[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81382.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bjfA.bssp"
#ERROR : Can't open dsspfile "3e0vB.bssp"
#ERROR : Can't open dsspfile "2c39W.bssp"
#ERROR : Can't open dsspfile "1a3xA.bssp"
#ERROR : Can't open dsspfile "1a3wA.bssp"
#ERROR : Can't open dsspfile "2br2A.bssp"
#ERROR : Can't open dsspfile "2cdqA.bssp"
#ERROR : Can't open dsspfile "2c39S.bssp"
#ERROR : Can't open dsspfile "1a3wB.bssp"
#ERROR : Can't open dsspfile "2c38U.bssp"
#ERROR : Can't open dsspfile "1aqfE.bssp"
#ERROR : Can't open dsspfile "1dxfA.bssp"
#ERROR : Can't open dsspfile "1a7lB.bssp"
#ERROR : Can't open dsspfile "3cwcA.bssp"
#ERROR : Can't open dsspfile "1dxeA.bssp"
#ERROR : Can't open dsspfile "2c1gA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "1e7hA.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2bxiA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1ao6A.bssp"
#ERROR : Can't open dsspfile "1e7bB.bssp"
#ERROR : Can't open dsspfile "2ebhX.bssp"
#ERROR : Can't open dsspfile "1ddqC.bssp"
#ERROR : Can't open dsspfile "1bkeA.bssp"
#ERROR : Can't open dsspfile "2c1iA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2e4tA.bssp"
#ERROR : Can't open dsspfile "1bj5A.bssp"
#ERROR : Can't open dsspfile "2b9bB.bssp"
#ERROR : Can't open dsspfile "3cuoD.bssp"
#ERROR : Can't open dsspfile "2ec5A.bssp"
#ERROR : Can't open dsspfile "2a3lA.bssp"
#ERROR : Can't open dsspfile "3e7jA.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3btaA.bssp"
#ERROR : Can't open dsspfile "2acjC.bssp"
#ERROR : Can't open dsspfile "2auaA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3cpeA.bssp"
#ERROR : Can't open dsspfile "2b0lA.bssp"
#ERROR : Can't open dsspfile "3cuoC.bssp"
#ERROR : Can't open dsspfile "2a61A.bssp"
#ERROR : Can't open dsspfile "1dgsA.bssp"

## Summary of PDB Search
:796
    2e-43  10%  3bjfA  [x.x.x] PYRUVATE KINASE ISOZYMES M1/M2
    2e-41  12%  3e0vB  [x.x.x] PYRUVATE KINASE
    2e-33  12%  2c39W  [x.x.x] PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
    4e-33  12%  1a3xA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    9e-33  12%  1a3wA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    2e-31  13%  2br2A  [x.x.x] EXOSOME COMPLEX EXONUCLEASE 2
    4e-28   9%  2cdqA  [x.x.x] ASPARTOKINASE
    2e-27  12%  2c39S  [x.x.x] PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
    3e-27  11%  1a3wB  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    4e-27  12%  2c38U  [x.x.x] PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
    1e-21  11%  1aqfE  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    1e-20  15%  1dxfA  [c.1.12] 2-DEHYDRO-3-DEOXY-GALACTARATE ALDOLASE
    1e-20  14%  1a7lB  [c.94.1] MALE-B363
    5e-19   7%  3cwcA  [x.x.x] PUTATIVE GLYCERATE KINASE 2
    3e-16  18%  1dxeA  [c.1.12] 2-DEHYDRO-3-DEOXY-GALACTARATE ALDOLASE
    1e-10  15%  2c1gA  [x.x.x] PEPTIDOGLYCAN GLCNAC DEACETYLASE
    3e-10  18%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-10  18%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-09  18%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-08  13%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-08  18%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-08  17%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07  21%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-06   8%  1e7hA  [a.126.1 - a.126.1 - a.126.1] SERUM ALBUMIN
    3e-06  19%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-06   8%  2bxiA  [x.x.x] SERUM ALBUMIN
    4e-06  19%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-06  13%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-06   7%  1ao6A  [a.126.1 - a.126.1 - a.126.1] SERUM ALBUMIN
    7e-06  12%  1e7bB  [a.126.1 - a.126.1 - a.126.1] SERUM ALBUMIN
    8e-06   6%  2ebhX  [x.x.x] DERMONECROTIC TOXIN
    1e-05   5%  1ddqC  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    2e-05  11%  1bkeA  [x.x.x] SERUM ALBUMIN
    2e-05   8%  2c1iA  [x.x.x] PEPTIDOGLYCAN GLCNAC DEACETYLASE
    2e-05  19%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-05  17%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-05  14%  2e4tA  [x.x.x] ENDOGLUCANASE
    4e-05  10%  1bj5A  [a.126.1 - a.126.1 - a.126.1 (1e7cA)] HUMAN SERUM ALBUMIN
    5e-05   5%  2b9bB  [x.x.x] FUSION GLYCOPROTEIN F0
    7e-05  11%  3cuoD  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    8e-05   6%  2ec5A  [x.x.x] DERMONECROTIC TOXIN
    1e-04   6%  2a3lA  [x.x.x] AMP DEAMINASE
    2e-04  10%  3e7jA  [x.x.x] HEPARINASE II PROTEIN
    3e-04  17%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-04  18%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-04   6%  3btaA  [d.92.1 - h.4.2 - b.29.1 - b.42.4] PROTEIN (BOTULINUM
    4e-04  16%  2acjC  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    4e-04  10%  2auaA  [x.x.x] HYPOTHETICAL PROTEIN
    6e-04  23%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-04  14%  3cpeA  [x.x.x] DNA PACKAGING PROTEIN GP17
