIVE PHOSPHINOTHRICIN N-ACETYLTRANSFERASE
    1e-12  19%  3cxsA  [x.x.x] GLUCOSAMINE 6-PHOSPHATE N-ACETYLTRANSFERASE
    3e-12  13%  2dxqA  [x.x.x] ACETYLTRANSFERASE
    4e-12  14%  2dxqB  [x.x.x] ACETYLTRANSFERASE
    6e-12  18%  3cxqA  [x.x.x] GLUCOSAMINE 6-PHOSPHATE N-ACETYLTRANSFERASE
    6e-12  13%  2beiA  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    1e-11  18%  3dr8A  [x.x.x] YNCA
    2e-11  20%  3dsbA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    5e-11  13%  1bo4A  [d.108.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    7e-11  14%  2b3uA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-10  16%  1cm0B  [d.108.1] P300/CBP ASSOCIATING FACTOR
    1e-10  12%  1bo4B  [d.108.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    2e-10  11%  3ec4A  [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY
    2e-10  18%  3bj7A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-10  17%  1cjwA  [d.108.1] PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
    3e-10  21%  3d8pA  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    4e-10  17%  1b6bA  [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    4e-10  18%  3bj8C  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    6e-10  17%  1cm0A  [d.108.1] P300/CBP ASSOCIATING FACTOR
    9e-10  16%  2b5gB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-09  15%  2bswA  [x.x.x] GLYPHOSATE N-ACETYLTRANSFERASE
    1e-09  17%  3bj7B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-09  20%  3cxpA  [x.x.x] GLUCOSAMINE 6-PHOSPHATE N-ACETYLTRANSFERASE
    1e-09   7%  2a6aB  [x.x.x] HYPOTHETICAL PROTEIN TM0874
    2e-09  15%  1b6bB  [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    2e-09  13%  1bobA  [x.x.x] HISTONE ACETYLTRANSFERASE
    2e-09  17%  3dr6B  [x.x.x] YNCA
    2e-09  12%  2aj6A  [x.x.x] HYPOTHETICAL PROTEIN MW0638
    3e-09  14%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    4e-09  14%  3eg7F  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    5e-09  16%  3dr6A  [x.x.x] YNCA
    5e-09  17%  3bj8A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    6e-09  19%  2cnmA  [x.x.x] MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN
    8e-09  19%  2bueA  [x.x.x] AAC(6')-IB
    1e-08  16%  3efaA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    1e-08  16%  2b4dB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-08  20%  3d8pB  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    2e-08  16%  3dr6C  [x.x.x] YNCA
    2e-08  15%  3eg7B  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    2e-08  10%  3c26A  [x.x.x] PUTATIVE ACETYLTRANSFERASE TA0821
    2e-08  15%  2ae6A  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    2e-08  18%  2atrA  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    2e-08  17%  2b4dA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-08  15%  3eg7A  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    3e-08  17%  2b4bA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-08  14%  3e0kA  [x.x.x] AMINO-ACID ACETYLTRANSFERASE
    4e-08  15%  3eg7E  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    5e-08  17%  3bj8B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    6e-08  17%  3dr8B  [x.x.x] YNCA
    1e-07  16%  2b4bB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-07  15%  3eg7C  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    3e-07  16%  2b3uB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    6e-07  17%  2b3vA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    7e-07  15%  2ae6C  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    9e-07  16%  3d3sD  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    2e-06  14%  2ae6D  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    3e-06  11%  3ec4B  [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY
