[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81560.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cpgA.bssp"
#ERROR : Can't open dsspfile "1ct5A.bssp"
#ERROR : Can't open dsspfile "3e5pA.bssp"
#ERROR : Can't open dsspfile "3e5pB.bssp"
#ERROR : Can't open dsspfile "1b54A.bssp"
#ERROR : Can't open dsspfile "2dy3D.bssp"
#ERROR : Can't open dsspfile "2dy3A.bssp"
#ERROR : Can't open dsspfile "2dy3B.bssp"
#ERROR : Can't open dsspfile "2dy3C.bssp"
#ERROR : Can't open dsspfile "3b8uD.bssp"
#ERROR : Can't open dsspfile "1bd0B.bssp"
#ERROR : Can't open dsspfile "3b8wA.bssp"
#ERROR : Can't open dsspfile "3b8uC.bssp"
#ERROR : Can't open dsspfile "3b8wD.bssp"
#ERROR : Can't open dsspfile "3b8vD.bssp"
#ERROR : Can't open dsspfile "3b8uB.bssp"
#ERROR : Can't open dsspfile "3b8vC.bssp"
#ERROR : Can't open dsspfile "3co8B.bssp"
#ERROR : Can't open dsspfile "1bd0A.bssp"
#ERROR : Can't open dsspfile "3b8vA.bssp"
#ERROR : Can't open dsspfile "3c5qA.bssp"
#ERROR : Can't open dsspfile "3b8tD.bssp"
#ERROR : Can't open dsspfile "3b8uA.bssp"
#ERROR : Can't open dsspfile "3co8A.bssp"
#ERROR : Can't open dsspfile "3b8tA.bssp"
#ERROR : Can't open dsspfile "3btnA.bssp"
#ERROR : Can't open dsspfile "3btnB.bssp"
#ERROR : Can't open dsspfile "2dfeA.bssp"
#ERROR : Can't open dsspfile "1d7kB.bssp"
#ERROR : Can't open dsspfile "1d7kA.bssp"
#ERROR : Can't open dsspfile "3cu2A.bssp"

## Summary of PDB Search
:219
    1e-32  28%  3cpgA  [x.x.x] UNCHARACTERIZED PROTEIN
    5e-32  27%  1ct5A  [c.1.6] PROTEIN (YEAST HYPOTHETICAL PROTEIN, SELENOMET)
    1e-29  13%  3e5pA  [x.x.x] ALANINE RACEMASE
    2e-29  13%  3e5pB  [x.x.x] ALANINE RACEMASE
    6e-28  29%  1b54A  [x.x.x] YEAST HYPOTHETICAL PROTEIN
    1e-26  14%  2dy3D  [x.x.x] ALANINE RACEMASE
    3e-26  14%  2dy3A  [x.x.x] ALANINE RACEMASE
    9e-26  14%  2dy3B  [x.x.x] ALANINE RACEMASE
    1e-23  14%  2dy3C  [x.x.x] ALANINE RACEMASE
    2e-23  15%  3b8uD  [x.x.x] ALANINE RACEMASE
    3e-23  10%  1bd0B  [b.49.2 - c.1.6] ALANINE RACEMASE
    5e-23  15%  3b8wA  [x.x.x] ALANINE RACEMASE
    1e-22  15%  3b8uC  [x.x.x] ALANINE RACEMASE
    2e-22  15%  3b8wD  [x.x.x] ALANINE RACEMASE
    2e-22  15%  3b8vD  [x.x.x] ALANINE RACEMASE
    3e-22  14%  3b8uB  [x.x.x] ALANINE RACEMASE
    8e-22  15%  3b8vC  [x.x.x] ALANINE RACEMASE
    2e-21  13%  3co8B  [x.x.x] ALANINE RACEMASE
    2e-21  11%  1bd0A  [b.49.2 - c.1.6] ALANINE RACEMASE
    4e-21  15%  3b8vA  [x.x.x] ALANINE RACEMASE
    4e-21  14%  3c5qA  [x.x.x] DIAMINOPIMELATE DECARBOXYLASE
    5e-21  15%  3b8tD  [x.x.x] ALANINE RACEMASE
    5e-21  14%  3b8uA  [x.x.x] ALANINE RACEMASE