    8e-04  24%  2b0lA  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    8e-04  11%  3cuoC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    8e-04  14%  2a61A  [x.x.x] TRANSCRIPTIONAL REGULATOR TM0710
    8e-04  22%  1dgsA  [d.142.2 - b.40.4 - a.60.2] DNA LIGASE
:796

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bjfA           ----------------------------------------------------------------------
3e0vB           ----------------------------------------------------------------------
2c39W           ----------------------------------------------------------------------
1a3xA           ----------------------------------------------------------------------
1a3wA           ----------------------------------------------------------------------
2br2A           ----------------------------------------------------------------------
2cdqA           ----------------------------------------------------------------------
2c39S           ----------------------------------------------------------------------
1a3wB           ----------------------------------------------------------------------
2c38U           ----------------------------------------------------------------------
1aqfE           ----------------------------------------------------------------------
1dxfA           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
2c1gA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e7hA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bxiA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1ao6A           ----------------------------------------------------------------------
1e7bB           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
1bkeA           ----------------------------------------------------------------------
2c1iA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2e4tA           ----------------------------------------------------------------------
1bj5A           ----------------------------------------------------------------------
2b9bB           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
2ec5A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
3e7jA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2auaA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bjfA           ----------------------------------------------------------------------
3e0vB           ----------------------------------------------------------------------
2c39W           ----------------------------------------------------------------------
1a3xA           ----------------------------------------------------------------------
1a3wA           ----------------------------------------------------------------------
2br2A           ----------------------------------------------------------------------
2cdqA           ----------------------------------------------------------------------
2c39S           ----------------------------------------------------------------------
1a3wB           ----------------------------------------------------------------------
2c38U           ----------------------------------------------------------------------
1aqfE           ----------------------------------------------------------------------
1dxfA           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
2c1gA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e7hA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bxiA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1ao6A           ----------------------------------------------------------------------
1e7bB           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
1bkeA           ----------------------------------------------------------------------
2c1iA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2e4tA           ----------------------------------------------------------------------
1bj5A           ----------------------------------------------------------------------
2b9bB           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
2ec5A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
3e7jA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2auaA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxYLISSMLIFDYNLVSIRNFFGGFKEKASKVKFVDKKYEKDDYINL
3bjfA           ----------------------------------------------------------------------
3e0vB           ----------------------------------------------------------------------
2c39W           ----------------------------------------------------------------------
1a3xA           ----------------------------------------------------------------------
1a3wA           ----------------------------------------------------------------------
2br2A           ----------------------------------------------------------------------
2cdqA           ----------------------------------------------------------------------
2c39S           ----------------------------------------------------------------------
1a3wB           ----------------------------------------------------------------------
