[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81021.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e5nA.bssp"
#ERROR : Can't open dsspfile "1ehiB.bssp"
#ERROR : Can't open dsspfile "1ehiA.bssp"
#ERROR : Can't open dsspfile "1e4eA.bssp"
#ERROR : Can't open dsspfile "1a9xA.bssp"
#ERROR : Can't open dsspfile "1e4eB.bssp"
#ERROR : Can't open dsspfile "1c30A.bssp"
#ERROR : Can't open dsspfile "1bxrA.bssp"
#ERROR : Can't open dsspfile "1ce8A.bssp"
#ERROR : Can't open dsspfile "2c00B.bssp"
#ERROR : Can't open dsspfile "3bg5A.bssp"
#ERROR : Can't open dsspfile "1b6sB.bssp"
#ERROR : Can't open dsspfile "1bncA.bssp"
#ERROR : Can't open dsspfile "1dv1A.bssp"
#ERROR : Can't open dsspfile "1auvB.bssp"
#ERROR : Can't open dsspfile "3bg5B.bssp"
#ERROR : Can't open dsspfile "2dzdB.bssp"
#ERROR : Can't open dsspfile "3d8nA.bssp"
#ERROR : Can't open dsspfile "1dv2A.bssp"
#ERROR : Can't open dsspfile "3bg5D.bssp"
#ERROR : Can't open dsspfile "3bg5C.bssp"
#ERROR : Can't open dsspfile "3d8rA.bssp"
#ERROR : Can't open dsspfile "2c00A.bssp"
#ERROR : Can't open dsspfile "1dv2B.bssp"
#ERROR : Can't open dsspfile "3d8tB.bssp"
#ERROR : Can't open dsspfile "2dzdA.bssp"
#ERROR : Can't open dsspfile "3d8tA.bssp"
#ERROR : Can't open dsspfile "1auvA.bssp"
#ERROR : Can't open dsspfile "3df7A.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "1dv1B.bssp"
#ERROR : Can't open dsspfile "1bncB.bssp"
#ERROR : Can't open dsspfile "1b6sC.bssp"
#ERROR : Can't open dsspfile "2dwcA.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "1b6sA.bssp"
#ERROR : Can't open dsspfile "1cqjB.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"
#ERROR : Can't open dsspfile "1b6rA.bssp"
#ERROR : Can't open dsspfile "2cqyA.bssp"
#ERROR : Can't open dsspfile "2bjqA.bssp"
#ERROR : Can't open dsspfile "1auxA.bssp"
#ERROR : Can't open dsspfile "1dosA.bssp"
#ERROR : Can't open dsspfile "2bv8B.bssp"
#ERROR : Can't open dsspfile "2dxcF.bssp"
#ERROR : Can't open dsspfile "3e7dB.bssp"
#ERROR : Can't open dsspfile "2dd4C.bssp"
#ERROR : Can't open dsspfile "3dluD.bssp"
#ERROR : Can't open dsspfile "2dd4F.bssp"
#ERROR : Can't open dsspfile "3cwcB.bssp"
#ERROR : Can't open dsspfile "2abrB.bssp"
#ERROR : Can't open dsspfile "3e7dA.bssp"
#ERROR : Can't open dsspfile "3e7dC.bssp"
#ERROR : Can't open dsspfile "2bufF.bssp"
#ERROR : Can't open dsspfile "3czqD.bssp"
#ERROR : Can't open dsspfile "1b73A.bssp"

## Summary of PDB Search
:301
    1e-39  35%  3e5nA  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    3e-38  31%  1ehiB  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    3e-37  31%  1ehiA  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    3e-36  32%  1e4eA  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    1e-35  15%  1a9xA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    3e-34  33%  1e4eB  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    9e-33  17%  1c30A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    1e-32  15%  1bxrA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    6e-31  14%  1ce8A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    7e-31  16%  2c00B  [x.x.x] BIOTIN CARBOXYLASE
    3e-28  17%  3bg5A  [x.x.x] PYRUVATE CARBOXYLASE
    2e-27  14%  1b6sB  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    6e-27  13%  1bncA  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    1e-26  13%  1dv1A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    2e-26  11%  1auvB  [c.30.1 - d.142.1] SYNAPSIN IA
    3e-26  12%  3bg5B  [x.x.x] PYRUVATE CARBOXYLASE
    4e-26  18%  2dzdB  [x.x.x] PYRUVATE CARBOXYLASE