    4e-06  18%  2c27A  [x.x.x] MYCOTHIOL SYNTHASE
    5e-06  14%  1b87A  [d.108.1] PROTEIN (AMINOGLYCOSIDE N6'-ACETYLTRANSFERASE
    7e-06  14%  2ae6B  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    1e-05  18%  2b5gA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-05  13%  3d3sB  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    4e-05  14%  3d3sC  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    5e-05  13%  2d4pA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1254
    5e-04  15%  3d3sA  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
:147

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNIYEFKKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEKIEGVILGNLE
2beiB           ---IREAKEGDCGDILRLIRELAEFESDQVKISEEALRADGFG----DNPFYHCLVAEICVVGYGIYYFI
2bl1A           --SIRDAGVADLPGILAIYNDAVGNTWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGASYGDWR
3cxsA           ---LRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKS-GDYYVTVVEDVTLGQIVATATLIIE
2dxqA           --SLRAAGPGDLPGLLELYQVLNPSDPELTTQEAGAVFAALAQ----PGLTIFVATENGKPVATAIVPNL
2dxqB           --SLRAAGPGDLPGLLELYQVLNPSDPELTTQEAGAVFAALAQ----PGLTIFVATENGKPVATATLLIV
3cxqA           GLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKS-GDYYVTVVEDVTLGQIVATATLIIK
2beiA           --RIREAKEGDCGDILRLIRELA--EFEKLKISEEALRADGFGD--NPFYHCLVAEILGPCVVYGIYYFI
3dr8A           ---IRFADKADCAAITEIYVLHTAAIWNDRTVDTDNRLAWYEAR-QLLGYPVLVSEENGVVTGASFGDWR
3dsbA           --------RDDLDTIAKFNYNLA-KETEGKELDDVLTKGVKALLLDERKGKYHVYTVFDKVVAQIYTYEW
1bo4A           IIRTCRLGPDQVKSMRAALDLFGREFGDVATYQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVK
2b3uA           ---IRPATAADCSDILRLIKELAQVITEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTY
1cm0B           VIEFHVVGNSLNQKPNKKILMWLVGQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGIC--FR
1bo4B           IIRTCRLGPDQVKSMRAALDLFGREFGDVATYQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVL
3ec4A           ---DGPVPSFDDPGIVALG-----ETDVPETALALATEPGPWASGTWRYGQFYGVRIDGRLAAAGER---
3bj7A           ---IRPATASDCSDILRLIKELAKYEEDQVILTEKDLQEDGFGEHPFHCLVAEVPPEGHSIVGFAYYFTY
1cjwA           ---FRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTL----CPELSLGWFVEGRLVAFIIGSLW
3d8pA           --NIIEYNRSYKEELIEFILSIQKNEIKIDRDDQPDLENIEHNYLNSGGQFWLAINNHQNIVGTIG----
1b6bA           ---FRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLT----LCPELSLGWFVEGRLVAFIIGSLW
3bj8C           ---IRPATASDCSDILRLIKELAKYEYMEDLTEKDLQEDGFGEHPFYHCLVAEVPPEGHSIVGFAYYFTY
1cm0A           ---FHVVGNSLNQKPNKKILMWLVGQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGIC--FR
2b5gB           ---IRPATAADCSDILRLIKELAYEYEEQVILTEKDLLEDGFFY-HCLVAEVPWTPEGHSIVGFAYYFTY
2bswA           --EVKPINAEDTYELRHRI--------LRPNQPIEACFESDLL----RGAFHLGGYYGGKLISIASFHQH
3bj7B           ---IRPATASDCSDILRLIKELAKYEYMEDQVEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFT
3cxpA           ---LRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGD-YYVTVVEDVTLGQIVATATLIIE
2a6aB           -----------------------------------------------APLNSFETAKSCPADGVVL--VA
1b6bB           ---FRCLTPEDAAGVFEIE-----REAFDEVQHFLTLCPELSLGWFVEGRLVIIGSLWDEERLTQESLAL
1bobA           EFVVYKSSLVDDFARRMHR-----RVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYW
3dr6B           ---IRFADKADCAAITEIYNHAVLHTIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDW
2aj6A           ---------NYIKQIANIHETLLSQVESKCTKLSIALRYEICSRLEHTNDKIYIYENEGQLIAFIWGHFS
3d2pA           -------------------------PHIAALIRPLILLHRSREYLENHISEFSILEHDGNLYGCA--ALK
3eg7F           ---LRALERGDLRFIHNLNNNRNISYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELI
3dr6A           ---IRFADKADCAAITEIYNHAVLHTAAIRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWR
3bj8A           ---IRPATASDCSDILRLIKELAKYEYMEDQVEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFT
2cnmA           MNTISILSTTDLPAAWQIE-----QRAHAFPWSEKTFFGNQGE-----RYLNLKLTADDRMAAFAIT---
2bueA           ---LRLMTEHDLAMLYEWHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVA
3efaA           -------------------------EERGISAD-VEFDVKDTD----QCEYAVLYLQPDLPITTLRL---
2b4dB           ---IRPATAADCSDILRLIKELAYEYEEQVILTEKDLLEDGFGELVAEVPKEHWTPEGHSIVGFAYYFTY
3d8pB           --NIIEYNRSYKEELIEFILSIQKNEIKIDRDDQPDLENIEHNYLNSGGQFWLAINNHQNIVGTIG----
3dr6C           ---IRFADKADCAAITEIYNHAVLHTAADRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWR
3eg7B           ---LRALERGDLRFIHNLNNNRNISYFEEPYESFDELEELYNKHIHDAERRFVVEDAQKNLIGLV--ELI
3c26A           --VFDRGSPSDIDEIKTFTSNTWKVGYYTDLYSKLADTGTDDYVDKVNDGSVYVLRVSGRPVATIH----
2ae6A           ---IRLVAEADWPALHAL---------DQIISLAAYQEK--------KDETIFVAISGQQLAGFIVHPPT
2atrA           --TIKKQEIVKLEDVLHL---------YQAVGWTNELEQALSH-----SLVIYLALDGDAVVGLIRLV--
2b4dA           ---IRPATAADCSDILRLIKELAKYEYEEQVILTEKDEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTY
3eg7A           ---LRALERGDLRFIHNLNNNRNISYWFEEPYESELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEI
2b4bA           ---IRPATAADCSDILRLIKELARYEYEEQVILTEKDEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTY
3e0kA           -----------------------------HPLEEQGILRRSREQLEQEIGKFTIIEKDGLIIGCAALY--
3eg7E           ---LRALERGDLRFIHNLNNNRNISYWFEEPYESELEELYNKHIHDNAERRFVVEDAQKNLIGLV--ELI
3bj8B           ---IRPATASDCSDILRLIKELAKYEYMEDQQEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFT
3dr8B           ---IRFADKADCAAITEIYNHAVLHTAAIRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWR
2b4bB           ---IRPATAADCSDILRLIKELAVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTY
3eg7C           ---LRALERGDLRFIHNLNNNRNISYWFEEPYESELEELYNKHIHDNAERRFVVEDAQKNLIGLVE--LI
2b3uB           ---IRPATAADCSDILRLIKELARYEYEEQVILLEDGFPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTYD
2b3vA           ---IRPATAADCSDILRLIKELARYEYEEQVILTEKDEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTY
2ae6C           --TIRLVAEADWPALHALD-----QIISLAAYQEK------------KDETIFVAISGQQLAGFIVHPPT
3d3sD           ---LRPPRRNDGAAIHQL---------VSECPDLNSLYAYLLLCEHHAHTCVVAESPGGRIDGFVSAYLL
2ae6D           --TIRLVAEADWPALHALD-----QIISLAAYQEK------------KDETIFVAISGQQLAGFIVHPPT
3ec4B           ---DGPVPSFDDPGIVALGETDVPETALALATEPPWASGTW------RYGQFYGVRIDGRLAAAGER---
2c27A           --------------------------GWTAVQLAERRGEAWFDP---DGLILAFGDSPRERPGRLLGFHW
1b87A           --IISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMN----PERIAVAAVDQDELVGFIGAIPQ
2ae6B           --TIRLVAEADWPALHALDQIILAAYQEKKDETI------------------FVAISGQQLAGFIEVHPP
2b5gA           ---IRPATAADCSDILRLILAKYEQVILTEKDLLEDGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTY
3d3sB           ---LRPPRRNDGAAIHQL---------VSECPDLNSLYAYLLLCEHHAHTCVVAESPGGRIDGFV-SAYL
3d3sC           ---LRPPRRNDGAAIHQL---------VSECPDLNSLYAYLLLCEHHAHTCVVAESPGGRIDGFVSAYLL
2d4pA           --RFRPFTEEDLDRLNRLA-----GKRPVSLGALRFFA---------RTGHSFLAEEGEEPMGFALAQAV
3d3sA           -----------------------------------------------AHTCVVAESPGGRIDGFVSAYLL


                         .         .         *         .         .         .         .:140
query           QWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMKGSTAEAFYNKRGYEIPKELI
2beiB           YSTWKGRTIYLEDIYVPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRADLYKALGAQD-----
2bl1A           PFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVVAAIESGNAASIGLHRRLGFEISGQPL
3cxsA           FIHSCAKRGRVEDVVVSDECRKQLGKLLLSTL--TLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENY
2dxqA           TRAARPYAFIENVVTLEARRGRGYGRTVVRHAIETAFGANCYKVLLTGRHDPAVHAFYESCGFVQ-----