2c38U           ----------------------------------------------------------------------
1aqfE           ----------------------------------------------------------------------
1dxfA           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
2c1gA           --------------------------------------------------------------QKIESLKK
1e9sB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e7hA           ----------------------------------------------------KLVTDLTKVHTECCHGDL
1e9sE           ----------------------------------------------------------------------
2bxiA           ----------------------------------------------------------YICENQDSISSK
1e9rF           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1ao6A           --------------------------------TECCHGDLLECADDRADLAKYICENQDSISSKLKECCE
1e7bB           --------------------------------AWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGD-
2ebhX           ------------------------------------------------EVLKARASVIGKPIGESYKRIL
1ddqC           -------------------------PLVLLLRVLGYDQETLVRELSAYGDLVQGLLDEAVLAMRPEEAMV
1bkeA           -----------------------------------------------FAEVSKLVTDLTKVHTECCHGDL
2c1iA           ------------------------------------------------QLSEGNQK--EHFRQGQAEVIA
1e9rG           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2e4tA           -----------------------------------------------------------WGDASNNYTEA
1bj5A           --------------------------------AEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICE
2b9bB           ------------------------------TITPNTVYCRYNDAQVLSDDTMACLQGNLTRCTFSPVVGT
3cuoD           ----------------------------------------------------------------------
2ec5A           -----------------------------------------------PEVLKARASVIGKPIGESYKRIL
2a3lA           ---------------------------VPLEVPTSDEVEAYKCLQLELRKRYVFQETVAPWEKEEPFAHY
3e7jA           -------------------------------------------------------------SSSGYGGSD
1e9sF           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3btaA           ------------------------------------------------------IPYIGPALNIGNMLYK
2acjC           ----------------------------------------------------------------------
2auaA           --------------------------------------------------------------GTENLYNE
1e9rA           ----------------------------------------------------------------------
3cpeA           -------------------------------------------------NEAGKILIKHPSLAEEDGIHW
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KKKDGASEGNKESKKDDISEDNNKIKILDFMKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLS
3bjfA           ----------------------------------------------------------------------
3e0vB           ----------------------------------------------------------------------
2c39W           ----------------------------------------------------------------------
1a3xA           ----------------------------------------------------------------------
1a3wA           ----------------------------------------------------------------------
2br2A           ----------------------------------------------------------------------
2cdqA           ----------------------------------------------------------------------
2c39S           ----------------------------------------------------------------------
1a3wB           ----------------------------------------------------------------------
2c38U           ----------------------------------------------------------------------
1aqfE           ----------------------------------------------------------------------
1dxfA           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
2c1gA           EKDDQLSEGNQKEHFRQGQAEVIAYYPLQGEKVISSVRELINQDVKDKLESKDNLVFYYTEQEESGLKGV
1e9sB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e7hA           LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDV-----
1e9sE           ----------------------------------------------------------------------
2bxiA           LKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVV
1e9rF           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1ao6A           KPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA
1e7bB           LLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNY
2ebhX           AKLQRIHNSNILDERQGLMHELMELIDLYEESQPSSERLNAFRELRTQLEKALYLPEMEALKKQILQIPN
1ddqC           RLFTLLRPGDPPKKDKALAYLFGLLADPKRYDLGEAGRYKAEEKLGVGLSGRTLVRFEDGEFKDEVFLPT
1bkeA           LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEM-PADLPSLAADFVESKDVCKNY
2c1iA           YYPLQGEKVISSVRELINQDVKDKLES---KDNLVFYYTEQEESGLKGVVNRNVTKQIYDIEETEKTSLG
1e9rG           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2e4tA           GINLYTNYDGKGGKFGDTSVKCETSDIEVSSAYASIVGEDDSKLHIILLNKNYDQPTTFNFSIDSSKNYT
1bj5A           NQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYAR
2b9bB           RFVLFDGIVYANCRSMLCKCMQPAAVILQP-SSSPVTVIDMYKCVSLQLDNLRFTITQLANVTYNSTIKL
3cuoD           ----------------------------------------------------------------------
2ec5A           AKLQRIHNSNILDERQGLMHELMELIDLYEESQPSSERLNAFRELRTQLEKALYLPEMEALKKQILQIPN