    3e-20  14%  3co8A  [x.x.x] ALANINE RACEMASE
    7e-20  15%  3b8tA  [x.x.x] ALANINE RACEMASE
    2e-18  12%  3btnA  [x.x.x] ANTIZYME INHIBITOR 1
    2e-13  12%  3btnB  [x.x.x] ANTIZYME INHIBITOR 1
    3e-12  13%  2dfeA  [x.x.x] RIBONUCLEASE HII
    3e-11  13%  1d7kB  [b.49.2 - c.1.6] HUMAN ORNITHINE DECARBOXYLASE
    1e-09  11%  1d7kA  [b.49.2 - c.1.6] HUMAN ORNITHINE DECARBOXYLASE
    1e-07  10%  3cu2A  [x.x.x] RIBULOSE-5-PHOSPHATE 3-EPIMERASE
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHL
3cpgA           --ITDGVHRVLDRIAASVRLLAATKTRDIGEIA-AIDAGVR-IGENRPQEVTAKAEGLAEHIPFHLIGQL
1ct5A           --LIAQYESVREVVNAEAKLLVVSKLKPASDIQILYDHGVREFGENYVQELIEKAKLLPDDIKWHFIGGL
3e5pA           --ITENVQKECQRLPEGTALFAVVKANGYGHGAVESAKAAKKFCVALLDEAIELREAG-VQDPILILSVV
3e5pB           --ITENVQKECQRLPEGTALFAVVKANGYGHGAVESAKAAKKFCVALLDEAIELREAG-VQDPILILSVV
1b54A           --LIAQYESVREVVNSKILLLVVSKLKPASDIQILYDHGVREFGENYVQELIEKAKLLPDDIKWHFIGGL
2dy3D           --IAHNTRVLKQMAGP-AKLMAVVKAGVEKVAPVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTP
2dy3A           --IAHNTRVLKQMAGP-AKLMAVVKHGVEKVAPVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTP
2dy3B           --IAHNTRVLKQMAGP-AKLMAVVKHGVEKVAPVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTP
2dy3C           --IAHNTRVLKQMAG-PAKLMAVVKHGVEKVAPVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTP
3b8uD           --LRHNLQRLRELAPA-SKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
1bd0B           --IYDNVENLRRLLPDDTHIMAVVKAGDVQVARTALEAGASRLAVAFLDEALALREKIEAPILVLGASRP
3b8wA           --LRHNLQRLRELAPA-SKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
3b8uC           --LRHNLQRLRELAPA-SKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
3b8wD           --LRHNLQRLRELAPA-SKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
3b8vD           --LRHNLQRLRELAP-ASKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
3b8uB           --LRHNLQRLRELAP-ASKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITK-PVLLLEGF
3b8vC           --LRHNLQRLRELAPA-SKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
3co8B           --LAYNVQYTKQVSG-AKTLWLAVKSGLLQVSKIARECGVDGLAVSVLDEGIAIRQAG-IDDFILILGPI
1bd0A           --IYDNVENLRRLLPDDTHIMAVVKAGDVQVARTALEAGASRLAVAFLDEALALREKIEAPILVLGASRP
3b8vA           --LRHNLQRLRELAPA-SKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
3c5qA           --IKQAFLNYKEAFKRKSLICYALKANSNLSILSLLAHLESGADCVSIGEIQRALKAGIKPYRIVFSGVG
3b8tD           --LRHNLQRLRELAP-ASKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
3b8uA           --LRHNLQRLRELAPA-SKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITK-PVLLLEGF
