[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81193.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dtzA.bssp"
#ERROR : Can't open dsspfile "2dbpA.bssp"
#ERROR : Can't open dsspfile "1bkaA.bssp"
#ERROR : Can't open dsspfile "1b1xA.bssp"
#ERROR : Can't open dsspfile "2b65A.bssp"
#ERROR : Can't open dsspfile "2de3A.bssp"
#ERROR : Can't open dsspfile "1ce2A.bssp"
#ERROR : Can't open dsspfile "1biyA.bssp"
#ERROR : Can't open dsspfile "2de2A.bssp"
#ERROR : Can't open dsspfile "1blfA.bssp"
#ERROR : Can't open dsspfile "2de3B.bssp"
#ERROR : Can't open dsspfile "2b4lA.bssp"
#ERROR : Can't open dsspfile "2czlA.bssp"
#ERROR : Can't open dsspfile "2bjjX.bssp"
#ERROR : Can't open dsspfile "1d4nA.bssp"
#ERROR : Can't open dsspfile "1eexA.bssp"
#ERROR : Can't open dsspfile "1dotA.bssp"
#ERROR : Can't open dsspfile "2b4mA.bssp"
#ERROR : Can't open dsspfile "1aivA.bssp"
#ERROR : Can't open dsspfile "2d3iA.bssp"
#ERROR : Can't open dsspfile "3e78A.bssp"

## Summary of PDB Search
:334
    2e-14  10%  1dtzA  [c.94.1 - c.94.1] APO LACTOFERRIN
    2e-14  11%  2dbpA  [x.x.x] TTHA1568
    1e-13  11%  1bkaA  [x.x.x] LACTOFERRIN
    3e-13   9%  1b1xA  [c.94.1 - c.94.1] LACTOFERRIN
    4e-13  15%  2b65A  [x.x.x] LACTOTRANSFERRIN
    5e-13   9%  2de3A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    7e-13  16%  1ce2A  [c.94.1 - c.94.1] PROTEIN (LACTOFERRIN)
    2e-12  15%  1biyA  [x.x.x] LACTOFERRIN
    4e-12   9%  2de2A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    6e-12   9%  1blfA  [x.x.x] LACTOFERRIN
    2e-11  10%  2de3B  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    3e-11  10%  2b4lA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    9e-10  12%  2czlA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1568
    1e-09  12%  2bjjX  [x.x.x] LACTOTRANSFERRIN
    5e-09  12%  1d4nA  [c.94.1] TRANSFERRIN
    1e-08  11%  1eexA  [c.1.19] PROPANEDIOL DEHYDRATASE
    9e-07  16%  1dotA  [x.x.x] DUCK OVOTRANSFERRIN
    7e-06  11%  2b4mA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    8e-06  16%  1aivA  [c.94.1 - c.94.1 (1ryxA)] OVOTRANSFERRIN
    2e-05  17%  2d3iA  [x.x.x] OVOTRANSFERRIN
    3e-04   8%  3e78A  [x.x.x] HIGH AFFINITY TRANSPORT SYSTEM PROTEIN P37
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSIEIVVPDGLPAISIVKMIKEKPEIMKGLDI
1dtzA           --------------------------------------KSVRWCTTSPAESKKCAQWQRRMKKVR-GPSV
2dbpA           -------------------------------------------------PCPNDTFIFYALVHGRVESPV
1bkaA           ------------------------------------------------------------------GPPV
1b1xA           ------------------------------------------------------------------GPSV
2b65A           ------------------------------------------------------------------GQNV
2de3A           -------------------------------------------YSNSPVPNALLTASESGFLDAA-GIEL
1ce2A           ------------------------------------------------------------------GQIV
1biyA           ------------------------------------------------------------------APSI
2de2A           ------------------------------------------------------------------GIEL
1blfA           -------------------------------------------TISQPEWFKRWQWRMKKLG----APSI
2de3B           ------------------------------------------------------------------GIEL
2b4lA           ----------------------------------------------------------------------
2czlA           -----------------------------------------------------------------SPVPL
2bjjX           -------------------------------------------------PEATKCFQWQRNMRRVRGPPV
1d4nA           ---------------------------------------------HEATKCQSFRDHMKSVIPSD-GPSV
1eexA           ----------------------------------------------------------------------
1dotA           ------------------------------------------------------------------NGEV
2b4mA           ----------------------------------------------------------------------
1aivA           --------------------------------------------------------------DLTQQERI
