[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81145.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1amoA.bssp"
#ERROR : Can't open dsspfile "2bmwA.bssp"
#ERROR : Can't open dsspfile "1bx1A.bssp"
#ERROR : Can't open dsspfile "1ddgA.bssp"
#ERROR : Can't open dsspfile "1b2rA.bssp"
#ERROR : Can't open dsspfile "1bqeA.bssp"
#ERROR : Can't open dsspfile "1bx0A.bssp"
#ERROR : Can't open dsspfile "2bsaA.bssp"
#ERROR : Can't open dsspfile "2eixA.bssp"
#ERROR : Can't open dsspfile "1bjkA.bssp"
#ERROR : Can't open dsspfile "2bn4B.bssp"
#ERROR : Can't open dsspfile "2bf4A.bssp"
#ERROR : Can't open dsspfile "2bn4A.bssp"
#ERROR : Can't open dsspfile "2bpoA.bssp"
#ERROR : Can't open dsspfile "1e64A.bssp"
#ERROR : Can't open dsspfile "1e63A.bssp"
#ERROR : Can't open dsspfile "2b5oA.bssp"
#ERROR : Can't open dsspfile "2bgiA.bssp"
#ERROR : Can't open dsspfile "2bgjA.bssp"
#ERROR : Can't open dsspfile "1a8pA.bssp"
#ERROR : Can't open dsspfile "1cneA.bssp"
#ERROR : Can't open dsspfile "1e62A.bssp"
#ERROR : Can't open dsspfile "1cqxA.bssp"
#ERROR : Can't open dsspfile "1cnfA.bssp"
#ERROR : Can't open dsspfile "2cc2C.bssp"
#ERROR : Can't open dsspfile "3cxjA.bssp"
#ERROR : Can't open dsspfile "1ekmA.bssp"

## Summary of PDB Search
:263
    6e-28  14%  1amoA  [c.23.5 - b.43.4 - c.25.1] NADPH-CYTOCHROME P450 REDUCTASE
    2e-26  17%  2bmwA  [x.x.x] FERREDOXIN--NADP REDUCTASE
    3e-25  18%  1bx1A  [b.43.4 - c.25.1] PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
    4e-25  13%  1ddgA  [b.43.4 - c.25.1] SULFITE REDUCTASE (NADPH) FLAVOPROTEIN
    3e-23  17%  1b2rA  [b.43.4 - c.25.1] PROTEIN (FERREDOXIN-NADP+ REDUCTASE)
    6e-23  16%  1bqeA  [b.43.4 - c.25.1] FERREDOXIN--NADP REDUCTASE
    7e-23  19%  1bx0A  [b.43.4 - c.25.1] PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
    1e-22  17%  2bsaA  [x.x.x] FERREDOXIN-NADP REDUCTASE
    1e-22  24%  2eixA  [x.x.x] NADH-CYTOCHROME B5 REDUCTASE
    1e-22  16%  1bjkA  [x.x.x] FERREDOXIN--NADP+ REDUCTASE
    2e-22  18%  2bn4B  [x.x.x] NADPH CYTOCHROME P450 REDUCTASE
    2e-22  18%  2bf4A  [x.x.x] NADPH-CYTOCHROME P450 REDUCTASE
    2e-22  16%  2bn4A  [x.x.x] NADPH CYTOCHROME P450 REDUCTASE
    3e-22  17%  2bpoA  [x.x.x] NADPH-CYTOCHROM P450 REDUCTASE
    5e-22  16%  1e64A  [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
    5e-22  16%  1e63A  [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
    1e-21  18%  2b5oA  [x.x.x] FERREDOXIN--NADP REDUCTASE
    1e-21  15%  2bgiA  [x.x.x] FERREDOXIN-NADP(H) REDUCTASE
    2e-21  16%  2bgjA  [x.x.x] FERREDOXIN-NADP(H) REDUCTASE
    9e-21  19%  1a8pA  [x.x.x] NADPH\:FERREDOXIN OXIDOREDUCTASE
    1e-20  19%  1cneA  [x.x.x] NITRATE REDUCTASE
    4e-20  17%  1e62A  [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
    1e-19  17%  1cqxA  [a.1.1 - b.43.4 - c.25.1] FLAVOHEMOPROTEIN
    1e-18  19%  1cnfA  [x.x.x] NITRATE REDUCTASE
    3e-16  11%  2cc2C  [x.x.x] 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
    8e-11   3%  3cxjA  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-08  13%  1ekmA  [d.17.2 - d.17.2 - b.30.2] COPPER AMINE OXIDASE
:263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xHNEYTPFISKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRRVGV
1amoA           ----------YLSWVVEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSISKVHPNSVHICAVAVEY
2bmwA           --APFIGKVISNEPLVKEGGIGIVQHIKFDLKYIEGQSIGIIPPGVDKNLYSIADVDDKTISLCVRQLGV
1bx1A           ----YVGRCLLNTKITGDDAPGETWHMVFSHEYREGQSVGVIPDGEDKNLYSIASSALGSVSLCVKRLGV
1ddgA           --------------LVGDKAKLQHYAATTPIVDSPAQLDAEALINLLRPLYSIASVGVVRYDVEGRARGA
1b2rA           ----------EPLVKEGGIGIVQHIKFDLTGKYIEGQSIGIIPPGVDKNLYSIADVDDKTISLCVRQLGV
1bqeA           --APFIGKVISNEPLVKEGGIGIVQHIKFDLKYIEGQSIGIIPPGVDKNTRHGDDVDDKTISLCVRQLGV
1bx0A           ----YVGRCLLNTKITGDDAPGETWHMVFSHEYREGQSVGVIPDGEDKNLYSIASSALGDVSLCVKRLGV
2bsaA           ----------EPLVKEGGIGIVQHIKFDLTGKYIEGQSIGIIPPGVDKNLYSIADVDDKTISLCVRQLGV
2eixA           ----------MLREKQIINHNTRLFRFNLHHPLPIGQHMSVKATVDGKEIYRPYTPEKGYFDLIIKVYGQ
1bjkA           ----------EPLVKEGGIGIVQHIKFDLTGKYIEGQSIGIIPPGVDKNLYSIDDVDDKTISLCVRQLGV
2bn4B           --------------------------------SIVENFPNPELPDAPPVLLRNIQLAQNNVNIAETNLHY
2bf4A           --------------------------------SIVENFPNPELPDAPPVLLRNIQLAQNNVNIAETNLHY
2bn4A           --------------------------------SIVENFPNPELPDAPPVLLRNIQLAQNNVNIAETNLHY
2bpoA           --------------------------------SIVENFPNPELPDAPPVVLRNIQLAQNNVNIAETNLHY
1e64A           ----------EPLVKEGGIGIVQHIKFDLTGKYIEGQSIGIIPPGVDKNLYSIADVDDKTISLCVRQLEY
1e63A           ----------EPLVKEGGIGIVQHIKFDLTGKYIEGQSIGIIPPGVDKNLYSIADVDDKTISLCVRQLGV
2b5oA           ----------YELVDEGGSGTVRHVTFDISERYLEGQSIGIIPPGEDKNTRHGDMEDNKTVSLCVRQLEY
2bgiA           ------PDAQTVTSVRHWTDTLFSFRVTRPQRFRSGEFVMIGLLDDNGKPIMRAYSIASLEFYSIKVPDG
2bgjA           ------PDAQTVTSVRHWTDTLFSFRVTRPQRFRSGEFVMIGLLDDNGKPIMASPAWDEELEFYSIKVGP
1a8pA           --SNLNVE--RVLSVHHWNDTLFSFKTTRNPRFENGQFVMIGLEVDGRPLMRASPNYEEHLEFFSIKVGP
1cneA           ----------RLVAKKELSRDVRLFRFSLPSPLPIGKHIFVCATIEGKLCMRAYTPEIGHFDLLVKVYFK
1e62A           ----------EPLVKEGGIGIVQHIKFDLTGKYIEGQSIGIIPPGVDKNLYSIADVDDKTISLCVRQLGV
1cqxA           -------RTFVIREKRPESDVITSFILEPADNFEPGQYTSVAIDVPALGLQQSDMPNGRTYRISVKREYV
1cnfA           ----------RLVAKKELSRDVRLFRFSLPSPLPIGKHIFVCATIEGKLCMRAMVDEIGHFDLLVKVYFK
2cc2C           ----------TVVDVCHSMTPWDVEEGARYRFFPEGTVFATTTPATGTTTVRIKQAAKQWAGSGAGFEGL
3cxjA           -EGFLREVPDENARFHYVVNYPEDHVIDIIQPAGKDDILIACATSVSPEHQAGIRALSEKRTEFIWKVTL
1ekmA           ----------------------------------EKKVIFIDIPNRRRKVSKHKHANFYPKHMIEKVGRP


                         .         .         *         .         .         .         .:140
query           VTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFK
1amoA           EAKSGRVNKEPALVPMFVRKSQ-FRLPFKSTTPVIMVGPGTGIAPFMGFIQERAWLREQGETLLYYGCRR
2bmwA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAAFSWLVFGVP
1bx1A           CSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDGLAWLFLGVP
1ddgA           SSFLADRVEEEGEVRVFIEHNDNFRLPANPETPVIMIGPGTGIAPFRAFMQQRAADEAPGKNWLFFGNPH
1b2rA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAGFSWLVFGVP
1bqeA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGIAPMRTYLWRMFKDAERAGFSWLVFGVP
1bx0A           CSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMHDDYKFNGLAWLFLGVP
2bsaA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLRAANPEYQFKGFSWLVFGVP
2eixA           MSQYIDHLNPGDFLQVRGPK-GQFDYKPNMVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANV
1bjkA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAQFKGFSWLVFGVP
2bn4B           DLNGPRKLFANYKLPVHVRRSNFRLPSN-PSTPVIMIGPGTGVAPFRGFIREKGGNNVSLGKHILFYGSR
2bf4A           DLNGPRKLFANYKLPVHVRRSNFRLPSN-PSTPVIMIGPGTGVAPFRGFIREKGGNNVSLGKHILFYGSR
2bn4A           DLNGPRKLFANYKLPVHVRRSNFR-LPSNPSTPVIMIGPGTGVAPFRGFIRERGGNNVSLGKHILFYGSR
2bpoA           DLNGPRKLFANYKLPVHVRRSN-FRLPSNPSTPVIMIGPGTGVAPFRGFIRERVAFLESQKNHILFYGSR
1e64A           KHPESGETVPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAQFKGFSWLVFGVP
1e63A           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAGFSWLVFGVP
2b5oA           QDPESGETVYTDDVKITGPVGKEMLLPDDEDATVVMLATGTGIAPFRAFLWRMHEDYKFKGKAWLIFGVP
2bgiA           PLTSRLQHIVGEQIILRPKPVGTLVIDALPGKRLWFLATGTGIAPFASLMREPEAYEKFDE-VIMMHACR
2bgjA           LTSRLQHIKVGEQIILRPKPVGTLVIDALLPKRLWFLATGTGIAPFASLMREPEAYEKFDE-VIMMHACR
1a8pA           LTSRLQHLKEGDELMVSRKPTGTVTSDLLPGKHLYMLSTGTGLAPFMSLIQDPEVYERFEK-VVLIHGVR
1cneA           NEHPKFPNGVGSYIDVKGPLGHVINGKQRNARRLAMICGGSGITPMYQIIAVLRDQPEDHTEMHLVYANR
1e62A           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANSWLVFGVP
1cqxA           SNLLHDHVNVGDQVKLAAPYGSFHIDVD-AKTPIVLISGGVGLTPMVSMLKVALQAPPR--QVVFVHGAR
1cnfA           NEHPKFPNGVGSYIDVKGSFVINGKQRNAR--RLAMICGGSGITPMYQIIAVLRDQPEDHTEMHLVYANR
2cc2C           LTTVLEEHGYLEAYEVTSPKVIPEPEPTFYSRESAHLAAGFPLSEVGRPLEDHEAVEQDGEALVVSAIDH
3cxjA           NRFGVDFQLHPENVLNSYLVTDEIFFDGLSKDRLISSIKNVFRAKLQVWI--------------------
1ekmA           EAPPINVTQEGVSFKMTGNVM-----------EWSNFKFHIGFNYREGIVLSVSYNDHGNVRPIFHRISL


                         +         .         .         .         .         *         .:210
query           GPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYIPELEIKDMDNVQVIVVGPPMMMKFTVLE
1amoA           SDEDYLYREELARFHKQLNVAFSREQAHKVYVQHLLKRDREHLWKLIHE-GGAHIYVCGDARNMAKDVQN
2bmwA           TTPNILYKEELEEIQQKYRLTYAISREQKNPQGGRMYIQDRVAEHADQKNQKTHTYICGPPPMEEGIDAA
1bx1A           TSSSLLYKEEFEKMKEKAPLDFAVSREQTNEKGEKMYIQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDI
1ddgA           FTEDFLYQVEWQRYVKLTRIDLAWSRDQKEKVYVQDKLREQGAELWRWINDGAHIYVCGDANRMAKDVEQ
1b2rA           TTPNILYKEELEEIQQNFRLTYAISREQKNPQGGRMYIQDRVAEWQLIKNQKTHTYICGLRGMEEGIDAA
1bqeA           TTPNILYKEELEEIQQKYRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQKTHTYICGLRGMEEGIDAA
1bx0A           TSSSLLYKEEFEKMKENFRLDFAVSREQTNEKGEKMYIQTRMELWEMLKKDNTYFYMCGLKGMEKGIDDI
2bsaA           TTPNILYKEELEEIQQNFRLTYAISREQKNPQGGRMYIQDRVAEHADQKNQKTHTYICGLRGMEEGIDAA
2eixA           NEDDILLRTELDDMAKNFKVYYVLNNPPAGWTGGVGFVSADMIKQHFSPPSDIKVMMCGPPMMNKAMQGH
1bjkA           TTPNILYKEELEEIQQKYPLTYAISREQKNPQGGRMYIQDRVAEHADQKNQKTHTYICGLEGMEEGIDAA
2bn4B           NTDDFLYQDEWPEYAKKLDGSFEMVVAHSRPNTKKVYVQDKLKDYEDQINNGAFIYVCGDAKGMAKGVST
2bf4A           NTDDFLYQDEWPEYAKKLDGSFEMVVAHSLPNTKKVYVQDKLKDYQVFEMNGAFIYVCGDAKGMAKGVST
2bn4A           NTDDFLYQDEWPEYAKKLDGSFEMVVAHSRLPNTQDKLKDYEDQVFEMINNGAFIYVCGDAKGMAKGVST
2bpoA           NTDDFLYQDEWPEYAKKLDMVVAHSRLPNTKKVYVQDKLKYEDQVFEMINNGAFIYVCGDAKGMAKGVST
