[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81009.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c3aB.bssp"
#ERROR : Can't open dsspfile "3c3aA.bssp"
#ERROR : Can't open dsspfile "16pkA.bssp"
#ERROR : Can't open dsspfile "1d0nA.bssp"
#ERROR : Can't open dsspfile "3c39B.bssp"
#ERROR : Can't open dsspfile "3c3bB.bssp"
#ERROR : Can't open dsspfile "3c39A.bssp"
#ERROR : Can't open dsspfile "2cunA.bssp"
#ERROR : Can't open dsspfile "3c3bA.bssp"
#ERROR : Can't open dsspfile "3d01D.bssp"
#ERROR : Can't open dsspfile "3d01B.bssp"
#ERROR : Can't open dsspfile "3d01K.bssp"
#ERROR : Can't open dsspfile "3d01G.bssp"
#ERROR : Can't open dsspfile "2e28A.bssp"

## Summary of PDB Search
:397
    5e-98  50%  3c3aB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    8e-98  50%  3c3aA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    5e-79  50%  16pkA  [c.86.1 (13pkA)] 3-PHOSPHOGLYCERATE KINASE
    2e-77  11%  1d0nA  [d.109.1 - d.109.1 - d.109.1 - d.109.1 - d.109.1 - d.109.1]
    2e-77  50%  3c39B  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-69  49%  3c3bB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    6e-68  50%  3c39A  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-64  37%  2cunA  [x.x.x] PHOSPHOGLYCERATE KINASE
    7e-63  45%  3c3bA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-12  10%  3d01D  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-09  10%  3d01B  [x.x.x] UNCHARACTERIZED PROTEIN
    9e-09  18%  3d01K  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-07  11%  3d01G  [x.x.x] UNCHARACTERIZED PROTEIN
    9e-07  10%  2e28A  [x.x.x] PYRUVATE KINASE
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNFNKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAK
3c3aB           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
3c3aA           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPP
16pkA           ----KKSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGRPKGIPM
1d0nA           MAAQHGMDDDGTGQKQIWRVEGSNKVPVDPATYGQFYGGDSYIILYNYRHGSRQGQIIYNWQGAQSTQ-D
3c39B           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPP
3c3bB           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
3c39A           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPP
2cunA           -----FRLEDFNFHNKTVFLRVDLNSPMKDGKIISDARFKAVLPTIRYLIESGAKVVIGTHQGKPYSEDY
3c3bA           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDVPMP
3d01D           --------------------------------------------LYFQGSDVIEGRLKELGFTLPVAN--
3d01B           --------------------------------------------LYFQGSDVIEGRLKELGFTLPAAN--
3d01K           -----------------------------------------------NLYFQGSDVI--EGRLKELGFTL
3d01G           --------------------------------------------------NLYFQSDVIEGRLKELGFTL
2e28A           -------------------------------------------DKLVQLMEAGMNVA---RLNFSHGDHE


                         .         .         *         .         .         .         .:140
query           PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGXXXXXXXXX
3c3aB           PDYSLEPVAVELKSLLGKDVLFLKD--CVK-----ACANPAAGSVILLENLRFHVEEEGKGKDASGNKVK
3c3aA           DKYSLEPVAVELKSLLGKDVLFLKD--CVGPEVEKACANPAAGSVILLENLRFHVEEEGKIEAFRASLSK
16pkA           AQATLKPVAKRLSELLLRPVTFAPD----CLNAADVVSKMSPGDVVLLENVRFYKEEGSKKAKDREAMAK
1d0nA           EVAASAILTAQLDEELGGTPVQSRV--VQGKEPAHLMSLFGGKPMIVYKGGTSREGGQTAPASTRLFQVR
3c39B           DKYSLEPVAVELKSLLGKDVLFLKD--------EKACANPAAGSVILLENLRFHVEEEGKIEAFRASLSK
3c3bB           PDKSLEPVAVELKSLLGKDVLFLKD------CVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVK
3c39A           DKYSLEPVAVELKSLLGKDVLFLKD--CVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKKAEPAKIE
2cunA           --TTTEEHARVLSELLDQHVEYIEDIF--GRYAREKIKELKSGEVAILENLRFSAEEVKNKPIEECEKTF
3c3bA           DKYSLEPVAVELKSLLGKDVLFLKD--CVGPEVEKACANPAAGSVILLENLRFHVEEEGKGPAKIEAFRA
3d01D           --YVPFTISGNLLPESGKIAVTGLV--GRDVDVASAQRAAELCAVNILAQVKAALNGDLSKIRRVIKLNG
3d01B           --YVPFTISGNLLPESGKIAVTGLV--GRDVDVASAQRAAELCAVNILAQVKAALNGDLSKIRRVIKLNG
3d01K           PNYVPFTISGNLLYVSGKIAVTGLVG--RDVDVASAQRAAELCAVNILAQVKAALNGDLSK---------
3d01G           PAYVPFTISGNLLYESGKIAVTGLV--GRDVDVASAQRAAELCAVNILAQVKAALNGDLSKIRRVIKLNG
2e28A           EHGRRIANIREAAKRTGRTVAILLDT----KGPEIRTHNMENGAIELKEGSKLVISMSEVLGTPEKISVT