    6e-26  15%  3d8nA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    6e-26  12%  1dv2A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    2e-25  13%  3bg5D  [x.x.x] PYRUVATE CARBOXYLASE
    2e-25  17%  3bg5C  [x.x.x] PYRUVATE CARBOXYLASE
    4e-24   9%  3d8rA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    4e-24  14%  2c00A  [x.x.x] BIOTIN CARBOXYLASE
    4e-23  12%  1dv2B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    6e-23  11%  3d8tB  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    4e-22  18%  2dzdA  [x.x.x] PYRUVATE CARBOXYLASE
    7e-22  10%  3d8tA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    2e-20  12%  1auvA  [c.30.1 - d.142.1] SYNAPSIN IA
    3e-20  14%  3df7A  [x.x.x] PUTATIVE ATP-GRASP SUPERFAMILY PROTEIN
    5e-20  15%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    8e-20  13%  1dv1B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    1e-19  12%  1bncB  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    2e-19  14%  1b6sC  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    1e-18  15%  2dwcA  [x.x.x] 433AA LONG HYPOTHETICAL
    3e-18  18%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL
    2e-17  15%  1b6sA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    4e-17  10%  1cqjB  [d.142.1 - c.23.4] SUCCINYL-COA SYNTHETASE BETA CHAIN
    1e-15  14%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    4e-14  14%  1b6rA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-13  25%  2cqyA  [x.x.x] PROPIONYL-COA CARBOXYLASE ALPHA CHAIN,
    5e-13  11%  2bjqA  [x.x.x] MFP2A
    1e-12  13%  1auxA  [c.30.1 - d.142.1] SYNAPSIN IA
    8e-12  11%  1dosA  [c.1.10] ALDOLASE CLASS II
    8e-12   8%  2bv8B  [x.x.x] C-PHYCOCYANIN BETA SUBUNIT
    1e-11  12%  2dxcF  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT GAMMA
    2e-10  11%  3e7dB  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    2e-10  13%  2dd4C  [x.x.x] THIOCYANATE HYDROLASE GAMMA SUBUNIT
    7e-10  12%  3dluD  [x.x.x] SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN
    8e-10  13%  2dd4F  [x.x.x] THIOCYANATE HYDROLASE GAMMA SUBUNIT
    1e-08  12%  3cwcB  [x.x.x] PUTATIVE GLYCERATE KINASE 2
    3e-07   5%  2abrB  [x.x.x] ARGININE DEIMINASE
    1e-06  13%  3e7dA  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    2e-06  15%  3e7dC  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    3e-04  14%  2bufF  [x.x.x] ACETYLGLUTAMATE KINASE
    4e-04  11%  3czqD  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    6e-04  17%  1b73A  [c.78.2 - c.78.2] GLUTAMATE RACEMASE
:301

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
3e5nA           IRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLIGIDKSGRGVALLPGIDVVFPIVHGTLGEDGSL
1ehiB           KRVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIAQARIHALKSDFDIFFPVVHGNLGEDGTL
1ehiA           -RVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIAQARIHALKSDFDIFFPVVHGNLGEDGTL
1e4eA           IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGLLVKKNHEYEINHVDVAFSALHGKSGEDGSI
1a9xA           -SILILGAGPIVIGQACEYSGAQACKALREEGYRVINVNSNPAEVVRKIIERPDAVLPTMGGQTALELER
1e4eB           IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIPDKKMHGLLVKKNHVDVAFSALHGKSGEDGSI
1c30A           REKIMVLGGGPNRIGQGIEFDYCASLALREDGYETIMVNCNPLEDVLEIVRIEKPKGVIVQYGGQTPLKL
1bxrA           KSILILGAGPIVIGQACEYSGAQACKALREEGYRVILVNSNPAEVVRKIIERPDAVLPTMGGQTALNCAL
1ce8A           -SILILGAGPIVIGQACEYSGAQACKALREEGYRVINVNSNPAEVVRKIIERPDAVLPTTALNCALELER
2c00B           -----------------------------------------------AEVTGATA-IHPGYGFLAENADF