3co8A           --LAYNVQYTKQVSG-AKTLWLAVKSGLLQVSKIARECGVDGLAVSVLDEGIAIRQAG-IDDFILILGPI
3b8tA           --LRHNLQRLRELAPA-SKMVAVVKAGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFF
3btnA           --IVKKHSQWQTVVA-QIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELVSPENIIFTSPCK
3btnB           --IVKKHSQWQTVVA-QIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIFTSPC
2dfeA           --------------PVIGPMVIAAVVVDENSLPKLEELKVRKLTPKRREKL---FNEILGVLDDYVILEL
1d7kB           --ILKKHLRWLKALP-RVTPFYAVCNDSKAIVKTLAATGTG-FDCASKTEIQLVQSLGVPPERIIYANPC
1d7kA           --ILKKHLRWLKALPR-VTPFYAVCNDSKAIVKTLAATGTG-FDCASKTEIQLVQSLVPPERIIYANPCK
3cu2A           ----------------SVGILSANWLQLNEEVTTLLENQINVFSSLFTVGAIGI-KYFPTHCFKDVHLVR


                         .         .         *         .         .         .         .:140
query           QTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGXXXXXXXXXXXXXXXC
3cpgA           QSNKIGKVLPVVDTIESVDSIDLAEKISRRAVARGITVGVLLEVNESGEESKSGCDPAHAIRIAQKIGTL
1ct5A           QTNKCKDLVPNLYSVETIDSLKKAKKLNESFQPDCNPILCNVQINTSHEDQKSGEAEIFEVIDFFLSEEC
3e5pA           DLAYVPLLIQYDLSVTVATQEWLEAALQQLTPESNTPLRVHLKVDTG-MGRIGFLTPEETKQAVRFVQSH
3e5pB           DLAYVPLLIQYDLSVTVATQEWLEAALQQLTPESNTPLRVHLKVDTG-MGRIGFLTPEETKQAVRFVQSH
1b54A           QTNKCKDLAKVLYSVETIDSLKKAKKLNEKFQPDCNPILCNVQINTSHEDQKSGEAEIFEVIDFFLSEEC
2dy3D           EQDFRAAI--DRNIDLAVISPAHAKALIE---TDAEHIRVSIKIDSG--LHRSGVDEQEWEGVFSALAAA
2dy3A           EQDFRAAI--DRNIDLAVISPAHAKALIE---TDAEHIRVSIKIDSG--LHRSGVDEQEWEGVFSALAAA
2dy3B           EQDFRAAI--DRNIDLAVISPAHAKALIETDAEHIR-----VSIKIDSGLHRSGVDEQEWEGVFSALAAA
2dy3C           EQDFRAAI--DRNIDLAVISPAHAKALIE---TDAEHIRVSIKIDSG--LHRSGVDEQEWEGVFSALAAA
3b8uD           DARDLPTISA-QHFHTAVHNEEQLAALEEALDEPV------TVWMLDTGMHRLGVRPEQAEAFYHRLTQK
1bd0B           ADAALAAQQRIALTVFRSDWLEEASALYS----GPFPIHFHLKMDT-GMGRLGVKDEEETKRIVALIERH
3b8wA           DARDLPTIS-AQHFHTAVHNEEQLAALEEASLDEPV-----TVWMLDTGMHRLGRPEQAEAFYHRLTQCK
3b8uC           DARDLPTIS-AQHFHTAVHNEEQLAALEEASLDEPV-----TVWMLDTGMHRLGRPEQAEAFYHRLTQCK
3b8wD           DARDLPTIS-AQHFHTAVHNEEQLAALEEASLDEPV-----TVWMLDTGMHRLGRPEQAEAFYHRLTQCK
3b8vD           DARDLPTISAQ-HFHTAVHNEEQLAALEEASLDEPVT-----VWMLDTGMHRLGVRPEQAEAFYHRLTQK
3b8uB           FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVT-----VWMLDTGMHRLGVRPEQAEAFYHRLTQK
3b8vC           DARDLPTIS-AQHFHTAVHNEEQLAALEEASLDEPV-----TVWMLDTGMHRLGRPEQAEAFYHRLTQCK
3co8B           DVKYAPIASK-YHFLTTVSSLDWLKSADKILGKEK--LSVNLAVDTG-NRIGVRSKKDLKDEIEFLQEHS
1bd0A           ADAALAAQQRIALTVFRSDWLEEASALYS----GPFPIHFHLKMDTGMG-RLGVKDEEETKRIVALIERH