2a3lA           PQGKSDHCFEMQDGVVHVFANKDAKEDLFPVADTDLHHVLKVIAAGNIRTLCHRRLVLLEQKFNLHLMLN
3e7jA           HTDFAANDGGQRLPGKGWIAPRDLKEMLA--GDFRTGKILAQGFGPDNQTPDYTYLKGDITAAYSAKVKE
1e9sF           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3btaA           DDFV-----GALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIV
2acjC           ----------------------------------------------------------------------
2auaA           TEFYAYHIVTRKKHIGQIPFNKNQHNTLYHFFFEREQLNANGEDGIQILNNHYKNDELHINNENAKVVIS
1e9rA           ----------------------------------------------------------------------
3cpeA           IKSQ--WDGKWYPEKFSDYLRLHKIVKIP--NNSDKPELFQTYKDKNNKRSRYMGLPNLKRANIK---TQ
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LDNTIIEQRGFNSEKAKEEESIDKEISNNIASKGSSVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bjfA           ----------------------------------------------------------------------
3e0vB           ----------------------------------------------------------------------
2c39W           ----------------------------------------------------------------------
1a3xA           ----------------------------------------------------------------------
1a3wA           ----------------------------------------------------------------------
2br2A           ----------------------------------------------------------------------
2cdqA           ----------------------------------------------------------------------
2c39S           ----------------------------------------------------------------------
1a3wB           ----------------------------------------------------------------------
2c38U           ----------------------------------------------------------------------
1aqfE           ----------------------------------------------------------------------
1dxfA           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
2c1gA           VNRNVTKQIYDLVAFKIEETEKTSLGKVH-----------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e7hA           -CKNYAEAKDVFLGMFLYEYARRHPDYSV-----------------------------------------
1e9sE           ----------------------------------------------------------------------
2bxiA           LLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLV---------------------------------
1e9rF           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1ao6A           KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQN----------------------------------
1e7bB           AEAKDVFLGMFLYEYARRHPDYSVVLLLRL----------------------------------------
2ebhX           KGSGAARFLLRTAMNEMAGKTSESTADLIR----------------------------------------
1ddqC           LRYLFALTAGVPGHEVDDIDHLGNRRIRTV----------------------------------------
1bkeA           AEAKDVFLGMFLYEYARRHPDYSVVLLLRL----------------------------------------
2c1iA           KVHLTEDGQPFTLDQ-------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2e4tA           IGNVWAFDRGSSNITQRTPIVNIKDNTFTY----------------------------------------
1bj5A           RHPDYSVV--LLLRLAKTYETTLEKCCAAADPH-------------------------------------
2b9bB           ESSQILSIDPLDISQNLAAVNKSLSDALQH----------------------------------------
3cuoD           ----------------------------------------------------------------------
2ec5A           KGSGAARFLLRTAMNEMAGKTSESTADLIR----------------------------------------
2a3lA           ADKEFLAQKSAPHRDFYNVRKVDTHVHHSA----------------------------------------
3e7jA           VKRSFLFLNLKDAKVPAAMIVFDKVVASN-----------------------------------------
1e9sF           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3btaA           TNWLAKVNTQIDLIRKKMKEALENQAEATK----------------------------------------
2acjC           ----------------------------------------------------------------------
2auaA           YDQTIRAARETIVEVRLQEFPEYPSRLSCL----------------------------------------
1e9rA           ----------------------------------------------------------------------
3cpeA           WTREMVEEWKKCRDDIVYFAETYCAITHIDYGVI------------------------------------
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxTLMSFGVEAKILQVTKGPSVTRFELQPKAGIKVSKIVNLADDIALGLAAKGVRIEAPIPGKSAIGI
3bjfA           ----DSPPITARNTGIICTIGPASRSVETLKESGMNVARLNFSHGTHEYHAATESFASDPILYRPVAVAL
3e0vB           -------AARIICTI--GPSTQSVEALKGLIQSGMSVARMNFSHGSHEYHQTINNVRQAAAELGVNIAIA
2c39W           ----------------------------------------------------------------------
1a3xA           -----------------------------------SDLRRTSIIGTIGPKTNNPETLVALRKAGLNIVRM
1a3wA           ----------------------------------TSIIGTIGPKTNNPETLVA------LRKAGLNIVRM
2br2A           ----------------------------------------------------------------------
2cdqA           ----YLNTIGVKARQYDAFEIGFITTDDFTNGDILEATYPAVAKRLYDDWMHDPAVPI---VTGFLGKGW
2c39S           ----------------------------------------------------------------------
1a3wB           -----------------------------------------------TIGPKTNNPETALRKAGLNIVRM
2c38U           ----------------------------------------------------------------------
1aqfE           -------------------------------------------------------------------IQT