3bg5A           -----------------------------------------------------VDAIHPGYGFLSENEQF
1b6sB           KQVCVLGNG---------QLGRMLRQAGEPLGIAVWPVGLDAEPA-------AVPFQQSVITAEIERWPE
1bncA           DKIVIANRGEIALRILRKELGIKTVAVHSSADRDLKHVLLNIPAIISAAEITGAVAIHPGYGFLSENANF
1dv1A           -------------------------------------------------------AIHPGYGFLSENANF
1auvB           ARVLLVIDEPHTDWAKYFKIHGEIDNLVAHANGGFSVDEVLRNGVKVVRSLKPDFVLIRQHAFSARNGDY
3bg5B           ----------------------------------------------------------------NEDKSS
2dzdB           -KVLVANRGEIAIRVFRACTELGIRTVAIYSKEDVGSYHLDIEGIIEIAKAHDVDAIHPGYGFLSENIQF
3d8nA           -----------------------------------------------------------AYAGLRRKEEF
1dv2A           ----------------------------------------------------------------SENANF
3bg5D           ----------------------------------------------------------------NEDKSS
3bg5C           LDISTVAIYSNEDKSSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVD-AIHPGYGFLSENEQF
3d8rA           -----------------------------------------------------------AYAGLRRKEEF
2c00A           -KVLIANRGEIALRILACKELGIKTVAVHSTADRELMHLLQIPAIIAAAEVTGATAIHPGYGFLAENADF
1dv2B           ----------------------------------------------------------PGYGFLSENANF
3d8tB           -----------------------------------------------------------AYAGLRRKEEF
2dzdA           -KVLVANRGEIAIRVFRACTELGIRTVAIYSKEDVGSYYLDIEGIIEIAKAHDVDAIHPGYGFLSENIQF
3d8tA           -----------------------------------------------------------AYAGLRRKEEF
1auvA           -RVLLVIDE---PHTDWAK----YFKGKKIHGEIDIKVEQAEFSVKVVRSLKPDFVLIRQHAFSARNGDY
3df7A           LKLFLATCGERIEDSTAVEGLAFAFDGFKNYYEITGFVRPEFVDSDSEKYLEKSDAFLIIAPEDDFLLYT
2czgA           -KILLLGSGELGKEIAIEAQRDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDA
1dv1B           DKIVIANRGEIALRILRKELGIKTVHVLLADETVCIGPYLNIPAIISAAEITGAVAIHPGYGFLSENANF
1bncB           -KIVIANRGEIALRILACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISENANF
1b6sC           KQVCVLGNG---------QLGRMLRQAGEPLGIAVWPVGLDAEPA-------AVPFQQSVITAEIERWPE
2dwcA           -KILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMVVEREKPDAIIPEIEAINLDA
2dwcB           -KILLLGSGELGKEIAIEAQGVEVVNAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDA
1b6sA           KQVCVLGNG---------QLGRMLRQAGEPLGIAVWPVGLDAEPAA-------VPFQQSVITAEIERWPE
1cqjB           ----------------------------------------------------------------------
2czgB           -KILLLGSGELGKEIAIEAQGVEVVAVDRYANAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDA
1b6rA           KQVCVLGNG---------QLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV-------ITAEIERWPE
2cqyA           ----------------------------------------------------------------------
2bjqA           ----------------------------------------------------------------------
1auxA           --------------------------SVDMEVLRNGVKVVRSLKP-----DFVLIRQHAFSMARNGDYRS
1dosA           ----------------------------------------------------------------------
2bv8B           ----------------------------------------------------------------------
2dxcF           ----------------------------------------------------------------------
3e7dB           ---------------------------------------------------------------SAAALDL
2dd4C           ----------------------------------------------------------------------
3dluD           ----------------------------------------------------------------------
2dd4F           ----------------------------------------------------------------------
3cwcB           -------------------------------------------------------QLRRGIEIVTDALHL
2abrB           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
