[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81146.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0tA.bssp"
#ERROR : Can't open dsspfile "1d3wA.bssp"
#ERROR : Can't open dsspfile "2bs2B.bssp"

## Summary of PDB Search
:338
    5e-07  12%  1b0tA  [d.58.1] PROTEIN (FERREDOXIN I)
    6e-05  14%  1d3wA  [d.58.1] FERREDOXIN 1
    7e-04  15%  2bs2B  [d.15.4 - a.1.2 (1e7pB)] QUINOL-FUMARATE REDUCTASE
:338

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
2bs2B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
2bs2B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
2bs2B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxERCIACGRCNFVCPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDK
1b0tA           ----------DNCIKCKYCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSE----------
1d3wA           ----------DNCIKCKYCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIF------------
2bs2B           ---------------------------------------------------------------RVVRFMI


                         .         *         .         .         .         .         +:350
query           GQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICPEYISFSECVNKLKDxxxxxxxxx
1b0tA           ---DEVPEDMQEFIQLNAELAEVWPNITEDKDPLPDAEDWDGVKGKLQH---------
1d3wA           ---SEDEVPEDMQEFIQLNAELAEVWPNITEKKDP-----------------------
2bs2B           DPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLR----------