1dxfA           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
2c1gA           ----------------------------------------------------------------------
1e9sB           -----------------------------------------------------------------NSVGQ
1e9rB           -----------------------------------------------------------------NSVGQ
1e9sH           -----------------------------------------------------------------NSVGQ
2c03B           ----------------------------------------------------------------------
1e9sL           -----------------------------------------------------------------NSVGQ
1e9sM           -----------------------------------------------------------------NSVGQ
1e9sK           ----------------------------------------------------------------------
1e7hA           ----------------------------------------------------------------------
1e9sE           ------------------------------------------------------------------SVGQ
2bxiA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1ao6A           ----------------------------------------------------------------------
1e7bB           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
1bkeA           ----------------------------------------------------------------------
2c1iA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sG           -----------------------------------------------------------------NSVGQ
2e4tA           ----------------------------------------------------------------------
1bj5A           ----------------------------------------------------------------------
2b9bB           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
2ec5A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
3e7jA           ----------------------------------------------------------------------
1e9sF           -----------------------------------------------------------------NSVGQ
1e9sA           -----------------------------------------------------------------NSVGQ
3btaA           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2auaA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EVPNKEQTPVFFREIVESKEFLDNKFKVACALGKDITGKAVVTDLSKMPHVLIAGATGSGKSVCINTLIV
3bjfA           DTKGPEIRTGLIKGSGTAEVELKKGATL-KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLI
3e0vB           LDTKGPEIRTGQFVGGDAVMERGATCYVTTDPAFADKGTKDKFYI-DYQNLSKVVRPGNYIYIDDGILIL
2c39W           ----------------------------------------------------------------------
1a3xA           NFSHGSYEYHK-SVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDVDYPIPPTDDKYAKACDDKIM
1a3wA           NFSHGSYEYHKSV-IDNARKSEELYPGRPLAIALDTKGPEIRTGTTTVDYPIPPNHTDDKYAKACDDKIM
2br2A           ----------------------------------------------------------------------
2cdqA           KTGAVTTLGRGGSDLTATTIGKALGLKEIQVWKDVLTCDPTIYKRATPVPYLTFDEAAELAYFGAQVLHP
2c39S           ----------------------------------------------------------------------
1a3wB           NFSHGSYEYHKSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDPIPPNHEMIFTTYAKACDDKIM
2c38U           ----------------------------------------------------------------------
1aqfE           QQLHAAMADTFLEHMCRLD--IDSAPITARNTGIICTIGPASRSVETLKEMIKSGMNVAGTHEYHAETIK
1dxfA           --------------------------QVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDSTFIPQL
1a7lB           ------------------------------------------TDYSIAEAAFNKGETAMT--INGPWAWS
3cwcA           ----------------------------------------------------------------------
1dxeA           --------------------------QVQIGCWSALSNPISTEVLGLAGWLVLDGEHAPNDISTFIPQLM
2c1gA           ----------------------------------------------------------------------
1e9sB           GEGAPFKRFLRGTRIVSGGKLKRMTRE----KAKQVTVAGVPMPRAEPRHLLVNGATGTGKS----VLLR
1e9rB           GEGAPFKRFLRGTRIVSGGKL-KRMTR---EKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAY
1e9sH           GEGAPFKRFLRGTRIVSGGKL-KRMTR---EKAKQVTVAGVMPRDAEPRHLLVNGATGTGKS----VLLR
2c03B           DFVERVREEALGKQVLESLTPAEVILAVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKT----TTAA
1e9sL           GGGAPFKRFLRGTRIVSGGKLKR--------MTREKAKQVTVAGVPEPRHLLVNGATGTGKSVLLRELA-
1e9sM           GEGAPFKRFLRGTRIVSGGKLKR--------MTREKAKQVTVAGVPEPRHLLVNGATGTGKS----VLLR
1e9sK           -----------FKRFLRGTRIVSGG-KLKRMTAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAY
1e7hA           ----------------------------------------------------------------------
1e9sE           GEGAPFKRFLRGTRIVSGGKLKRMTRE----KAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLR----
2bxiA           ----------------------------------------------------------------------
1e9rF           --GAPFKRFLRGTRIVSGGKLKRMTRE----KAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELA-
1e9sJ           SVGQGEFGGAPFKRFLRGTRIVSGGKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKS----VLLR
1ao6A           ----------------------------------------------------------------------
1e7bB           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
1bkeA           ----------------------------------------------------------------------
