[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81490.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e5aA.bssp"
#ERROR : Can't open dsspfile "2ddwB.bssp"

## Summary of PDB Search
:142
    8e-19   6%  2e5aA  [x.x.x] LIPOYLTRANSFERASE 1
    4e-04  27%  2ddwB  [x.x.x] PYRIDOXINE KINASE
:142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGSAIASSSMAT
2e5aA           FPGINSKAIELQTWEWIYGKTKFSVDTSFTVLHSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLN
2ddwB           ---------------------------------------------------VKTDLKGTGDLFCAQ-LIS


                         .         .         *         .         .         .         .:140
query           ELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e5aA           SSLIGSKFSPIETT-----------VDELHSKWNILCEKIK-----------------------------
2ddwB           GLLKGKALTDAVHRAGLRVLEVM-----------------------------------------------


                         +         .         .         .         .         *         .:210
query           xx
2e5aA           --
2ddwB           --