2dxqB           PNLTRAARPYAFIETLEARRGRGYGRTVVRHAIETAFGANCYKVLLTGRHDPAVHAFYESCGFVQNKTGF
3cxqA           FIHSCAKRGRVEVVVSDECRGKQLGKLLLSTLT--LLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENY
2beiA           YSTWKGRTIYLEDIYVPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRADLYKALGAQD-----
3dr8A           SFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVVAGIESQNAASIRLHHSLGFTV-----
3dsbA           SDWRNGNFLIQSVYVDKEYRRKGIFNYLFNYIKNICDKDENIVGRLYVEKENIAKATYESLNYECDYNY-
1bo4A           FEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDAVALYTKLG--------
2b3uA           -DPWIGKLLYLEDFFVSDYRGFGIGSEILKNLSQVARCR--CSSHFLVAEWNESINFYKRRGASDLSSE-
1cm0B           MFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYH--IKHDILNFLTYADEYAIGYFKKQGFSKEIKIT
1bo4B           PKFEQPEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDAVALYTK----------
3ec4A           -RPAPNLAEVSGVCTWPEYRGRGLAARLIRKVIAGAARG--EVPYLHSYASNAAIRLYESLGFRA-----
3bj7A           DPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNESINFYKRRGASD-----
1cjwA           DEERGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQP-AVRRAVLMCEDALVPFYQRFGFHPSLTFT
3d8pA           -LIRLDNNSALKKFVDKGYRNLKIGKKLLDKVITCKEQNIDGIYLGTIDKFISAQYFYSNNGFREIKRGR
1b6bA           DEERGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQP-AVRRAVLMCEDALVPFYQRFGFH------
3bj8C           DPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNESINFYKRRGASD-----
1cm0A           MFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYH--IKHDILNFLTYADEYAIGYFKKQGFSKEIKIT
2b5gB           DPWIG-KLLYLEDFFVSDYRGFGIGSEILKNLSQVA--RCRCSSHFLVAEWNESINFYKRRGASD-----
2bswA           SELQGQKQYQLRGATLEGYREQKAGSSLIKHAEEIL--RKRGADLLWCNARTSASGYYKKLGFSEPVGPH
3bj7B           YDPWIGKLLLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNESINFYKRRGASD-----
3cxpA           HHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLT--LLSKKLNCYKITLACLPQNVGFYKKFGYTVSEENY
2a6aB           RRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISAVLVEESERLFR-----
1b6bB           HRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLM-CEDALVPFYQRFGFHPSLTFT
1bobA           HYIDKKFRAISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKL-
3dr6B           RSFDGFRYTEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVVAGIESQNAASIRLHHSLGFTVWLDLT
2aj6A           NEKSVN---IELLYVEPQFRKLGIATQLKIALEKWA--KTNAKRISNT----------------------
3d2pA           TFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALS---TNTGEWFAERGFQTASEDH
3eg7F           EINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVEKAVHLYEECGFVEYQDVK
3dr6A           SFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVVAGIESQNAASIRLHHSLGFTVWLDLT
3bj8A           YDPWIGKLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNESINFYKRRGASD-----
2cnmA           -QVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAIALYESLGFNE-----
2bueA           LETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDEVTKIQTDPSPSNLAIRCYEKAGFERGPAVY
3efaA           -EPQADHVRFGRVCTRKAYRGHGWGRQLLTAAEEWATQRGFTHGEIHG--ELTAQRFYELCGYRVTAGPV
2b4dB           DPWIGKLLYL-EDFFVSDYRGFGIGSEILKNLSQVARCR--CSSHFLVAEWNESINFYKRRGASD-----
3d8pB           -LIRLDNNSALKKFVDKGYRNLKIGKKLLDKVITCKEQNIDGIYLGTIDKFISAQYFYSNNGFREDVDNR
3dr6C           SFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVVAGIESQNAASIRLHHSLGFTVWLDLT
3eg7B           EINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPAVHLYEECGFVEEGHLK
3c26A           -EKLPDGSVLGGLRVHPEYRGSRLGSIQETIQFLRGKTERLRSAVYSWNE--PSLRLVHRLGFHQVEEYP
2ae6A           SLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDAE--ISGIHKLSLRVATNQAIRFYEKHGFVQYCDDY
2atrA           -GDGFSSVFVQDLIVLPSYQRQGIGSSLKEALGNFKEAYQVQLATEET----EKNVGFYRSGFEI-----
2b4dA           DPWIGKLLYL-EDFFVSDYRGFGIGSEILKNLSQVARCR--CSSHFLVAEWNESINFYKRRGASD-----