2c1iA           ----------------------------------------------------------------------
1e9rG           --GAPFKRFLRGTRIVSGGKLKR----MTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELA-
1e9sG           GEGAPFKRFLRGTRIVSGGKLKR--------MTREKAKQVTVAGVPEPRHLLVNGATGTGKSVLLR----
2e4tA           ----------------------------------------------------------------------
1bj5A           ----------------------------------------------------------------------
2b9bB           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
2ec5A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
3e7jA           ----------------------------------------------------------------------
1e9sF           GEFGGAP----FKRFLRGTR-IVSGGKLK-RMTREKAKQVTVAGVPEPRHLLVNGATGTGKS----VLLR
1e9sA           GGGAPFKRFLRGTRIVSGGKLKR--------MTREKAKQVTVAGVPEPRHLLVNGATGTGKSVLLRELA-
3btaA           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2auaA           ----------------------------------------------------------------------
1e9rA           --GAPFKRFLRGTRIVSGGKLKR--------MTREKAKQVTVAGVPEPRHLLVNGATGTGKSVLLR----
3cpeA           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWAVNEMTRRYKLFADNGVRNIE
3bjfA           SLQVKKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVH
3e0vB           QVQSHEDEQTLECTVTNSHTISDRRGVNLPGCDVDLPAVSAKDRVDLQFGVEQGVDMIFASFIRSAEQVG
2c39W           ----------------------------------------LGTTMVLAGTKLEIDKPYEDTPNQGNLIVN
1a3xA           YVDYKNITKVISIIYVDDGVLSFQVLEVVDDKLKVKALNAGKICSHKGVNLPGTDVDLPALSEKDKEDLR
1a3wA           YVDYKNITKVISAGYVDDGVLSFQVLEVVDTLKVKALNAGKICSHKG-VNLPGTDVDLPALSEKDKEDLR
2br2A           -----------------------------------------GTTMVLAGTKLEIDKPYEDTPNQGNLIVN
2cdqA           QSMRPAREGEIPVRVKNMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRE
2c39S           ---------------------------------KLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVD
1a3wB           YVDYKNITKVISIIYVDDGVLSFQVLEVVDTLKVKALNAGKICSHK-GVNLPGTDVDLPALSEKDKEDLR
2c38U           -----------------------------------------MVLAGTKLEIDKPYEDTPNQGNLIVNELL
1aqfE           NVRTATESFASDPILYRPVAVALDTKGPEPG---AAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAA
1dxfA           ALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAE----LAVASTRYPPEGIRGVSVSHRA
1a7lB           NIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLVALK
3cwcA           ----------------------------------------------------------------------
1dxeA           ALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRDYFAQSNLVQIE
2c1gA           ----------------------------------------------------------------------
1e9sB           ELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
1e9rB           T----GLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
1e9sH           ELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA----------
2c03B           KLALYYKGKRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDT
1e9sL           ---YTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
1e9sM           ELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
1e9sK           TGL----LRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
1e7hA           ----------------------------------------------------------------------
1e9sE           ELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ-------------
2bxiA           ----------------------------------------------------------------------
1e9rF           ---YTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
1e9sJ           ELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTD
1ao6A           ----------------------------------------------------------------------
1e7bB           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
1bkeA           ----------------------------------------------------------------------
2c1iA           ----------------------------------------------------------------------
1e9rG           ---YTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
1e9sG           ELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
2e4tA           ----------------------------------------------------------------------
1bj5A           ----------------------------------------------------------------------
2b9bB           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
2ec5A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
3e7jA           ----------------------------------------------------------------------
1e9sF           ELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA----------
1e9sA           ---YTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------
3btaA           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2auaA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           SYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYICRLAQMARAAGMHLVIATQRPSVDVITGVI
3bjfA           EVRKVLGEKGKNIKIISKIIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRP
3e0vB           DVRKALGPKENHSIIEESDGIMVARGDLGVEIPAEVVVAQKILISKCNVAGKPVICATQMLESMTYNPRP