2bufF           ----------------------------------------------------------------------
3czqD           ----------------------------------------------------------------------
1b73A           MKIGIFVGGLTVLKAIRNRYRKVDI--VYLGDTARVPYGIRSKDTIIRYSLECAGFLKDKGVDIASAYAL


                         .         .         *         .         .         .         .:140
query           QSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNG
3e5nA           QGLLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDAHADVD-TLIAQLGLPLFVKPANQ
1ehiB           QGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNDKIVAELGNIVFVKAANQ
1ehiA           QGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSIVAELGNIVFVKAANQ
1e4eA           QGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR---PVAATFTYPVFVKPARS
1a9xA           QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEAL-AVAADVGFPCIIRPSFT
1e4eB           QGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR---PVAATFTYPVFVKPARS
1c30A           ARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAIEMAV-EKAKEIGYPLVVRPAME
1bxrA           QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEAL-AVAADVGFPCIIRPSFT
1ce8A           QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEAL-AVAADVGFPCIIRPSFT
2c00B           AEQIERSGFTFVGPTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLPEDEELAIAREVGYPVIIKAAGG
3bg5A           ARRCAEEGIKFIGPHLEHLDMFGDKVKARTTAIKADLPVIPGTDIKSYELA-KEFAEEAGFPLMIKATSR
1b6sB           TALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEW-PAVFDRLGELAIVKRRTG
1bncA           AEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDRAIAKRIGYPVIIKRGMR
1dv1A           AEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDRAIAKRIGYPVIIKASMR
1auvB           RSLVIGLAGIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEEFPLINQTFYPNHKLSSTTYPVVVKGHAH
3bg5B           LHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARCAEEGIKFIGPHLEH
2dzdB           AKRCREEGIIFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGSDGPVDGLEDVVAAEAHGYPIIIKAALG
3d8nA           KALAEKLGFTPLLFPVQATEKVPVPEYRDQVREAQGVDLFLATTGVGVRDLL-EAGKALGLDLEGPLAKA
1dv2A           AEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDRAIAKRIGYPVIIKASGG
3bg5D           LHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRAEEGIKFIGPHLEH
3bg5C           ARRCAEEGIKFIGPHLEHLDMFGDKVKARTTAADLPVIPGTDGPIKSYELAK-EFAEEAGFPLMIKATSG
3d8rA           KALAEKLGFTPLLFPVQATEKVPVPEYRDQVRELAQGVDLTGVGVRDLLEA-GKALGLDLEGPLAKAFRL
2c00A           AEQIERSGFTFVGPTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLPEDEELAIAREVGYPVIIKAAGG
1dv2B           AEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDRAIAKRIGYPVIIKASGG
3d8tB           KALAEKLGFTPLLFPVQATEKVPVRDQVRELAQGVDLFLATTVGVRDLLEA-GKALGLDLEGPLAKAFRL
2dzdA           AKRCREEGIIFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGSDGPVDGLEDVVAFEAHGYPIIIKAALG
3d8tA           KALAEKLGFTPLLFPVQATEKVPVPEYRDQVRELAQGVDLFLVGVRDLLEA-GKALGLDLEGPLAKAFRL
1auvA           RSLVIGLAGIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEEFPLINQTFYPHKELSSTTYPVVVKGHAH
3df7A           LTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEV-QVPQT------------SLRPLDCKFIIKPRTA
2czgA           LFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELY-EACEKIGYPCHTKAIMS
1dv1B           AEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDRAIAKRIGYPVIIKMRVV
1bncB           AEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGDDMDKNR-AIAKRIGYPVIIKRVVR
1b6sC           TALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWP-AVFDRLGELAIVKRRTG
