[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81144.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2akjA.bssp"
#ERROR : Can't open dsspfile "4aopA.bssp"
#ERROR : Can't open dsspfile "1aopA.bssp"
#ERROR : Can't open dsspfile "1bqxA.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "1dwlA.bssp"
#ERROR : Can't open dsspfile "1clfA.bssp"
#ERROR : Can't open dsspfile "1bc6A.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "1b0vA.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"
#ERROR : Can't open dsspfile "1d0cB.bssp"
#ERROR : Can't open dsspfile "1b0tA.bssp"
#ERROR : Can't open dsspfile "1d3wA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"

## Summary of PDB Search
:326
    4e-28  17%  2akjA  [x.x.x] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST
    2e-20  23%  4aopA  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    2e-19  29%  1aopA  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    1e-09  22%  1bqxA  [d.58.1] PROTEIN (FERREDOXIN)
    5e-09  32%  1durA  [d.58.1] 2[4FE-4S] FERREDOXIN
    6e-09  20%  1dwlA  [i.4.1] FERREDOXIN I
    1e-08  39%  1clfA  [x.x.x] FERREDOXIN
    3e-08  23%  1bc6A  [x.x.x] 7-FE FERREDOXIN
    1e-07  19%  1bluA  [x.x.x] FERREDOXIN
    2e-07  25%  1a6lA  [x.x.x] FERREDOXIN
    1e-06  15%  1b0vA  [d.58.1] PROTEIN (FERREDOXIN)
    2e-06   8%  1d0cA  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    2e-06   9%  1d0cB  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    4e-06  25%  1b0tA  [d.58.1] PROTEIN (FERREDOXIN I)
    7e-06  14%  1d3wA  [d.58.1] FERREDOXIN 1
    1e-05  30%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
:326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTRQGFEIPGIDM
2akjA           --------------------------RLKLPNGVTTSEQTRYLASVIKKYGDGCADVTTRQNWQIRGVVL
4aopA           --------------------------RCRLPGGVITTKQWQAIDKFAGENIYGSIRLTNRQTFQ------
1aopA           ------------------------------PARPLKTGLL----EIAK-IHKGDFRITANQNLIIAGVPE
1bqxA           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1dwlA           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------
1bc6A           ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1b0vA           ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDIPEVNKKLQPIIEALEINQENPGDGYNAAGTRNVSACIGNNVCPFANYNTTNFAKKIEKAIFPNDLHF
2akjA           PD-------VPEIIKGLESVGLTSLQSGMDN-VRNPVGNPLAGIDPHEIVDTRPFTNLISQFVTANSRGW
4aopA           ---------FHGILPVHQMLHSVGLDALNDM--NRNVLCTSNPYESQLHAEAYEWAKKISEHLLPLPRKF
1aopA           SEKAKIEK----------IAKESGLMNAVTPQRENSMACVSFPTCPLAMAEAERFLPSFIDNIGVSDEHI
1bqxA           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1dwlA           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------
1bc6A           ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1b0vA           ----------------------------------------------------------------------
1d0cA           ------------------PRVKNWELGYDTLCAQSQQDGPCTPRRCLGSLVLPRKGPPPAEQLLSQARDF
1d0cB           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGACVRACKKKATGALSFENFKVVRDGSKCIGCG
2akjA           NPCVIGSHDLYEHPHINDLAYMPATKNGKFGFNLLVGGFFKRCEEAIPLDAWVSAEDVVPVCKAMLEAFR
4aopA           KTTVVIPPQNDIDLHANDMNFVA-----------------------------------------------
1aopA           VMRVTGCPNGCGRAMLAEVGLVGKAPGRYN----------------------------------------
1bqxA           --------------------------VITEPCIGTKCASCVEVCP---VDCIHEGEDQYYIDPDVCIDCG
1durA           ----------------------------VINDSCIACGACKPECPVNCIQ----EGSIYAIDADSCIDCG
1dwlA           ----------------------------IDHEECIGCESCVELCPEVFAMIDGEEKAMVTAPDSTAECAQ
1clfA           ----------------------------KIADSCVSCGACASEC---PVNAISQGDSIFVIDADTCIDCG
1bc6A           ----------------------------VITEPCIGTKSCVEVCP---VDCIHEGEDQYYIDPDVCIDCG
1bluA           ------------------------------TDECINCDVCEPECPNGAIDETYVIEPSLCTECVGHYETS
1a6lA           ----------------------------VVTDNCIKCKDCVEVCP---VDCFYEGPNFLVIHPDECIDCA
1b0vA           ----IKCKYDCVEVCPVDCFYEGPNFLVIHPDECNDCALCEPECPAQAEVPEDMQEFIQLNAELAEVWPN
1d0cA           INQYYSSKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQYICNHIK
1d0cB           ------IKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQYICNHIK
1b0tA           ----------------------------VVTDNCIKCKKCVEVCP---VDCFYEGPNFLVIHPDECIDCA
1d3wA           ----IKCKYECVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAEVPEDMQEFIQLNAELAEVWPN
3bk7A           --------------------------------DKCGHFLCERVCPVNRMGGEAIENYKPIIQEASCTGCG


                         .         .         .         +         .         .         .:280
query           ECVMNCPTNAWTRSKEKYYRLAIMGRTGKKNPRLAEDFILWVDEDSIIKIILNTYKYVTEYIAKDAPGGK
2akjA           DLGFRGNRQKC-----------------------------------------------------------
4aopA           ----------------------------------------------------------------------
1aopA           ----------------------------------------------------------------------
1bqxA           ACEAVCPVSAIY---HEDFVPEEWKSYIQKNRDFFK----------------------------------
1durA           SCASVCPVGAPN----------------------------------------------------------
1dwlA           DAIDACPVEAIS----------------------------------------------------------
1clfA           NCANVCPVGAPV----------------------------------------------------------
1bc6A           ACEAVCPVSAIYHEDFV-----------------------------------------------------
1bluA           QCVEVCPVDCEDELRAKYERIT------------------------------------------------
1a6lA           LCEPECPAQAIF----------------------------------------------------------
1b0vA           ITEKKDPLPDAEDWDGVKGKLQHLER--------------------------------------------
1d0cA           YAT--NRGNLRSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVR----------------------
1d0cB           YAT--NRGNLRSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPAN----------VEITELC
1b0tA           LCEPECPAQAIFSEDEV-----------------------------------------------------
1d3wA           ITEKKDPLPD------------------------------------------------------------
3bk7A           ICVHKCPFNAISIVNLPEQ---------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EHIGYIIDRTGFMEFKKWxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2akjA           ----------------------------------------------
4aopA           ----------------------------------------------
1aopA           ----------------------------------------------
1bqxA           ----------------------------------------------
1durA           ----------------------------------------------
1dwlA           ----------------------------------------------
1clfA           ----------------------------------------------
1bc6A           ----------------------------------------------
1bluA           ----------------------------------------------
1a6lA           ----------------------------------------------
1b0vA           ----------------------------------------------
1d0cA           ----------------------------------------------
1d0cB           IQHGWTPGNGRFDVLPLL----------------------------
1b0tA           ----------------------------------------------
1d3wA           ----------------------------------------------
3bk7A           ----------------------------------------------