[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81104.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ddoC.bssp"
#ERROR : Can't open dsspfile "3ddoF.bssp"
#ERROR : Can't open dsspfile "3ddoA.bssp"
#ERROR : Can't open dsspfile "3ddoB.bssp"
#ERROR : Can't open dsspfile "3dpsF.bssp"
#ERROR : Can't open dsspfile "1a69C.bssp"
#ERROR : Can't open dsspfile "2ac7B.bssp"
#ERROR : Can't open dsspfile "2ac7A.bssp"
#ERROR : Can't open dsspfile "2bsxA.bssp"
#ERROR : Can't open dsspfile "3df9A.bssp"
#ERROR : Can't open dsspfile "3df9B.bssp"
#ERROR : Can't open dsspfile "2ai3A.bssp"
#ERROR : Can't open dsspfile "1a9qA.bssp"
#ERROR : Can't open dsspfile "3e0qA.bssp"
#ERROR : Can't open dsspfile "2a8yA.bssp"
#ERROR : Can't open dsspfile "3c74A.bssp"
#ERROR : Can't open dsspfile "3ddoE.bssp"
#ERROR : Can't open dsspfile "3dp9A.bssp"
#ERROR : Can't open dsspfile "3e9rB.bssp"
#ERROR : Can't open dsspfile "1b8oA.bssp"
#ERROR : Can't open dsspfile "3bgsA.bssp"
#ERROR : Can't open dsspfile "3eeiA.bssp"
#ERROR : Can't open dsspfile "3c74F.bssp"
#ERROR : Can't open dsspfile "1a9oA.bssp"
#ERROR : Can't open dsspfile "3c74E.bssp"
#ERROR : Can't open dsspfile "3dp9C.bssp"
#ERROR : Can't open dsspfile "2a0wA.bssp"
#ERROR : Can't open dsspfile "3bsfA.bssp"
#ERROR : Can't open dsspfile "2a0xA.bssp"
#ERROR : Can't open dsspfile "3bl6A.bssp"
#ERROR : Can't open dsspfile "2ai2A.bssp"
#ERROR : Can't open dsspfile "2a0yA.bssp"
#ERROR : Can't open dsspfile "1b8nA.bssp"
#ERROR : Can't open dsspfile "1cb0A.bssp"
#ERROR : Can't open dsspfile "3djfB.bssp"
#ERROR : Can't open dsspfile "2b94A.bssp"
#ERROR : Can't open dsspfile "3e9zC.bssp"
#ERROR : Can't open dsspfile "3bjeA.bssp"
#ERROR : Can't open dsspfile "1c3xA.bssp"
#ERROR : Can't open dsspfile "3e0qB.bssp"
#ERROR : Can't open dsspfile "3e9zB.bssp"
#ERROR : Can't open dsspfile "3e9rC.bssp"

## Summary of PDB Search
:235
    9e-71  29%  3ddoC  [x.x.x] URIDINE PHOSPHORYLASE
    2e-64  29%  3ddoF  [x.x.x] URIDINE PHOSPHORYLASE
    9e-57  29%  3ddoA  [x.x.x] URIDINE PHOSPHORYLASE
    6e-56  28%  3ddoB  [x.x.x] URIDINE PHOSPHORYLASE
    5e-55  30%  3dpsF  [x.x.x] URIDINE PHOSPHORYLASE
    9e-50  51%  1a69C  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-49  69%  2ac7B  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    1e-46  69%  2ac7A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-45  24%  2bsxA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    1e-43  20%  3df9A  [c.56.2 (1nc1A)] MTA/SAH NUCLEOSIDASE
    3e-43  20%  3df9B  [c.56.2 (1nc1B)] MTA/SAH NUCLEOSIDASE
    8e-43  15%  2ai3A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    1e-42  14%  1a9qA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-42  16%  3e0qA  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    4e-41  18%  2a8yA  [x.x.x] 5'-METHYLTHIOADENOSINE PHOSPHORYLASE (MTAP)
    6e-41  28%  3c74A  [x.x.x] URIDINE PHOSPHORYLASE
    6e-41  28%  3ddoE  [x.x.x] URIDINE PHOSPHORYLASE
    2e-40  21%  3dp9A  [x.x.x] MTA/SAH NUCLEOSIDASE
    3e-40  17%  3e9rB  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    5e-40  14%  1b8oA  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-40  13%  3bgsA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-40  19%  3eeiA  [x.x.x] 5-METHYLTHIOADENOSINE NUCLEOSIDASE/S-
    7e-40  28%  3c74F  [x.x.x] URIDINE PHOSPHORYLASE
    4e-39  15%  1a9oA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-39  28%  3c74E  [x.x.x] URIDINE PHOSPHORYLASE
    6e-39  21%  3dp9C  [x.x.x] MTA/SAH NUCLEOSIDASE
    1e-38  13%  2a0wA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-38  17%  3bsfA  [x.x.x] AT4G34840