2dwcA           LFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEA-CEKIGYPCHTKAIMS
2dwcB           LFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEK-IGYPCHTKAIMS
1b6sA           TALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRL-GELAIVKRRTG
1cqjB           ---------------------NLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQNS
2czgB           LFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEA-CEKIGYPCHTKAISY
1b6rA           TALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEW-PAVFDRLGELAIVKRRTG
2cqyA           -----------------SSGSSGDKIESKLLAKKAEVNTIPGGVVKDAEEA-VRIAREIGYPVMIKASAG
2bjqA           ---------------SGKSEQVAGGPIQDMLVLFRNVKAPPKGIKIY-DDTWLDLKYRDPFPAARNPIAA
1auxA           LVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLTFYPNHKEMLSSTTYPVVVKMGHA
1dosA           ----------KIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINLETAAKVKAPVIVQFSNG
2bv8B           ---------------LSNTQLDALANMIAEGNKRLDIVNRINSNASAIVS-NSARALFAEQPQLIQPGGA
2dxcF           ----------------------------------------------------------------------
3e7dB           WLPHIEGSIVAIGNAPTALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDE-LAANSRGVPYIVRGRRG
2dd4C           ----------------------------------------------------------------------
3dluD           -------GRFV--VWPSELDSRLSRKYGRIVPRSIAVESPRVEEI-------VRAAEELKFKVIRVEEDT
2dd4F           ----------------------------------------------------------------------
3cwcB           EACLADADLVITGEGRIDSQTIHGKVPIGNIAKRYNKPVIGIAGSLTAHGLD-AVFSVIYTICTLEDALK
2abrB           ------ESLGLK-KLRVVETGAAEREQWDDGNNVVCLEPGVVVGYDRNTYTN-TLLRKAGVEVITISASE
3e7dA           -------SIVAIGNAPTALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDE-LAANSRGVPYIVRGRRG
3e7dC           --------IVAIGNAPTALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDE-LAANSRGVPVIVRGRRG
2bufF           ---INRHGGSAIGLTGKDAELIRAKKLTVTRQPEIIDIGHVGEVTGVNVGL-LNMLVKGDFIPVIAPIGV
3czqD           --------------------KWDDYTGKRDRLKETHTEHGPWAVIRGNDKRR------SRINVIRHLTKL
1b73A           ERLKKEINVPVFGVIEPGVKEALKKSRNKKIGVIGTPATVKSGAYQ-------RKLEEGGADVFAKACPL


                         +         .         .         .         .         *         .:210
query           GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD
3e5nA           GSSVGVSQVRTADAFAAALALALAYDHKVLVEAAVAGREIECAVL-------------GNAVPHASVCGE
1ehiB           GSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGAELEVGVIGNDQPLVSEIGAHTVHFQIPAQLSP
1ehiA           GSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIGGDGWYDYNNKFVD
1e4eA           GSSFGVKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVVGEVDQIRLQYGIFRIHQ
1a9xA           MGGSGGGIAYNREEFEEICARGLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTG
1e4eB           GSSFGVKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVVQIRLQYGIFRIHQEVSE
1c30A           IVYDEADLRRY------------FQTAVLLDHFLDDAVEVDVDAICDG--EMVLIGGIMEHIEQAGVHGD
1bxrA           MGGSGGGIAYNREEFEEICARGLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTG
1ce8A           MGGSGGGIAYNREEFEEICARDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTG
2c00B           GMRVVYDESELIKSAKLTRTEAGAGNPMVYLEKFLTNPHVEVQVLSDGQGNAIHLGDRDCSLQRRH--QK
3bg5A           IVREESELEDAFHRAKSEAEKSFGNS-EVYIERYIDNKHIEVQVIGDEHGNIVHL---FERDCSVQRRHQ
1b6sB           GYDGRGQWRLRANETEQL---PAECYGECIVEQGINFSEVSLVGARGFDGSTVFYPLTHNLHQ----DGI
1bncA           V-------VRGDAELAQSISMTRAEAKMVYMEKYLENPRHVEIQVLADGQGN-AIYLAERDCSMQRRHQK
1dv1A           VVRGDAELAQSISMTRAE------ANDMVYMEKYLEPRHVEIQVLADGQGNAIYLAE--RDCSMQRRHQK
1auvB           SGGKV--KVDNQHDFQDIASVVALTKTYATTEPFIDAKDVRIQKIGQNYKAYRLEQIA------------