                         +         .         .         .         .         *         .:210
query           XXXMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKELKFLGDAVETPERPFVAILGGAKVSDKINVI
3c3aB           AEPAYVNDAFGTAHRAHSSMVGVNLP--QKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
3c3aA           LGDVYVNDAFGTAHRAHSSMVGVNLP--QKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
16pkA           ILASYISDAFGTAHRDSATMTGIPKILGNGAAGYLMEKEISYFAKVLGNPPRPLVAIVGGAKVSDKIQLL
1d0nA           ASSAFVLKTPSAAYLWVGAGASEAEKTGAQELLRVLRAQPVQVAEGSEPDSFWEALGGKATYRTSPRLKD
3c39B           LGDVYVNDAFGTAHRAHSSMVGVNLP--QKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
3c3bB           AEPAYVNDAFGTAHRAHSSMVGV--NLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
3c39A           AFRAYVNDAFGTAHRAHSSMVGV--NLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
2cunA           LVKKVVNDAFATAHRSQPSLVGFARI-KPMIMGFLMEKEIEALMRAYYSKDSPKIYVLGGAKVEDSLKVV
3c3bA           SLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
3d01D           FVANLIATVLGEPGRHARAAVGAS-----LPFNASVEID-------------------------------
3d01B           FVANLIATVLGEPGRHARAAVGAS-----LPFNASVEID-------------------------------
3d01K           ----------------------------------------------------------------------
3d01G           FVANLIATVLGEPGRHARAAVGAS-----LPFNASVEID-------------------------------
2e28A           YPSLLLDDG-LISLEVNAVDKQAGEIV-------------------------------------------


                         .         .         .         +         .         .         .:280
query           NNLLEKVDTLIIGGGMAYTFLKAQGYTVGSSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKDV
3c3aB           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEN
3c3aA           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEN
16pkA           DNMLQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPIDHVCHEFKAVD
1d0nA           KKMDAHPPRLFACSNKIGRFVIEEPGEFMQEDLATDDVMLLDTWDSQDEEKTEALTSAKRYIDTDPAHRT
3c39B           NNMLDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEN
3c3bB           NNMLDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEN
3c39A           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEN
2cunA           ENVLRREDLVLTGGLVANVFTLAKGFDLGRKNVEFMKKKGLLDYVKHADEFYPYIRTPVDFAVDYKGERV
3c3bA           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEN
3d01D           ----------------------------------------------------------------------
3d01B           ----------------------------------------------------------------------
3d01K           ----------------------------------------------------------------------
3d01G           ----------------------------------------------------------------------
2e28A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EAVVTEDQNIAEGFMGLDIGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEADATTI
3c3aB           AKQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKA-----
3c3aA           AKQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATCITI
16pkA           SPLITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMGRGGLMSI
1d0nA           PITVVKQGFEPPSFVGWFLGWDDSYWSVDPLDRALAELA-------------------------------
3c39B           AKQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATCITI
3c3bB           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVK------
3c39A           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGC
2cunA           EDLLSENRGLLHQYQIMDIGKRTAEKYREILMKARIIVANGPMGVFEREEFAIGTVEVFKAIADSPAFSV
3c3bA           AKQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGC
3d01D           ----------------------------------------------------------------------
3d01B           ----------------------------------------------------------------------
3d01K           ----------------------------------------------------------------------
3d01G           ----------------------------------------------------------------------
2e28A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IGGGDSAAAVNILGFGDKMSHISTGGGASLEFLEGKVLPGIAALNDK
3c3aB           ----TSRGCITIIGGEDKVSHVSTGGGASLELLEGKVLPGVDALSN-
3c3aA           IGGWNTE---------DKVSHVSTGGGASLELLEGKVLPGVDALSN-
16pkA           IGGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVLDDK
1d0nA           -----------------------------------------------
3c39B           IG-------------GDKVSHVSTGGGASLELLEGKVLPGVDALSN-
3c3bB           ----ATSRGCITIIGGDKVSHVSTGGGASLELLEGKVLPGVDAL---
3c39A           I----------TIIGGDKVSHVSTGGGASLELLEGKVLPGVDALSN-
2cunA           LGGGHSIASIQ-KYGITGITHISTGGGAMLSFFAGEELPVLRALQIS
3c3bA           I----------TIIGGDKVSHVSTGGGASLELLEGKVLPGVDALSN-
3d01D           -----------------------------------------------
3d01B           -----------------------------------------------
3d01K           -----------------------------------------------
3d01G           -----------------------------------------------
2e28A           -----------------------------------------------