3eg7A           NYIH--RSAEFQIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPAVHLYEECGFVEEGHLK
2b4bA           DPWIGKLLYL-EDFFVSDYRGFGIGSEILKNLSQVARCR--CSSHFLVAEWNESINFYKRRGASD-----
3e0kA           -PYSEERKAEACVAIHPDYRDGNRGLLLLNYKHRSKSENINQIFVLTT----HSLHWFREQGFYEVGVDK
3eg7E           EINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILHKIYLHVAVENPKAVHLYEECGFVEEGHLK
3bj8B           YDPWIGKLLLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNESINFYKRRGASD-----
3dr8B           SFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVVAGIESQNAASIRLHHSLGFTV-----
2b4bB           DPWIGKLLYL-EDFFVSDYRGFGIGSEILKNLSQVARCR--CSSHFLVAEWNESINFYKRRGASD-----
3eg7C           EINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILHKIYLHVAVENPKAVHLYEECGFVEEGHLK
2b3uB           PWIG--KLLYLEDFFVSDYRGFGIGSEILKNLSQVA--RCRCSSHFLVAEWNESINFYKRRGASD-----
2b3vA           DPWIG-KLLYLEDFFVSDYRGFGIGSEILKNLSQVA--RCRCSSHFLVAEWNESINFYKRRGASD-----
2ae6C           SLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKD-AEISGIHKLSLRVATNQEAIRFYEKHGFVQEAHF-
3d3sD           PTRPD-VLFVWQVAVHSRARGHRLGRALGHILER-QECRHVRHLETTVQASRRFAGLAGERGAHV-----
2ae6D           SLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDAE--ISGIHKLSLRVATNQAIRFYEKHGFVQEAHFY
3ec4B           -RPAPNLAEVSGVCTWPEYRGRGLAARLIRKVIAGA--ARGEVPYLHSYASNAAIRLYESLGFRA-----
2c27A           TKDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLKTLVLLYVESDNVAVRTYQSLGFTT-----
1b87A           YGITGWE--LHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTLSQTDLYEHTFDKVA
2ae6B           TSLAAHQKQLLSIGVSPDFQDQGIGGSLLSYIKDA-EISGIHKLSLRVATNQEAIRFYEKHGFVQYCDDY
2b5gA           DPWIGKLLYLEDFFV-SDYRGFGIGSEILKNLSQVA--RCRCSSHFLVAEWNESINFYKRRGASD-----
3d3sB           LPTRPDVLFVWQVAVHSRARGHRLGRALGHILERQECRHVRHLETTVGPDNQASRRTFAGLAGER-----
3d3sC           PTRPD-VLFVWQVAVHSRARGHRLGRALGHILERQECRHVRHLETTVGPDNQASRRTFAGLAGER-----
2d4pA           WQGEATTVLVTRIEGRSVEALRGLLRAVVKSAYDAGVYE-------------------------------
3d3sA           PTRPD-VLFVWQVAVHSRARGHRLGRALGHILER-QECRHVRHLETTVGPDNQSRRTFAGLAGER-----


                         +         .         .         .         .         *         .:210
query           MMRKKLK
2beiB           -------
2bl1A           TFQLNLD
3cxsA           MCRR---
2dxqA           -------
2dxqB           QIRQ---
3cxqA           MCRRFL-
2beiA           -------
3dr8A           -------
3dsbA           -------
1bo4A           -------
2b3uA           -------
1cm0B           LMGCEL-
1bo4B           -------
3ec4A           -------
3bj7A           -------
1cjwA           EMHCSL-
3d8pA           FYYRNLK
1b6bA           -------
3bj8C           -------
1cm0A           LMGCEL-
2b5gB           -------
2bswA           ILYKRI-
3bj7B           -------
3cxpA           MCRRFLK
2a6aB           -------
1b6bB           EMHCSL-
1bobA           -------
3dr6B           FQLQLD-
2aj6A           -------
3d2pA           ILVRRL-
3eg7F           RYILQSK
3dr6A           FQLQLD-
3bj8A           -------
2cnmA           -------
2bueA           MVQTR--
3efaA           IHKQLL-
2b4dB           -------
3d8pB           FYYRNLK
3dr6C           FQLQLD-
3eg7B           RYILQSK
3c26A           IYTFQ--
2ae6A           QYAYFI-
2atrA           -------
2b4dA           -------
3eg7A           RYILQSK
2b4bA           -------
3e0kA           ILALDL-
3eg7E           RYILQSK
3bj8B           -------
3dr8B           -------
2b4bB           -------
3eg7C           RYILQSK
2b3uB           -------
2b3vA           -------
2ae6C           -------
3d3sD           -------
2ae6D           QYAYFI-
3ec4B           -------
2c27A           -------
1b87A           SIQ----
2ae6B           QYAYFI-
2b5gA           -------
3d3sB           -------
3d3sC           -------
2d4pA           -------
3d3sA           -------