[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB80734.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dclC.bssp"
#ERROR : Can't open dsspfile "2dclA.bssp"
#ERROR : Can't open dsspfile "2dclB.bssp"

## Summary of PDB Search
:113
    3e-13  34%  2dclC  [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
    4e-11  34%  2dclA  [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
    1e-07  45%  2dclB  [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRNEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLPX
2dclC           --EHWNTLRLRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGKIR---------LSTDLPI
2dclA           VE-HWNTLRLRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGTDLPIIVEVVDRGHN----
2dclB           --EHWNTLRLRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYG---------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXPMIETGTITVIDNIQVIxxxxxxx
2dclC           IVEVVDRGHNIEKVVNVIKPMIKDGMITV-EPTIVL-------
2dclA           -------------------------------------------
2dclB           -------------------------------------------