2c39W           VELLPDENAIELALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEISKNEV
1a3xA           FGVKIIVKIENQEILKVTDGVMVARGDLGIEIPAPVLAVQKKLIAKSNLAGKPVICATQ-----MLESMT
1a3wA           FGVKNGVHMENQQNFDEILKVTDGRGDLGIEIPAEVLAVQKKLIAKSNLAGKPVICATQMLESMTYNPRP
2br2A           VELLPDENADSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNV
2cdqA           LIQQELDHVVEELEKIAVVNLLKGRAIISLGNVQHSSLILERAFHVLYTKGVNVQMISQGASKVNISFIV
2c39S           RSLR-----DSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNV
1a3wB           FGVKNGVHMIVKIENQQGVNNFDEILDLGIEIPAEVLAVQKKLIAKSNLAGKPVICATQ-----MLESMT
2c38U           PLAYETFEPGPPDENLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNG
1aqfE           DVHEVRKILGSKIENHEGVRRFDEILLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRP
1dxfA           NFGTVNITILVQIESQQGVDNVDAIAATEGVDHPDVQKAIQHIFNRASAHGKPSGILAPVEA--------
1a7lB           SYEEELQKGEIMPNIPQMSAFWYAVRTAVASGRQTVDEALKDGSQDPRVRGLYF----------------
3cwcA           ----LRRGIEIVTDALHLEACLADADLVITGERIDSGKVPIGVANIAKRYNKPVIGIAGS-----LTHGL
1dxeA           SQQGVDNVDAI-AATEGVDGIFVGPSDLAAALGHDVQKAIQHIFNRASAHGKPSGILAPVEA--------
2c1gA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2c03B           AGRIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGAALSARH
1e9sL           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e7hA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bxiA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9sJ           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLF--------------
1ao6A           ----------------------------------------------------------------------
1e7bB           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
1bkeA           ----------------------------------------------------------------------
2c1iA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2e4tA           ----------------------------------------------------------------------
1bj5A           ----------------------------------------------------------------------
2b9bB           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
2ec5A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
3e7jA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2auaA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           KANIPSRISFAVSSQIDSRTILDSAGAEKLLGRGDMLFYPVGESKPQRVQGAFISEEEVEHVVSFIKESQ
3bjfA           TRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQNLIAREAEAAIYHLQLFEELRRLAPITSDPTE
3e0vB           TRAEVSDVANAVFNGADCVML--------------SGETAKGKYPNEVVQYMARICLEAQSALNEYVFFN
2c39W           VGKLPLNYPVVSVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGMSLQDIDQAENTARS-T
1a3xA           YNPRPTRAVSDVGNAILDGADCVMLSGETAKGNYPINAVTTMAETAVIAEQAIAYLPNYDDMRNCTPKP-
1a3wA           TRAEVSDVGNAILDGADCVML----SGETAKGNYPINAVTTMAETAVIAEQAIAYLPNYDDMRN------
2br2A           VGKLPLNVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKGSMSLQDIDQAENTARS-T
2cdqA           NEA-------------------------------------------------------------------
2c39S           VGKLPLNVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKGSMSLQDIDQAENTARSTA
1a3wB           YNPRPTRVGNAILDGADCVML----SGETAKGNYPINAVTTMAETAVIAEQAIAYLPNYDDMRN------
2c38U           KLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGMSLQDIDQAENTARS-T
1aqfE           TRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLME
1dxfA           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
3cwcA           DAVFSVIYTI----CTLEDALKNASENVRTARNVAATLKAGQQLR-------------------------
1dxeA           ----------------------------------------------------------------------
2c1gA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2c03B           VTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDV----------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e7hA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bxiA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1ao6A           ----------------------------------------------------------------------
1e7bB           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
1bkeA           ----------------------------------------------------------------------
2c1iA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2e4tA           ----------------------------------------------------------------------
1bj5A           ----------------------------------------------------------------------
2b9bB           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
2ec5A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
3e7jA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2auaA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2a61A           ----------------------------------------------------------------------
1dgsA           -----------------------------------------------------MGEKSAQNLLRQIEESK


                         .         .         .         .         +         .         .:770
query           RDAQYEEDILEHINSATIASEGNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE
3bjfA           ATAVGAVEASFKCCSGAI----------------------------------------------------
3e0vB           SIKKLQHIP------MSADEAVCSSAVNSVYETKAKAMVVLSNTGRSARLVAKYRPNCPIVC--------
2c39W           AVKLLEE---------------------------------------------------------------
1a3xA           ----------------------------------------------------------------------
1a3wA           ----------------------------------------------------------------------
2br2A           AVKLLEE---------------------------------------------------------------
2cdqA           ----------------------------------------------------------------------
2c39S           ------VKLLEELKKH------------------------------------------------------
1a3wB           ----------------------------------------------------------------------
2c38U           AVKLLEE---------------------------------------------------------------
1aqfE           AMAMGSVEASYK--------------------CLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNH---
1dxfA           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
2c1gA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e7hA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bxiA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1ao6A           ----------------------------------------------------------------------
1e7bB           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
1bkeA           ----------------------------------------------------------------------
2c1iA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2e4tA           ----------------------------------------------------------------------
1bj5A           ----------------------------------------------------------------------
2b9bB           ----------------------------------------------------------------------
3cuoD           ----------------------------HPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRD
2ec5A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
3e7jA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
2acjC           ---------------------------MEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAK
2auaA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b0lA           ----------------------------EAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLES
3cuoC           ----------------------------HPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRD
2a61A           -----KQPFERILREICFMVKVEGRKVLRDFITPALQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEA
1dgsA           HERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELIEVGELTARAILETLKDPAFRD--LVRRLKE


                         .         .         *         .         .         .         .:840
query           CGVISRRDGSKPRQVLLSKDELExxx
3bjfA           --------------------------
3e0vB           --------------------------
2c39W           --------------------------
1a3xA           --------------------------
1a3wA           --------------------------
2br2A           --------------------------
2cdqA           --------------------------
2c39S           --------------------------
1a3wB           --------------------------
2c38U           --------------------------
1aqfE           --------------------------
1dxfA           --------------------------
1a7lB           --------------------------
3cwcA           --------------------------
1dxeA           --------------------------
2c1gA           --------------------------
1e9sB           --------------------------
1e9rB           --------------------------
1e9sH           --------------------------
2c03B           --------------------------
1e9sL           --------------------------
1e9sM           --------------------------
1e9sK           --------------------------
1e7hA           --------------------------
1e9sE           --------------------------
2bxiA           --------------------------
1e9rF           --------------------------
1e9sJ           --------------------------
1ao6A           --------------------------
1e7bB           --------------------------
2ebhX           --------------------------
1ddqC           --------------------------
1bkeA           --------------------------
2c1iA           --------------------------
1e9rG           --------------------------
1e9sG           --------------------------
2e4tA           --------------------------
1bj5A           --------------------------
2b9bB           --------------------------
3cuoD           EGLIDSQRDAQRILYSIKNEAVN---
2ec5A           --------------------------
2a3lA           --------------------------
3e7jA           --------------------------
1e9sF           --------------------------
1e9sA           --------------------------
3btaA           --------------------------
2acjC           KGKLQKEAGTPPLWKIAVSTQ-----
2auaA           --------------------------
1e9rA           --------------------------
3cpeA           --------------------------
2b0lA           AGVISRSLGMKGTYIKVLNNK-----
3cuoC           EGLIDSQRDAQRILYSIKNEAVN---
2a61A           DGYLTRPDPADRRAYFLV--------
1dgsA           AGV-----------------------