    7e-37  13%  2a0xA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-36  18%  3bl6A  [x.x.x] 5'-METHYLTHIOADENOSINE NUCLEOSIDASE/S-
    6e-36  14%  2ai2A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    2e-35  14%  2a0yA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-34  15%  1b8nA  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-34  16%  1cb0A  [c.56.2] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE
    3e-31  19%  3djfB  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    1e-23  21%  2b94A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-19  21%  3e9zC  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    3e-11  20%  3bjeA  [x.x.x] NUCLEOSIDE PHOSPHORYLASE, PUTATIVE
    7e-11  12%  1c3xA  [c.56.2] PENTOSYLTRANSFERASE
    8e-06  23%  3e0qB  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    2e-05  24%  3e9zB  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    4e-04  26%  3e9rC  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGVPSIS
3ddoC           ---HLGLTKNQGAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
3ddoF           ---HLGLTKNQGAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
3ddoA           ---HLGLTKNQGAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
3ddoB           ---HLGLTKNQGAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
3dpsF           ---HLGLTKNQGAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
1a69C           ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
2ac7B           -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
2ac7A           -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSIS
2bsxA           ---HLKISKEQITPVVLVVGDPGRVDKIKV-VCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCA
3df9A           ----------------IIGAMEEEVTLLRDKIENRQT--ISLGGCEIYTGQLNGTEVALLKSGIGKVAAA
3df9B           ----------------IIGAMEEEVTLLRDKIENRQT--ISLGGCEIYTGQLNGTEVALLKSGIGKVAAA
2ai3A           ---WLLSHTEQRPQVAVICGSGLGGLVNKLTQAQYSEIPNFPESGRLVFGILNGRACVMMHMYEGYPFWK
1a9qA           ---WLLSHTEQRPQVAVICGSGLGGLVNKLTIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMFWKV
3e0qA           VAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTIFGTLSGRKVVVQGRFHMYEGYS
2a8yA           ------IEQNEKASIGIIGGSGLYDPGIFSESKEIKVYTPGQPSDFITIGKIGNKSVAFHGRGHRIPPHK
3c74A           ---HLGLTKNDLAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
3ddoE           ---HLGLTKNDLAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
3dp9A           ----------------IIGAMQQEVAILKD-LIEDVQEVN-QAGCTFYSGQIQGVDVVLLQSGIGKVSAA
3e9rB           ---HIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPNFPQTSSGNLIFGTLSGRKVVVQGRFHMYEGYS
1b8oA           ---WLLSHTEQRPQVAVICGSGLGQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMFWKV
3bgsA           ---WLLSHTKHRPQVAIICGTQAQIFDYSEIP-NFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMLWKV
3eeiA           -----------LKTVAVIGAMEQEIELLREMMEN--VKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAA
3c74F           ---HLGLTKNDLAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
1a9oA           ---WLLSHTEQRPQVAVICGSGLGQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMYEGYPFWKVT
3c74E           ---HLGLTKNDLAQLAIVPGDPERVEKIAA-LMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTS
3dp9C           ----------------IIGAMQQEVAILKD-LIEDVQEVN-QAGCTFYSGQIQGVDVVLLQSGIGKVSAA
2a0wA           ---WLLSHTKHRPQVAIICGSGLAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMLWKV
3bsfA           -----------ISTIVFIVAMQKEAQPLIN-RLRLVEEVNTPFKDLNINIVCPGKDSTLGVESVGTVPAS
2a0xA           ---WLLSHTKHRPQVAIICGTQAQIFDYSEIPNFPRSTVPGHAGRL-VFGFLNGRACVMMQGRFHPLWKV