2d3iA           --------------------------------------------------------------DLTQQERI
3e78A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGSLYVISSDDSVNSLEDLKGKD
1dtzA           TCVKKTSRFECIQAISTEKADAVTLDGGLVYDAGLDPYKLRPIAAEVYYYAVAIAKKGTNFQLNQLQGLK
2dbpA           PLEPVLEDETLNRWALEGRLPLTKLSYAAYAQVRDRYVALRSGGALGRGVGPLVVARGPL---QALEGLR
1bkaA           SCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYYYAVAVVKKGGSFQLNELQGLK
1b1xA           SCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPGKPQTRYYAVAVVKKGSGFQLNQLQGVK
2b65A           TCATASTTDDCIVLVLKGEADALNLDGGYIYTAGKCGLVPVLAETEGYLAVAVVKKANEGLTWNSLKDKK
2de3A           DVLSGQQGTVHFTYDQPAYTRFGGEIPPLLSEGLRAPGRTRLLGITPLLGRQGFRDDSPITAAADLAGRR
1ce2A           TCATASTTDDCIALVLKGEADALSLDGGYIYTAGKCGLVPVLAENRGYLAVAVVKKANEGLTWNSLKGKK
1biyA           TCVRRAFVLECIRAITEKKADAVTLDGGMVFEAGLDPYKLRPVAAEIYYYAVAVVKKGSNFQLDQLQGRN
2de2A           DVLSGQQGTVHFTYDQPAYTRFGGEIPPLLSEGLRAPGRTRLLGITPLRQGFFVRDDSPITAAADLAGRR
1blfA           TCVRRAFALECIRAIAEKKADAVTLDGGMVFEAGRDPYKLRPVAAEIYYYAVAVVKKGSNFQLDQLQGRK
2de3B           DVLSGQQGTVHFTYDQPAYTRFGGEIPPLLSEGLRAPGRTRLLGITPLLGGFFVRDDSPITAAADLAGRR
2b4lA           --------------------------------------------------------DENASAAEQVNKTI
2czlA           EPVLE-DVETLNRWALEGRLPLTKLSYAAYAQVRDRYVALRSGGALGRGVGPLVVA---RGPLQALEGLR
2bjjX           SCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERAVVKKGGSFQLNELQGLK
1d4nA           ACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYYYAVAVVKKDSGFQMNQLRGKK
1eexA           ----------------------------------------------ASSNDQTFTHSDMRRTARLLMQFL
1dotA           ECTILDDNKDCIVKITKGEADAISLDGGFVYTAGVCGLVPVVGESYEDETQCAVVKKSSAITWNNLQGKK
2b4mA           -------------------------------------------------------------AAEQVNKTI
1aivA           SLTCVQKATDCIKAIANNEADAISLDGGQAFEAGLAPYKLKPIAAEVYEHAVAVVKKGTEFTVNDLQGKT
2d3iA           SLTCVQKATDCIKAIANNEADAISLDGGQVFEAGLAPYKLKPISTTSYYAV-AVVKKGTEFTVNDLQGKT
3e78A           -----------------------NVYQSVYDPTVQANFYRGMIWIKGNDETLAKIKKAWDKDWNTFRNFG


                         +         .         .         .         .         *         .:210
query           VYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASELAPLFIEGKAKYAVVPEPMLTQIMTKKPETK
1dtzA           SHTGLGRSAGWNIPMGLLRPFLDWTGPPEPLQKAVAK------FFSASCVPCVDGKEYPNLCQLCAGTGE
2dbpA           VAVPGRHTTAYFLLSLYAQGFVPVEVRY---------DRILPMVAQGEVEAGLIIHESRFTYPRYGLVQV
1bkaA           SHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASC----VPGADKGQFPNLCRLCAGTGENK
1b1xA           SHTGLGRSAGWNIPIGTLRPYLNWTGPPEPL------QKAVANFFSASCVPCADGKQYPNLCRLCAGTEA
2b65A           SCHTAVDRTAGWNIPMGLIVNQTGSCSQSCAPGADPKSRLCAL-CAGDDQGLDKCVPNSKEKYYGYTGAF
2de3A           IGVSASAIRILRGQLGDYLELD-----PWRQTLVALGSWEARALLHTLEHGELGVDDVELVAVLASGDVD
1ce2A           SCHTAVDRTAGWNIPMLIANQTGSCAFDEFFSQSCAPKSRLCALCAGDDQGLDKCVPNSKEKYYGYT--G
1biyA           SCHTGLGRSAGNIPMGILRPYLSWTESLEPLQGAVAKFFSASC----VPCVDRQAYPNLCQLCKGEGENQ
2de2A           ITLVALGSWEARALLHTLEHGELGVDDVELVPISSPGVDVPASATVKGADLFPDVARGQAAVLASGDVDA
1blfA           SHTGLGRSAGWIIPMGILRPYLSWTESLEPLQGAVAK------FFSASCVPCIDRQAYPNLCQLCKGEG-
2de3B           IG-VSASAIRILRGQLGDYLELDPWRQTLVALGSWEARPISSPGVDVPAEQLEESATVKGADLFPDVARG
2b4lA           I-GIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLD
2czlA           VAVPGRHTTAYFLLSLYAQGFVPVEVRY---------DRILPMVAQGEVEAGLIIHESRFTYPRYGL--V
2bjjX           SCHTGLRRTAGNVPIGTLRPFLNWTGPPEPI-------EAAVARFFSASCVPGAQFPNLCRLCAGTGENK
1d4nA           SCHTLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCA-DGTDFPQLCQLCPGCGCSTLNQYF
1eexA           PGTDFISSGYSAVPNYDNMFAGSNEDAEDFDDYNLKVDGGLRPVREEDVIAIRNKAARALQAVFAGMGLP
1dotA           SCHTAVGRTAGNIPMGLIHNKTGSCDFDDYFSEGCAPGSPPN----------------------------
2b4mA           I-GIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYK-----
1aivA           SCHTGLGRSAGNIPIGTLLHRGAIEWEG------------------------------------------