3bg5B           LDMFGDKVKARTTAIKADL--------PVIPIDNPKHIEVQVIGDEHGNIVHL----FERDCSVQRRHQK
2dzdB           GGGRGMRIVRSKSEVKEAFERAKSEAKEVYVEKLIENPHIEVQILGDYEGNI--VHLYERDCSVQRRHQK
3d8nA           GAKAARALKEA-GLPPHAVGDG---TSKSLLPLLPQGRGVAALQLYGKPLPLLALAERGYRVLPLMPY--
1dv2A           GGGRGMRVVRGDAELAQSISMTRAENDMVYMEKYLENPHVEIQVLADGQGNAIYLAER--DCSMQRRHQK
3bg5D           LDMFGDKVKARTTAIKADLP--------VIPIDNPKHIEVQVIGDEHGNIVHL-----FERDCSVQRRHQ
3bg5C           GGGKGMRIVREESELEDAFHRAKSGNSEVYIERYIDNPKHIEVQVIGDEHGNIVHLFERDCSVQRRHQKV
3d8rA           ARG-----AKAARALKEAGLPVGDGTSKSLLPLLPQGRGVAALQLKPLPLLENALAERGYRVLPLMPYRH
2c00A           RGMRVYDESELIKSAKLTRTEAGFGNPMVYLEKFLTNPHVEVQVLSDGQGNAIHLGDRDCSLQRRHQKVI
1dv2B           GGGRGMRVVRGDAELAQSISMTRAENDMVYMEKYLENPHVEIQVLADGQGNAIYLAER--DCSMQRRHQK
3d8tB           ARG-----AKAARALKEAGLPVGDGTSKSLLPLLPQGRGVAALQLKPLPLLENALAERGYRVLPLMPYRH
2dzdA           GGGRGMRIVRSKSEVKEAFERAKSESDEVYVEKLIENPKHIEVQILGDYEGNIVHLYERDCSVQRRHQKV
3d8tA           ARG-----AKAARALKEAGLPVGDGTSKSLLPLLPQGRGVAALQLKPLPLLENALAERGYRVLPLMPY--
1auvA           SGGKVK--VDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYRTLEQ------------
3df7A           CIGFSDEVPD-----------------GHIAQEFIEGINLSVSLAVGEDVKCLSV-----NEQIINN-FR
2czgA           YFVKGPEDIPKAWEKIIV---------EEHIDFDVEVTELAVRHFDENGEIVTTFPKPVGHYQ---IDGD
1dv1B           RGDAELAQS--------------ISMTRAYMEKYLENPHVEIQVLADGQGNAIYL---AERDCSMQRRQK
1bncB           GDAELAQ--------------SISMTRAYMEKYLENPRHVEIQVLADGQGNAIYL---AERDCSMQRRHQ
1b6sC           GQWRLRANETEQLP--------AECYGECIVEQGINFSEVSLVGARGFDGSTVFYPLTHNLHQ----DGI
2dwcA           YFVKGPEDIPKAW-------EEEKIIVEEHIDFDVEVTELAVRHFDENGEIVTTFPKPVGHYQIDGDYHA
2dwcB           GSYFVKGPEDIPKAWEEE---------KIIVEEHIDFDEVTELAVRHFDENGEIVTTFPKPVGHYQIDGD
1b6sA           GGQWRLRANETEQLPAE-------CYGECIVEQGINFSEVSLVGARGFDGSTVFYPLTHNLHQ----DGI
1cqjB           KEDIRAFAENWLGKRLVTYQTDAQPVNQILVEAATDIAKELYLGASSRRVVFMASTEGGVEIKVAEETPH
2czgB           FVKGPEDIPKAWKIIVEEHIDFDVEV-TELAVRHFDENGEIVTTFP-------------KPVGHYQIDGD
1b6rA           QWRLRANETEQLPA--------ECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLT----HNLHQDGI
2cqyA           GGGKGMRIAWDDEETRDGFRLSSQEDDRLLIEKFIDNPHISGPSS-------------------------
2bjqA           GGRKVKSDDGTEMFQYVALWYEH--GQPVFGRAYPDSADKTLANFWGGQENAGAEVPDPDILGFEYKWIP
1auxA           HSGMGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKDVRIQKIGQNYKAYMRTLE-------------
1dosA           AGKGVKSDVPQGAAILGAISGAHHVVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLS
2bv8B           YTNRRMAACLRDMEIVLRYVSYAEGDSSVLDDRCLNGRETYQALGTPGSSVAVA------IEKMKEASVS
2dxcF           -------------------------SDFEILEMAVRELAIEKGLFSAEDHRV--------WKDYVHTLGP
3e7dB           GSAMTAAAVNALASER------------------------------------------------------
2dd4C           -------------------EILEMAVRELAIEKGLFSAEDHRVWKDY-----------------VHTLGP
3dluD           FGMIVLESPYGKSKSLKLIAQKIR----------------------------------------------
2dd4F           -------------------EILEMAVRELAIEKGLFSAEDHRVWKDY-----------------VHTLGP
3cwcB           NASENVRTARNVAATLKAG---------------------------------------------------
2abrB           LGRGRGGGHMTCPIVRDPI---------------------------------------------------
3e7dA           GSAMTAAAVNALAS--------------------------------------------------------
3e7dC           GSAMTAAAVNA-----------------------------------------------------------
2bufF           GSNGESYNINA-DLVAGKVAEALKAEKLMLLTN-------------------------------------
3czqD           DYDAIGEVDEKILGSGPGFL--------------------------------------------------