1e64A           TTPNILYKEELEEIQQNFRLTYAISREQKNPQGGRMYIQDRVAEWQLIKNQKTHTYICGLRGMEEGIDAA
1e63A           TTPNILYKEELEEIQQKYRLTYAISREQKNPQGGRMYIQDRVAEHADQKNQKTHTYICGLRGMEEGIDAA
2b5oA           YTANILYKDDFEKMAAENPLTYAISREQKTADGGKVYVQSRVSEYADEQKPNTHVYMCGLKGMQPPIDET
2bgiA           TVAELEYGRQLVEALQEDPLIGELVTTTREEFHHMGRITDNLASGKVFNPETDRAMVCGSLAFNVDVMKV
2bgjA           TVAELEYGRQLVEALQEDPLIGELVEGTREEFHHMGRITDNLLGIAPMNPETDRAMVCGSLAFNVDVMKV
1a8pA           QVNELAYQQFITEHLPQSEKLIYYPTVTRESFHNQGRLTDLMRSLPPINPQDDRAMICGSPSMLDESCEV
1cneA           TEDDILLRDELDRWAAEYPDRLKVKRPEEGWKYSVGFVTAVLREHVPEGGDDTLALASGPPPMIQFAISP
1e62A           TTPNILYKEELEEIQQNFRLTYAISREQKNPQGGRMYIQDRVAEHADQKNQKTHTYICGLRGMEEGIDAA
1cqxA           NSAVHAMRDRLREAAKNLDLFVFYDQPLPEDVQGRDYDYPGLVDEKSILLPDADYYICGPIPFMRMQHDA
1cnfA           TEDDILLRDELDRWAAEYPDRLKVKRPEEGWKYSVGFVTEAVLREHVPEGDDTLALACGPPPMIQFAISP
2cc2C           PFGNVWTNIHRTDLEKAGARLRLTLDGVLPFEAPLTPTFADAGE------IGNIAIYLNSRGYLSI-ARN
3cxjA           ----------------------------------------------------------------------
1ekmA           SEMIVPYGSPEFPHQRKHAL--DIGEYGAGYMTNPLSLGCDCKGV-IHYLDAHFSDRAGDPITVK-----


                         .         .         .         +         .         .         .:280
query           FLKRGIKEENIWISQERKMCCGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1amoA           TFYIVAEFGPM------------------------------------------
2bmwA           LSAAAAKEGVTWSDYQKDLKK--------------------------------
1bx1A           MVSLAAAEGIDWIEYKRQLKK--------------------------------
1ddgA           ALEVIAEFGGM------------------------------------------
1b2rA           LSAAAAKEGVTW-----------------------------------------
1bqeA           LSAAAAKEGVTWSDYQKDL----------------------------------
1bx0A           MVSLAAAEGIDWIEYKRQLKK--------------------------------
2bsaA           LSAAAAKEGVTW-----------------------------------------
2eixA           LETLGYTPEQWF-----------------------------------------
1bjkA           LSAAAAKEGVTWSDYQKDLKK--------------------------------
2bn4B           ALGILSRGKSI------------------------------------------
2bf4A           ALGILSRGKSI------------------------------------------
2bn4A           ALGILSRGKSI------------------------------------------
2bpoA           ALVILSRGKSI------------------------------------------
1e64A           LSAAAAKEGVTWSDYQKDL----------------------------------
1e63A           LSAAAAKEGVTWSDYQKDL----------------------------------
2b5oA           FTAEAEKRG---LNWEEMR----------------------------------
2bgiA           LESYGLREGANSFVVEKFVGEG-------------------------------
2bgjA           LESYGLREGANSFVVEKFVGEG-------------------------------
1a8pA           LDGFGLKISPR------------------------------------------
1cneA           NLEMKYDMANS------------------------------------------
1e62A           LSAAAAKEGVTWSDYQKDL----------------------------------
1cqxA           LKNLGIHEARIH-----------------------------------------
1cnfA           NLEMKYDMANSF-----------------------------------------
2cc2C           AASLAYPYHLKEGMSAR------------------------------------
3cxjA           -----------------------------------------------------
1ekmA           -----------------------------------------------------