[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81206.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bu7A.bssp"
#ERROR : Can't open dsspfile "2btzA.bssp"
#ERROR : Can't open dsspfile "1ddqC.bssp"
#ERROR : Can't open dsspfile "2e4tA.bssp"
#ERROR : Can't open dsspfile "3crlA.bssp"
#ERROR : Can't open dsspfile "2bu6A.bssp"
#ERROR : Can't open dsspfile "3d2rB.bssp"

## Summary of PDB Search
:440
    3e-06   9%  2bu7A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    9e-06  13%  2btzA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    2e-05  10%  1ddqC  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    3e-05   8%  2e4tA  [x.x.x] ENDOGLUCANASE
    1e-04   8%  3crlA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    1e-04  10%  2bu6A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    5e-04  15%  3d2rB  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
:440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu7A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
2e4tA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu7A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
2e4tA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu7A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
2e4tA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxDKLEMEYKYYSNLKDNQEKVKRLYHDIKNHIACIEGNNKETGIRKKYIDS
2bu7A           -----------------------LEYKDTYGDDPVSNQNIQYFLDRFYLIRMLINQHTLIFDPKHIGSID
2btzA           ----------------------------------------------------------------------
1ddqC           ---------------------YARLQLIHKDTGLIKEDEVFLGHLPLMTEDGSFIINGADRVIVSQIHRS
2e4tA           --------------------DYGGGNHITGGIAQADVLGIFGKYGVYLATFWGDASNNYTEAGINLYTNY
3crlA           ---------------------------YFLDRFYLSRISIRMLINQHTLI-FDGSTNPAHPKHIGSIDPN
2bu6A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LNSEIDKLNLGFNTGNEVLDVILNNKREKCMENNISLKVFIDFSKVNFIEYFDICTIFSNCIDNAIEACK
2bu7A           PNCNVSEVVKDAY---DMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYSHLYHMLFELFKNAMRATV
2btzA           --------------------------------------------------------MLFELFKNAMRATV
1ddqC           PGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEASGVVTMKVNKRKFPLVLLLRVLGYDQETLVRELSA
2e4tA           DGKGGKFGDTSVKCETSDIEVSSAYASIVGEDDSKLHIILLNKNYDQPTTFNFSIDSSKNYTIGNVWAFD
3crlA           CSVSDVVKDA-----YDMAKLLCDKYYMASPDLEIQEVNATNATQPIHMVYSHLYHMLFELFKNAMRATV
2bu6A           --------------------------------------------------------MLFELFKNAMRATV
3d2rB           ------------------SRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYSHLHHMLFELFKNAMRATV


                         .         .         .         .         *         .         .:420
query           KIKDNNRYISLKGNCVNNFYVIKIENSKTNKIKKLNGDFLTDKKDKFLHGIGLKNIRLALEKYNGEIIIE
2bu7A           ESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI-ERLFSYMYSTAPGYGLPISRLYAKYFQGDLQLF
2btzA           ESSLILPPIKVMVALGEEDLSIKMSDRG-GGVPLRKIERLFSYMYSTAPGYGLPISRLYAKYFQGDLQLF
1ddqC           YGDLVQGLLDEAVLAMRPEEAMVRLFTLLRPGDPPK----KDKALAYLFGLLADPKRYDLGEAGRYKAEE
2e4tA           RGSSNITQRTPIVNIKDNTFTYTVPALTACHIV-------------------------------------
3crlA           ESSLTLPPIKIMVALGEEDLSIKMSDRGGLRKIERLFSYMYSTAPLAGFGYGLPISRLYAKYFQGDLQLF
2bu6A           EESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPGYGLPISRLYAKYFQGDLQLF
3d2rB           ENQPSLTPIEVIVVLGKEDLTIKISDRPLRIIDRLFSYTYSTAPTPPLAGYGLPISRLYAKYFQGDLNLY


                         .         .         +         .         .         .         .:490
query           PLDDKFILKMLIPINQEKEA
2bu7A           SMEGFTDAVIYLKALSTDSV
2btzA           SMEGFAVIY--LKALSTDSV
1ddqC           KLGVGLSGRTLVRFE-----
2e4tA           --------------------
3crlA           SMEGFAVIY--LKALSTDSV
2bu6A           SMEGFAVIY--LKALSTDSV
3d2rB           SLSGYAIIY--LKALSSESI