1b73A           FAPLAEELLEGEITRKEHYLKEFKGKIDTLILGCTHYPLLKKEIKKFLGDAEVVDSSEALSLSLHNFIKD


                         .         .         .         +         .         .         .:280
query           GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGI
3e5nA           VVVEIVIADIDAQTQQRIQQIAVQAYQALGCAGMARVDFLCADGRIVINEVNTLPGFTRISVYPKLWQAS
1ehiB           ------------EVTKEVKQMALDAYKVLNLRGEARMDLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYS
1ehiA           NSAVHFQIQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLENNVPYLGEPNTLPGFTNMSLFKRLWDYS
1e4eA           EAVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDMFLDNGRIVLNEVNTLPGFTSYSRYPRMMAAA
1a9xA           DSITVAPQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAKNGRLIVIEMNPRVSRS------------
1e4eB           NAVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDFLQDRGRIVLNEVNTLPGFTSYSRYPRMMAAA
1c30A           SACSLPAYTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAART----VPFVSKAT
1bxrA           DSITVAPQTLTDKEYQIMRNASMAVLREIGVETGGSNVVNPKNGRLIVIEMNPRVSRS------------
1ce8A           DSITVAPQTLTDKEYQIMRNASMAVLREIGVETGGSNVVNPKNGRLIVIEMNPRVSRS------------
2c00B           VIEEAPAPGIDEKARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQVE------------
3bg5A           KVVEVAPVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVE------------
1b6sB           LRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQN------
1bncA           VVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEM--ITGV
1dv1A           VVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVE------------
1auvB           --------------SDRYKLWVDTCSEIFGGLICAVEALHGKDGRDHIIEVVGSSPLIGDHQDEDKQLIV
3bg5B           VVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVE------------
2dzdB           VVEVAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLVSGDEFYFIEVNPRIQVE------------
3d8nA           -----RHLPDPEGILRLEEAVLRGEVDALAFVAAIQVEFLFGAKDPKALREALNTRVKALAVGRVTA---
1dv2A           VVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQVE------------
3bg5D           KVVEVAPVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVE------------
3bg5C           VEVAPS-VGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVE------------
3d8rA           ---------LPDPEGILRLEEAVLRGEVDALAFVQVEFLFEGAKDPKALREALNTRVKALAVGRVTA---
2c00A           EEA--PAPGIDEKARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQVE------------
1dv2B           VVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQVE------------
3d8tB           ---------LPDPEGILRLEVLRGEVDALAFVAAIQVELFEGAKDPKALREALNTRVKALAVGRVTADAL
2dzdA           VEVAPS-VSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLVSGDEFYFIEVNPRIQVE------------
3d8tA           -------RHLPDPEGILRLEVLRGEVDALAFVAAIQVELFEGAKDPKALREALNTRVKALAVGRVTA---
1auvA           ------------IASDRYKLWVDTCSEIFGGLICAVEALHGKDGRDHIIEVVGSSPLIGDHQDEDKQLIV
3df7A           YAGAVVPARISDEVKREVVEEAVRAVECVELNGYVGVDIVY-SDQPYVIEINARLTTP----VVAFSRAY
2czgA           YHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHPPGF
1dv1B           VVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEMITGVDL
1bncB           KVVEEPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEM------
1b6sC           LRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWT--------
2dwcA           SWQ---PAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHPPGF
2dwcB           YHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDT------------
1b6sA           LRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNS------------
1cqjB           LIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKATIFLERDLALIEINPLVITKQGDLIC------