2d3iA           SCHTGLGRSAGWNIPILIHRGAIEWEGIESGSVEQAVAKF------------------------------
3e78A           ILHGKDNSSSKFKLEETILKNHFQNKFEDRSAHPNAYKQKSADTLGTLDDFHIAFSEEGSFAWTHNKSAT


                         .         .         .         +         .         .         .:280
query           IVASLNEQWKEMSDSKMGYPQSSVIVKEDLAKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEEVGITG
1dtzA           NKCAC--------SSQEPYFGYSGAFKCLQDGAG-DVAFVKDSTVFESLPAKADRDQYELLCP-------
2dbpA           VDLG--AWWEERTGLPLPLG-----AILARRDLGEGLIRALDEAVRRSVAYALAHPEEALDYMRAHAQEL
1bkaA           CAFSSQEPY-----------FSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKP-
1b1xA           D-----KCACSSQEPYFGY----SGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYE-LLCPDNTRKP
2b65A           RCLAEDVGD--------VAFVKNDTVWENTNGESTADWAKNLKREDFRLLCLDGTRKPVTEAQSC-----
2de3A           ALYSWLPWAGELQATGRNAYASVWTVSSGLVRQRPGLVQRLVDAAVDAGLWARDHSDATSLHAANLGVST
1ce2A           AFRCLAEDV------GDVAFVKNDTVWENTNGESTADWAKNLNREDFRLLCLDGTRKPVTEA--------
1biyA           CACSPREPYFGYS----GAFKCLQDGAGDVAFVKETTVFENLPEKADRDQYELLCLNNTRAPVDAF----
2de2A           LYLQATGARPVVDLGLDEAYASVWTVSSGLVRQRPGLVQRLVDAAVDAGLWARDHSDATSLHAANLGVS-
1blfA           --------ENQCACSSREPYFGYSGAFKCLQDGAGDVAFVKETTVFENLPEKADRDQYE-----------
2de3B           QAAVLASGDVDAGLDERNAYASVWTVSSGLVRQRPGLVQRLVDAAVDAGLWARDHSDAVTSHAANLGVS-
2b4lA           DP----------KQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVE-----------
2czlA           QVVDLGAWWEERTGLPLPLGAI-----LARRDLGEGLIRALDEAVRRSVAYALAHPEEALDYMRAHAQEL
2bjjX           CAFSSQE----------PYFSYS-GAFKCLRDGAGDVA--FIRESTVFEDLSDEAERDE-----------
1d4nA           GYS--------------GAFKCLKDGAGDVAFVKESTIFENLANKADRDQYELLCLDNTKPVDEYKDCHL
1eexA           PI-----------TDEEVEAATYAHGSKDMPERNIVEDIKFAQEI----INKNRNGLEVKALAQGGFTDV
1dotA           ----------------------------------------------------------------------
2b4mA           ----------------------------------------------------------------------
1aivA           ----------------------------------------------------------------------
2d3iA           ----------------------------------------------------------------------
3e78A           KPFETKANE------KMEALIVTNPIPYDVGVFRKSVNQLEQNLIVQTFINLAKNKQDT-----------


                         .         *         .         .         .         .         +:350
query           KKEIIAKSLERANLNYVSALDSESEYIKYYDKIYSLEPKAIGGKKVNEEIFxxx
1dtzA           ------------------------------------------------------
2dbpA           SDEVIWAHVHTYVNAFSLDVGEEG--ERAVARLF--------------------
1bkaA           VDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLF---
1b1xA           VDAFKECHLARVPSHAVVARSVDGREDLIWK-----------------------
2b65A           ------------------------------------------------------
2de3A           --GAVGQGFGA-------------------------------------------
1ce2A           ------------------------------------------------------
1biyA           ------------------------------------------------------
2de2A           -TGAVGQGFGA-------------------------------------------
1blfA           ------------------------------------------------------
2de3B           -TGAVGQGFGA-------------------------------------------
2b4lA           ------------------------------------------------------
2czlA           SDEVIWAHVHTYVNAFSLDVG--EEGERAVARLF--------------------
2bjjX           ------------------------------------------------------
1d4nA           AQVPSHTVVARSMGGKEDLIW---------------------------------
1eexA           AQDMLNIQKAK-------------------------------------------
1dotA           ------------------------------------------------------
2b4mA           ------------------------------------------------------
1aivA           ------------------------------------------------------
2d3iA           ------------------------------------------------------
3e78A           ------------------------------------------------------