3bl6A           ------------MMIGIIGAMEEEVTILKNKLTQLSE--ISVAHVKFYTGILKDREVVITQSGIGKVNAA
2ai2A           ---WLLSHTEQRPQVAVICGSGLGG---LVNKLTQAQTFDYSEIPNFVFGILNGRACVMMHMYEGYPFWK
2a0yA           ---WLLSHTKHRPQVAIICGSGLGGIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMYEGYPLWKVT
1b8nA           ------------------------------EIPNFPESTVPGHAGRLVFGILNGRACVMMYEGYPFWKVT
1cb0A           ----------------IIGGTGLDDPEILEGRTEKYVDTFGKPSDALILGKIKNVDCVLHGRQHTIMPSK
3djfB           -----------------------------------------------IFGTLSGRKVVVMYEGYSNDTVA
2b94A           ---HIKLTPSQTTPVVLVVGDPGRVDKVKMLCDSYVDLAE----YKSVECTYKGQKFLCVSHGVGSAGCA
3e9zC           ----------------------------------------------------QGRFHMYEGYSNDTVALP
3bjeA           TTLHLKCKSDELADRIIFVGDPGRVDVISGYFDKDSIASRDHREIRFATGTYKGTPVTVISTGMGVDNIE
1c3xA           -----------------------------------------------------VRHALVLGSRGKGVRAV
3e0qB           -------------------------------------------------GTLSGRKVMYEGYSNDTVALP
3e9zB           -------------------------------------------------GTLSGRKVVVEGYSNDTVALP
3e9rC           -------------------------------------------------GTLSGRKVMYEGYSNDTVALP


                         .         .         *         .         .         .         .:140
query           IYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDT
3ddoC           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASL-HFAPMEFPAVADFACTTALVEA
3ddoF           IAVEELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASL-HFAPMEFPAVADFACTTALVEA
3ddoA           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASL-HFAPMEFPAVADFACTTALVEA
3ddoB           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASL-HFAPMEFPAVADFACTTALVEA
3dpsF           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASL-HFAPMEFPAVADFACTTALVEA
1a69C           IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
2ac7B           IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
2ac7A           IYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDA
2bsxA           VCFEELCQ-NGAKVIIRAGSCGSLQPDIKRGDICICNAAVREDRVSHLLIHGDFPAV-GDFDVYDTLNKC
3df9A           LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEDVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC
3df9B           LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC
2ai3A           VFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRPAMSDAYDRDMRQKAHST
1a9qA           TFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRPAMSDAYDRDMRQKAHST
3e0qA           NDTVRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGQEAFGTRFPALSNAYDRDLRKLAVQV
2a8yA           INYRWALKELGVRWVISVSAVGSLRMDYKLGDFVIPDQFIDMTKNREYSFFDVSMADPFCNSLRKLAIET
3c74A           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAV-ADFACTTALVEA
3ddoE           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPM-EFPAVADFACTTALVEA
3dp9A           LGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYGQPAAFKADEKLMTVAEQA
3e9rB           NDPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVPALSNAYDRDLRKLAVQV
1b8oA           TFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRPAMSDAYDRDMRQKAHST
3bgsA           TFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGAMSDAYDRTMRQRALST
3eeiA           VATAWIIREFAADCVINTGSAGGLGKGLKVTETAHHDVDVTAFGYAWGQVPQLPARFASDGILIEAAKRA
3c74F           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAV-ADFACTTALVEA
1a9oA           -FPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGAMSDAYDRDMRQKAHST
3c74E           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVT-TASVRLDGASLHFAPMEFPAVADFACTTALVEA
3dp9C           LGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGAGQPAAFKADEKLMTVAEQA
2a0wA           TFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLFPAMSDAYDRTMRQRALST
3bsfA           LVTYASILAIQPDLIINAGTAGGFKKGACISDVYVV-----STVAFHDRRIPVPVLDIYGVGMRNTFPTP
2a0xA           TFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLFPAMSDAYDRTMRQRALST
3bl6A           ISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQV
2ai2A           VFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLFPAMSDAYDRDMRQKAHST
2a0yA           -FPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRPAMSDAYDRTMRQRALST
1b8nA           FPVR-VFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGAMSDAYDRDMRQKAHST
1cb0A           VNYQANIWAEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDIPMAEPFCPKTREVLIET
3djfB           LPI-RVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVPALSNAYDRDLRKLAVQV
2b94A           ICFEELMN-NGAKVIIRAGSCGSLQPTQMKRGDICICNAAVREDRVSHLMIYSDFPAVADFEVYDTLNKV
3e9zC           IRV---MKLLGVKILMVSNAAGGLNRSLKLGDFVILGLNNILVGPNQEAFGTPALSNAYDRDLRKLAVQV
3bjeA           IVLNEIHALKEYDMERGQWRHRKGDADAPSAGPFFDPSTMKIIRLGTCGSPAESVPPLALAVTRHAIGMD
1c3xA           VHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINLTARSPLEGPTFVDLTDVYSPRLRELAHR
3e0qB           IRV---MKLLGVKILMVSNAAGGLNRSLKLGDFVILGLNNILVGPNQEAFGFPALSNAYDRDLRKLAVQV
3e9zB           IRV---MKLLGVKILMVSNAAGGLNRSLKLGDFVI-LKDHIYVGPNQEAFGTPALSNAYDRDLRKLAVQV
3e9rC           IRV---MKLLGVKILMVSNAAGGLNRSLKLGDFVILGLNNILVGPNQEAFGFPALSNAYDRDLRKLAVQV


                         +         .         .         .         .         *         .:210
query           AVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAE
3ddoC           AKSIGATTHVGVTASSDTFYPGQKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGV---IVNRT
3ddoF           AKSIGATTHVGVTASSDTFYPGQKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
3ddoA           AKSIGATTHVGVTASSDTFYPGQEGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQKQ
3ddoB           AKSIGATTHVGVTASSDTFYPGQKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
3dpsF           AKSIGATTHVGVTASSDTFYPG--QSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQEK
1a69C           AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTTA
2ac7B           GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHI----
2ac7A           GTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHI----
2bsxA           AQELNVPVFNGISVSSDMYYPNKPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWD
3df9A           IAELNLNAVRGLIVSGDAFINGSVGAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQS
3df9B           IAELNLNAVRGLIVSGDAFINGSVGAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQS
2ai3A           WKQMGEQRELGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
1a9qA           WKQMGEQRELGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDT
3e0qA           AEENGFGNLVGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDV
2a8yA           AKELNIKTHESGTYICIEGPRFSTESRTWREVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVAEI
3c74A           AKSIGATTHVGVTASSDTFYPRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN-----
3ddoE           AKSIGATTHVGVTASSDTFYPGQKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNR----
3dp9A           LAQLPNTAVRGLICTGDAFVCTERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKES
3e9rB           AEENGFGNLVGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDV
1b8oA           WKQMGEQRELGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
3bgsA           WKQMGEQRELGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
3eeiA           ARTFEGAVEQGLIVSGDRFVHSSEGAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEAD
3c74F           AKSIGATTHVGVTASSDTFYPRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
1a9oA           WKQMGEQRELGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK---VI
3c74E           AKSIGATTHVGVTASSDTFYPGQKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
3dp9C           LAQLPNTAVRGLICTGDAFVCTERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKES
2a0wA           WKQMGEQRELGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
3bsfA           NLIKELNLKVGRLSTGDSMDMS-PHDEESITANDATVKDMEGAAVAYVADIFKVPTILIKGVTDIVDGNR
2a0xA           WKQMGEQRELGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
3bl6A           VQQQQLTAKVGLIVSGDSFIGSVERQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEA
2ai2A           WKQMGEQRELGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
2a0yA           WKQMGEQREEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
1b8nA           WKQMGEQRELGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY
1cb0A           AKKLGLRCHSKGTMVTIEGPRFSSRASFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYD--CW
3djfB           AEENGFGNLVGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLES
2b94A           AQELEVPVFNGISLSSDLYYPHKPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPL---
3e9zC           AEENGFGNLVHQVMNGGPCYETPAE-CTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNIKPNHE
3bjeA           NTSLYYSA-------------GSLKFNLSNGVEVVTNIEMETSAICYLSDMLGYQAGAACVVVSRVGEKK
1c3xA           VDPT---LPEGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTNLGISPT
3e0qB           AEENGFGNLVHQVMNGGPCYETPAEC-TMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDV
3e9zB           AEENGFGNLVHQVMNGGPCYETPAEC-TMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTN--ISVL
3e9rC           AEENGFGNLV------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ETTSEERQTTFTKMMEVALDAAITL
3ddoC           QQNAETMKQTESHAVKIVVEAARRL
3ddoF           IPNASH-------AVKIVVEAARRL
3ddoA           TSH----------AVKIVVEAARRL
3ddoB           IPTESHAVKIVVEAARRLL------
3dpsF           QTESH--------AVKIVVEAARRL
1a69C           ----AERQTTFNDMIKIALESVLLG
2ac7B           ------FQTTFNEMIEIALDAA---
2ac7A           -------QTTFNEMIEIALDAA---
2bsxA           ELVPHQ----LENMIKIALGACAKL
3df9A           HLSFDEFLAVAAKQSSLMVESLV--
3df9B           HLSFDEFLAVAAKQSSLMVESLV--
2ai3A           KANHEEVLEAGKQAAQKLEQFVSLL
1a9qA           ESQGKANHEEVLEAGKQAAQKLEQF
3e0qA           ESDLKPNHEEVLATGAQRAELMQSW
2a8yA           PVTAEEVTRVMAENTEKAKKLLYAL
3c74A           ---RTQQEIPESHAVKIVVEAARRL
3ddoE           ----TQQKQTESHAVKIVVEAARRL
3dp9A           PLSFEEFPLAAKSSSAMVLKMVELL
3e9rB           EEEVLATGAQRAELMQSWFEKII--
1b8oA           ESQGKANHEEVLEAGKQAAQKLEQF
3bgsA           ESLEKANHEEVLAAGKQAAQKLEQF
3eeiA           ISFDEFLKTAAANSAKMVAEIVKSL
3c74F           IPNAETMK--ESHAVKIVVEAARRL
1a9oA           MDTESQGKANHEEVLEAGKQAAQKL
3c74E           IPSHAVKIV----------------
3dp9C           PLSFEEFPLAAKSSSAMVLKMVELL
2a0wA           ESLEKANGEEVLAAGKQAAQKLEQF
3bsfA           PTSEEFLENLAAVTAKLDESLTKVI
2a0xA           ESLEKANFEEVLAAGKQAAQKLEQF
3bl6A           EMSFEALEKAAVSSSQTVEALVSQL
2ai2A           ESQGKANHEEVLEAGKQAAQKLEQF
2a0yA           ESLEKANDEEVLAAGKQAAQKLEQF
1b8nA           ESQGKANHEEVLEAGKQAAQKLEQF
1cb0A           AVSVDRVLKTLKENANKAKSLLLTT
3djfB           AQRAELMQSWFEKIIEKLP------
2b94A           --KWNLVPEKLENMIKISLETC---
3e9zC           EVTGAQRAELMQSWFEKII------
3bjeA           MFLGDQLDAAMKRCIKIILEALV--
1c3xA           PLSHAEVIEAGQAAGPRISALLADI
3e0qB           EQRAELMQSWFEKIIE---------
3e9zB           DVEHEEVLATGAQRAELM-------
3e9rC           -------------------------