2czgB           YHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHPPGF
1b6rA           LRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWT--QNGASI
2cqyA           ----------------------------------------------------------------------
2bjqA           YKEAKAGKPLHVGECTPCLLKDANGTERL-GNLHMGMEATAGLAGKDSAVSGPAVG--------------
1auxA           ----------QIAMSDRYKLWVDTCSEIFGGLDICAVELHGKDGRDHIIEVVGSS---------------
1dosA           EESLQENIEICSKYLERMSKIGMTLEIELGCTGEEDGVDNSHMDASALYTQPEDVDYA------------
2bv8B           DANDSSGTGDCSSLSAELGTYFDRAASAV-----------------------------------------
2dxcF           LPAARLVAKLDPEYKKLCIEDGVEASKAVGVNWVTPTQFGTDYCNLRVLADSPTLKHVVVCTLSYPRPIL
3e7dB           ----------------------------------------------------------------------
2dd4C           LPAARLVAKLDPEYKKLCIEDGVEASKAVGVNWVTSTQFGTSDYCNLRVLADSPTLK-------------
3dluD           ----------------------------------------------------------------------
2dd4F           LPAARLVAKLDPEYKKLCIEDGVEASKAVGVNWVTSTQFGTSDYCNLRVLADSPTLKHVCSCYPRPILGQ
3cwcB           ----------------------------------------------------------------------
2abrB           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
2bufF           ----------------------------------------------------------------------
3czqD           ----------------------------------------------------------------------
1b73A           DG--------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NMSFEELLDTIIEKSLKxxxx
3e5nA           GLDYRGLITRLIELAL-----
1ehiB           DINNAKLVDMLIDYGF-----
1ehiA           DINNAKLVDMLIDYGF-----
1e4eA           GISLPELIDRLIVLALK----
1a9xA           ---------------------
1e4eB           GISLPELIDRLIVLAL-----
1c30A           GVPLAKVAARVMA--------
1bxrA           ---------------------
1ce8A           ---------------------
2c00B           ---------------------
3bg5A           ---------------------
1b6sB           ---------------------
1bncA           DL-------------------
1dv1A           ---------------------
1auvB           EL-------------------
3bg5B           ---------------------
2dzdB           ---------------------
3d8nA           ---------------------
1dv2A           ---------------------
3bg5D           ---------------------
3bg5C           ---------------------
3d8rA           ---------------------
2c00A           ---------------------
1dv2B           ---------------------
3d8tB           TERLGSLLQG-FKRAL-----
2dzdA           ---------------------
3d8tA           ---------------------
1auvA           EL-VVNKA-------------
3df7A           GASVADLLAGGEV--------
2czgA           SE-------------------
1dv1B           IKEQLRIAA------------
1bncB           ---------------------
1b6sC           ---------------------
2dwcA           SEFAL----------------
2dwcB           ---------------------
1b6sA           ---------------------
1cqjB           ---------------------
2czgB           S--------------------
1b6rA           SQFELHL--------------
2cqyA           ---------------------
2bjqA           ---------------------
1auxA           ---------------------
1dosA           ---------------------
2bv8B           ---------------------
2dxcF           GQSPEWYRSPNY---------
3e7dB           ---------------------
2dd4C           ---------------------
3dluD           ---------------------
2dd4F           SPEWYRSPNYRRR--------
3cwcB           ---------------------
2abrB           ---------------------
3e7dA           ---------------------
3e7dC           ---------------------
2bufF           ---------------------
3czqD           ---------------------
1b73A           ---------------------