3b8vA           DARDLPTISA-QHFHTAVHNEEQLAALEEASLDEPV-----TVWMLDTGMHRLGRPEQAEAFYHRLTQCK
3c5qA           KSFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARISIRINPNLKENKFGVGEKEALEMFLWAKKS
3b8tD           DARDLPTISA-QHFHTAVHNEEQLAALEEASLDEPV-----TVWMLDTGMHRLGRPEQAEAFYHRLTQCK
3b8uA           FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVT-----VWMLDTGMHRLGVRPEQAEAFYHRLTQK
3co8A           DVKYAPIAS-KYHFLTTVSSLDWLKSADKILGKE--KLSVNLAVDTGNRIGVRS-KKDLKDEIEFLQEHS
3b8tA           DARDLPTIS-AQHFHTAVHNEEQLAALEEASLDEPV-----TVWMLDTGMHRLGRPEQAEAFYHRLTQCK
3btnA           QVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAK------VLLHIATEDMKFG-TTLKNCRHLLECAKE
3btnB           KQSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAK------VLLHIATEDMKFGTTLKNCRHLLECAKEL
2dfeA           PPDV---IGSREGTLNEFEVENFAKALNSL---KVKPDVIYADAADVDEERFAR----------------
1d7kB           KQSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKCRLSVKFG-ATLRTSRLLLERAKE
1d7kA           QVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKCRLSVKFG-ATLRTSRLLLERAKE
3cu2A           NQLEVAKAVVANGANLVTLQLEQYHDFALTIEWLAKQKTTYANQVYPVLIGACLCPETPISELEPYLDQI


                         +         .         .         .         .         *         .:210
query           NNVNVLGIMTIIPKGTEEECRKYFSKTHXXXXXXXXXXXXNIKMDILSMGMSGDYEIATEEGSNMVRIGQ
3cpgA           DGIELQGLTIGAHVHDETVIRRGFSHL--RKTRDLILASGEPGTDRCRELSGTGDELAIAEGSTIVRVGT
1ct5A           KYIKLNGLTIGSWNRDFATLVEWKKK------------IDAKFGTSLKLSGSADFREAIRQGTAEVRIGT
3e5pA           KEFLWEGIFTHFSTADEIDTSYFEKQAG---RFKAVLAVLEELPRYVHVSNSATALWHPDVPGNMIRYGV
3e5pB           KEFLWEGIFTHFSTADEIDTSYFE---KQAGRFKAVLAVLEELPRYVHVSNSATALWHPDVPGNMIRYGV
1b54A           KYIKLNGLMTIGSWENRDF--------ATLVEWKKKIDAKFGTSLKLSMGMSADFREAIRQGTAEVRIGT
2dy3D           PHIEVTGMFTHLACA-DEPTDRQIIAFR---RALALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGL
2dy3A           PHIEVTGMFTHL--AETDRQIIAFRRA------LALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGL
2dy3B           PHIEVTGMFTHLACAPEDRQIIAFRRA------LALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGL
2dy3C           PHIEVTGMFTHL--ACADEPPETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGL
3b8uD           NVRQPVNIVSHFARADEPKCG-ATEKQLAIFNTFCE-----GKPGQRSIAASGGILLWPQSHFDWVRPGI
1bd0B           PHFVLEGLYTHFATADEVNTDYFS---YQYTRFLHMLEWLPSRPPLVHCANSAASLRFPDRTFNMVRFGI
3b8wA           NVRQPVNIVSHFARADEPK-CGATEKQL-----AIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGI
3b8uC           NVRQPVNIVSHFARADEPK-CGATEKQL-----AIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGI
3b8wD           NVRQPVNIVSHFARADEPK-CGATEKQL-----AIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGI
3b8vD           NVRQPVNIVSHFARADEPK-CGATEKQLAIFNTFCE-----GKPGQRSIAASGGILLWPQSHFDWVRPGI
3b8uB           NVRQPVNIVSHFARADEPK-CGATEKQLAIFNTFC-----EGKPGQRSIAASGGILLWPQSHFDWVRPGI
3b8vC           NVRQPVNIVSHFARADEPK-CGATEKQL-----AIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGI
3co8B           DHFSYDGIFTHFASSDNPDDHYFQRQKNRWYELIDGLIPRYVHVNSGAAYHS----KELPGCNSIARVGT
1bd0A           PHFVLEGLYTHFATADEVNTDYFS---YQYTRFLHMLEWLPSRPPLVHCANSAASLRFPDRTFNMVRFGI
3b8vA           NVRQPVNIVSHFARADEPK-CGATEKQL-----AIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGI
3c5qA           AFLEPVSVHFHIGSQLLEPIIEASQKVA---KIAKSLIALGIDLRFFDVGGGIGVSYENEETIKLYDYAQ
3b8tD           NVRQPVNIVSHFARA-DEPKCGATEKQL-----AIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGI
3b8uA           NVRQPVNIVSHFARADEPK-CGATEKQLAIFNTFC-----EGKPGQRSIAASGGILLWPQSHFDWVRPGI
3co8A           DHFSYDGIFTHFAFQRQKNRYELIDGLIPRY----------VHVNSGAAYHSKEL----PGCNSIARVGT
3b8tA           NVRQPVNIVSHFARA-DEPKCGATEKQL-----AIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGI
3btnA           LDVQIIGVKFHVSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTGTEIQLEEVNHVISPLLD
3btnB           -DVQIIGVKFHVSSACKEYYVHALSDAR-CVFDMAGEFGFTMNMLDIGGGFTGTEIQLEEVNHVISPLLD
2dfeA           ----------------------------------------------------------------------
1d7kB           LNIDVVGVSFHVGSG-CTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGSEDVKLKFEEITGVINPAL
1d7kA           LNIDVVGVSFHVGSG-CTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVI
3cu2A           DVIQLLTLDPRNG--TKYPSELILDRVIQVEKRLGNRRVEKLINIDGSTLELAKYFKQGTHQIDWLVSGS


                         .         .         .         +         .         .         .:280
query           GIFGKRLYK
3cpgA           AIF------
1ct5A           DIFG-----
3e5pA           AMYGLNPS-
3e5pB           AMYGLNPS-
1b54A           DIFG-----
2dy3D           AFYGLEPVA
2dy3A           AFYGLEPVA
2dy3B           AFYGLEPVA
2dy3C           AFYGLEPV-
3b8uD           ILYGVSPL-
1bd0B           AMYGLAPSP
3b8wA           ILYGVS---
3b8uC           ILYG-----
3b8wD           ILYGVSPLP
3b8vD           ILYGVSPLK
3b8uB           ILYG-----
3b8vC           ILYGVS---
3co8B           VVYGVEPSE
1bd0A           AMYGLA---
3b8vA           ILYGVS---
3c5qA           GIL------
3b8tD           ILYGVSAS-
3b8uA           ILYG-----
3co8A           VVYGVEPS-
3b8tA           ILYGVS---
3btnA           IYFPEG---
3btnB           IYFPEG---
2dfeA           ---------
1d7kB           DKYFPSDS-
1d7kA           NPALDKY--
3cu2A           ALFSGELKT